TCONS_00072678 (transcript) - C. hemisphaerica

Overview
NameTCONS_00072678
Unique NameTCONS_00072678
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length11708

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00072678 ID=TCONS_00072678|Name=TCONS_00072678|organism=Clytia hemisphaerica|type=transcript|length=11708bp
GCAGATCtgcaattaaaattaaaatgattgactgacaataaaataacaaa
caaaaaatggtatttgaaTCTTTGGTTGCTGACCTCTTGAACAAGTATCT
GGGTCAATATGTGAAAAATCTTGATGCTTCTCAATTGAAGATTGGCATTT
GGGGAGGAAATGTTGTCCTGACAGAACTTGAACTGAAAGATACAGCTCTG
GATGATCTTGACTTACCCATAAAAGTTGTTCGTGGATATTTGGgtAAATT
GGTCTTGTCCATCCCATGGAAAAATCTTTACACTGAATCAACTGTTGTCG
ATATTCAAGATCTCCACCTTGTCGCTAAGCCTAATTTTGACATCAAATAC
AATGAAGAACgcgaagaaaaatcaaaacatgacAAGAAACAACAACAGAT
TCACAATATCGAAGAAGCGAGGCAAAGAGAAGAAGACAAAAAGAAAGGCG
CCAAGAAAGAAGAGAGTGACGGTTTTGCTGAGAAACTTGCAACAAACGTC
ATAAAAAATCTACAGGTTACGATCAAGAACATACATGTTCGATATGAAGA
CTCAATCAGTGATGTGAATGGACCCTTTTCAGTCGGTCTTACAATGGAAA
GTTTAACAGCACAAACCACAGATGAAGATTTTGTTCCAAAGATTATCAAA
GAATCTGTCTCATTAATTCATAAGatggTGAAATTAGACAATTTGGCTTT
ATATTGGAATCCAGGAGACGAACTGATTGATCCTTCACTTGATACCAAGC
AATGGTTGgaagtTTCAACGAAGCAAATTTCAACACACCAATCGAAGCCA
GAGAAAACGAAATATATTTTGAGTCCCATGGTTGCAACGAAGAAATTGAA
GCTGAACACCAAACCAGGTTCCAACCTTGACATCCCGAAGatgttTTTGA
ACTTGGTTTTGGAAGAACTTGGTATCATCGTGGCAAGAAGTCAATATCAT
GGCGTGGTGCAACTGATTGAATCATTTGAACGAATGAATAGGAACCAACC
TTTTCGTAAATACAGACCACATACCTCCGTTCTTGGGAACGAAAGTATTT
GGTGGAAGTACTGCATGTCCAGCATACTGGAGGTGGATGTCAAAAGACGA
TCTCAAATGTGGAGCTGGAAGCATATTCAAAAACATCGAGTTCTTTGCAA
AGCTTACAAAGTGAAGTAcaaggaaaaattgaaacagaaaaATCCATCCA
AACAAATTCTCACTGAACTAGAGaGCATGGAGGATGAGTTGAATATTGCA
AGCATCACCATTTTTCGACAGCTTGCAGCTACAGAGGTTTTAACGGAACA
AAAGAAGAAAGGCACTAAAGGAAGTTTCTTCAGTTTCTTCTCCAGATCAA
AAGAACCAGAAAAGTCTGCTGCTAATAAAATTGGAGATTTAATGGGTGAT
GACCAGGAGAAGGAAATGCAGAAATTGTATGACGCAATCGGTTATACTGA
AAATGAAGTCATCACTCCCTTTCCTAAAGAGTACGTGGCGATGTCAGTGG
AATCGATTCTCCAGAAATTATTCATCAGCCTCATCGATGACACAGATAAG
GCGAAAGAATTCAAAGTGTTGGATTTTTCACTCAACAACATCATTGTAGA
AGTTTTCCAAAGACCTTCTGCTCAAGCTCTCAAATTATGTGCAAAGATAG
GAGAGATGAAGTTATTTGGTACAGCTTCTGCTCAATGTACACCTCtcatc
atcaaaaacatgttaCAAGGTCGAGGTATGGAATTTCTGCCGTTGGTGGA
CTTCATCTTTGAGACGAATCCTTTGAAGAAACCGGACATTGACCAATGTA
TCACTGCTATTTGTCAACCCTTAGAAATCATCTATGATGCTAACACGATC
AACCATATCATTAGTTTCTTCAAACCTCCTGAACATGTTATCTTGCAAGA
TTTACAAGACAAAGCGTATTCTACTTTCGAAGATTTTAAAGTTTCAAGTA
CGGCTGGTCTTCTACATGCTATGGAACAAAGAACGGTTATGGACATCGAC
ATTGATGTTGGAGCATCTCATTTGATCATCCCTGAAAAAGGTTCTTACAA
TGGTTGTACAGATATGCTGGTGATCGACTTTGGTAAAATCACGATGAGCA
GCGATCCTAGTCAAATCAGACACCTTGACCCTAAGGACATTGAGGATGTG
AATGAAGTACAAAGCAAAGCTTATGATCGATTCTTGTTGTCGCTTCAAGC
TCTTCAAATATTACTCGTTAGAGAAGGTGAAGATTTAAAGAGTGCTAAAA
GCAACGTCAGTAAAGCTTCATCACACATTTTGCATCCCATCAATTTCGAT
GGCAAACTTGCCAAAGCTATACTTCCACAAGATCCACGTTTAAAACAGAT
ATGTGTCTCTGGTGAATTATCTTCGCTGTTTGTTTCTGTATCGGATGATA
AAGTCAGTCGTCTCATCAAGCTAGCAGACTCGATACCACTCCCTCAATCA
CCTTCTCACGATAACATCGACGGAGAAGAAAAACCTGAAGGACTCTTCAC
CAAGGCGTTGTCAATGATAAGCTTGACAGGTGACAATGACACAGGGGTGG
ACATCGGAGGATTTTCCATCCCTGTACCGACATCTCCAACATCAGTGACG
TCAGATGAAGATGAATACGGGACACCACCTGATGGCTCCATATTACAGTT
ACAACAAGAAGCTGGTCCGGACTTTTCATCAGGAGTGGCGAACCAAGTCA
AAGTGGACTTGAACTTTAAAATCCATAAAGTGATGATCGCCATTGGTTTG
ACTGACAAAGCATTGAAACAGGAAAAAGAATGTCTGAAATTCATCGTGGA
CGACATCAATACAGAGgtGATACTACGAAGATGGGATTTGTTCGTCAATG
CAGAAGTTGGTCGTCTGGTGTTGAATGAAATGACATGGGGTGTTGATGGA
GAACCTTTCGCCATCATGAGTACacccaaaaacaccaaaatgttGAAATT
CAGCTATCGGAGGTGTGAATTCAACGAAAGTTTGAATCTCGGTCCAAGTT
ACTTTTATTCCAAAGAAGCGCAAGTCAGAGCTTTACATTTCAAAGATGAA
TTTGGCGCCACGGATCAGATTTTAGATGTACAAGTGGCTACTTTATTTCT
GATGCTTCATCAAGAAGCACTTTTGAGCATCATGTCATTGATCTACCAAG
TACTGGAACCACTCAACAAACATGATAAGGAAGCCACACAGAAGATCAAA
CGGAGTTTGAGTACGGCAGGTAGTCGTTTGAGTCTCTCCatcgaagaaaa
agaaaaggagaGACAGATACAACGAAAATTAGCCAACCCTAAAGCACTGG
AAGCTGCCAACGAACTTAAGCAACAGGTTGGcttagaagaagaaaaaaag
atgaGAGTGACCGCCCACCTGGATGGTGTTGGTATCATGATTTGTTCAGC
CAAAGTTGACCTTGCACAAGCCTTCGTTAAAGGGTTATCTGCTAAAGTAC
TGATGAAAGATGACTTATTAGAAGTGAAAGCCAGCATGAAAGATATGCAA
GTACAAGATAATGTTGGCGAAACAAAGTACAAAGACATCATTAGCATGCG
ATCTGATGAAGTGTTCGATTTAGAGTTGGCTATTTACGAGAATGGATCTT
CTGGTAGCAAGCAATACGATATGTCGTGTGTCGACACCAGTGTCAAACTG
AACTTCGGTCAAATGCGCGTTGTTTTCTTGTATAGATTCATACAAGACTT
AATGTCATTCACCGAAAACTTCGAAGAAGCACAGAAAGCAGTTGTGGAAG
CTGGTAAAGCTGCCAAGGATAAAGCTCTGGAAACAGCGACCGATTTGAAT
AGACATTCTTCTCGTGTCAAACTAAATGTGGTTCTGAAAGCACCGACTAT
TATCATTCCAGTTGGATCAAACAATGAATTGGCTTTACTGGTGGATCTGG
GTGAATTGCGTATTTACAACACATTCAAACTCCTCAACGATGATCAATAC
CATAAGAAATCTATCATCACTGATAACATGACCATTAAGTTATCCAATCT
GAAATTGTTAAAAGCACTTATTCAAGATGGTAAAGATTTCTTGCATCAAC
GAGCCATTATTGAACCTATGATGCTACAAATAACTATTGTTCGTAATTTA
ACGAAAGGTAACCATTCCATACCGGATGTTTCAGTTCAAGCAAAGATGCC
AGCTATTCTGTTATCAATCAGTGAAGAAGATGTGACCGTAGCTCTAAAGA
TTGTCCAAGGGAATCTCGCCGAAGGTGAGTCACATGCGCCGAAGAAGCAA
GCCAAGCCTGCCAAACAAACGTTAAACGTGCCACAAGATCGTTTAGCAGA
CATTTACGAGGAGcctgaagatgaagatgagaaTCGACAAGGATATCTTC
AAACCAAACTATCCTTCGATCTGGCTAAAATTGACATCAAGCTTTACTTG
AAACCATCTGATATGACATTTGAAGATGAATTTTTAGCGAGGACGGATGA
TTTGTTGTTAGCTTTGTTCACTATTGGTAACCTGTGTGTTGATGGAGACA
TCATGTCCACGCAAGCTATGAAGATGAGCGTTCGATTGGACACTTTGGTG
TTGGATGATATGAGACCTATCGAGGAGCATGAAGGTGTTAAACGTATGAT
CAACTACAGTCCCGAGCCACTCCTTGAAGAAGTCAAAACCTCTTCTCATA
AACGACCAATCGACAACTCACGAATGATCGAAATCCAAttcgatcaaact
tcatcgcaagataaaaatatcgacATCAAACTTTGTAACATGCTTTGTAT
ATTCAACGTTGAGTTTATCATGGTCCTGTTGAAAACGTTGCAAGCTGCCA
TACCTAAAGATGATAGTCTGCAACATGGCCATTCAATGAGTAGTCTAGAC
TCGGCGGCAGGGTCTGGCGGCAGCGATGACGAGGACTCTTTAGAAGCCAG
CGAGATTGTCCTCTGCACTGGTGATCAAGAAAGACCTGAGACTAAAGTCT
CTATCTTCGTCCATAACCCGCAAATTGTTTTACTAGCAGATGCAAAGGAT
GTCAAAACAAATGCACTCTTTCTTACAACCGagatcaattttcaatattt
cgaaTTGCGAGATACTCAAAAAATGATTGGCGCTGTTTCTAACACCGCTA
TTTTGTCAACTGCTTTCAAGAATGACCATCGGAGTGATATATCAACAGTG
TTGTCATTAGATTCCATCAATCTCCACTCGTCATCACCCATCAATGGTAA
ACCTCATATGAGTGTCAGCACAACTTTGATCAAACTGAATATCTCACCCA
AAACCATCCGAACTTTATCAGCGTGTGCTGGTTACATCTCCAATGATCCA
ACAGATGAAGAAATCAAAGAAGCTCGAAAAGCCATGCGTGATTTATGGCA
AATTCAAACGTTCACCAATAAGCGACCGTGGTATTTAAACCACCCACCAC
AACAAGTCTTAAGTGCTGGCAGCTTCGTCCTTGCGCGAACGAGAACAGGA
GAATATAAGCATGGTTTCTTAGCTAAAAAGGATGTCTCGTATCAAGTCTA
TTTTTCAGAGGAGCGAGGAACAGCCAGTCACCGAGCCATGGATATCTCAT
CTGTTGTTTTGGATATCGTACCGCTGATCGGTGATCTATGTGTTGGATGT
AATGTTTTAGCTGTGGAATCGAAAGAACATGGATATCGTACTGGTCGAAT
TACTCAGGTTTGGGATTCGAATGTGGATAAAGATTCTTCGGATGGCGCCA
AACAATCTGTTTCTGTCAAGACAACTGCTATTGCTCCAATCAAATACCTT
GTCAATTTCTATGACAACCAAACGGAGAACTTCTTCCCGCCTGATGAACT
TCGTATCATTGGTAAACCCATCAAGGGGGTTGTCCCTGGACTAGGGGCGT
GTGTTTACGCCCGCTTTAATGATGGTTTTTACTATCGGGGCAAAGTTGAT
GACATCGAGGATTATCGAATCCGAGTGCAATTGGATGAGATCAGTGGAGA
AATCGAACACGACATCGATGATCCGTCAGCCGTTATTTTGAACCTGACGC
CTCAATACCGTCAAGTCAAAAAGCATTTCAAAGTCATTGCATCCAAAGGA
AGCACAACTAAAGGATATCATCCGGGGAAAGTGACCGCCATCCAAGGTGA
AGGAAATAACCGATTGTATTCGATACGCTTCGAAGACGGTACAATTAACC
AAGTACCCATCacgaaattgattttgatgccAAAAGCACCTTTTGATGCT
TTACCTGAAGTTGGCACATACGTTTATTCCCGAGTGTCACGCGACGCTCC
TTTATACGAGAAGGGTATCGTAGCAGAGAAGAACACAATGATCTGCGTTA
AACATTTAAATGGACGGAAATTGGCTCACGAAATACAAAACATTCATTTT
GTTGTCCGAAATATCGTTCCTCTCGTGTCATCAttgaagGTTGGTTTGGA
CGTCATAGTGCAACCTGACAATGACGATCAGAAAATGTATTTGGCTGTCA
TTAGGGAAGTCACCAAAAAAGAAGGTGACAAAACGAACCGTTATCTAGTG
GAGTTTACGGATGGATCCAAGAAGAGAGTGACGCCCAGCCGGATCCGTAT
ACTTTCTCAATACGGAAGTGCAGAAACGAGTGAAGAAAATGCTGACATTA
TCACAACAAGACAGGAGGAACTAGTTCTCGATGTGCAAGGTATCTCATTA
CGTGTGGAAGGTTACTTGGGAGGCGTGTTGACACCCATGCTCAAAATGGA
TTCCAAAATCACAGCTAACTTGAAGGATTGGTCAAGCCAAATGAATGCAC
ACGCTACTGTATCATTAGAAGCCAGTTATTATAACGAAAACGTTGCCGAA
TGGGAGCCAGTTATTGAACCTTTGATGGAGAAACGGAGGGAAAGACCGTG
GCAACTCTCTGTCAATTACACGATGGAAGGTGACGACAATTCTGCTTCAT
CCACTTCCAACGAACTCGTTTTACAAAAACCGGAATCCAACCTGAAAATC
AAATCTCAAGATAATCTTGAATTGACAATTTCAAAATCATGTCTTGCTTT
ACTCGGTGAATTGGGACAGGTGTTTGGAGATGCAGTAGAATCTGTGGACG
TTTTACCACAAGTCCTGGTCGAAAAAGAACCTTTCATGATCGAAAACTTG
CTCTCCAAGAAGGTGACAGTAACATTGAATGAACTTCTGCAGGGACCAAA
TGGAGATTCGACAATCGAGCTAGCATCTTCTTCGAATCCTGTTGGCATTA
CTTTTGCTCCCAagaaatttgagaaacgaaAGACCAACGATCTATACACA
ATCAATTTAtcgGTGGACGGTTTTCATGACATTAAAGACATTGTGGTTCA
AAGAAAGCGAAGCGTTATCTATGATCTTGTACCAATAAAACTATTATCAG
CACAGTCTTCATATTCGATAGTGGTACAAGTGAAGACAACAGACGGACAA
CGTATCATCGTACTCCGATCACCATTGCAGTTGAAAAATCACTTTCCAAT
GCCGTTGGATGTCAGCTACATTTCCAAAGAAAACCAACCAGTTAAACTGA
CAACAGTGGGATCGGGAGATATCTATTCCTTCCCTTTGTTGTTAACCTAC
CACAGTGTTTTTCATCTCAAACCTGCTGGTTTCGACTACGGTGATTGCAC
AGAAGCTCTCAATTGGAGTGATTTGAAGACGAGCAACGAAAAACAGTTCT
CCTGCCCTTCACCTGACAAAAGTGCTGACCCTTTCTACATGCAGGTGGTG
ATGAAAGAGGAGACGTACTCTTCCGTACACGGCATGTTGGACTGTGTACC
ACGTTACACGTTGGAGTGCTTTCCCGTCATCACGCTGCATAATTACCTAC
CTTGCACTATTAATTATAAGATCAAGGGTATGGCGAAATCGGAAAGTCTA
CCAGGCGGACACAATTGGCCTTTGTTTACCGTCAACTTCAGTGATAAACC
TTCCATCTATATCGAGATTGAGTCGTATAACAACCAAAGATGGGAAGGAG
GTTTGACATTACCAACAAAACCGGTAGATTCTTTGAACAAACCATCATTA
TCTTTCGTCATGATGTCTGGTGAACGCAAAATGGAATTGGGTGTTTATTA
CCAGTTAGACGGTTCATTGAACATCACCTTATATTCGCCTTACTGGCTTC
TCAATAAAACTGGAAAACCACTTGTCTATCAGCCAGCGGGGAGCAGCATC
CAGCAAGTTCACCAAGAGAACGATGTAAATGCTCTTATGATGCTCGTCAA
AGGGAAACATAAAAAGgcgaaagtgaaagtgaaaaataGCGAGTCATGGT
CAAATGAATTTTCATTGGATACTGTTGGCAGTGGTGGTTCCTTGAAATGC
AATGGTCCAAGAGATCGAGTTTATGAGATTGGTTTGAACATCAGTTTGTC
ATACTTTGGATTGACGAAGATTGTGACGTTCACGCCACTCCGAATGTTAT
CTAACCACACCAAGTACACCATCAGTATGGCAGAAAGTAATTCTAAATCG
TCAGAATGGCACACGGTAAACCCTGACGAGaacattccatTCTGGCCGAC
GAAACTTCCTTTGGTCAACCTTTACATTAACATCAATGGGCAAGATTCAG
TGAAATTCAACCCTGAAGTTGGAAAAACTTTACTGTTGAAGTTCCAGAAT
GAGGTTGGAGGAGTTTGCGTGGATTACCAAGAAAAGGACTCGTCCTCAGT
CCTTTCGTTTAATCCGTACTTCGCAGGTGCAGCTCCTGTGCGGCttgaaa
atctttgcaaaaaGATCGGCATGATCGCTTATAAACAAGCAGGTTCGGTA
ATGGGTCACGTGTTAACACATGACCAATCAGTGTTGTACACGTGGGATGA
TCCAACCATGGAACAAGAATTGATTTGTTCCATTGTCAATGATGAAGCCA
GTGAAACAAGGATCAAACTCGATGCCAACGATTTCGGACGAATGAGAGTT
GGAGATGGTGCAATTTATTGGGTTTCCTTTCTGGATGGTCTTCAACGTGT
TCTATTGTTCACTGATAACTTCAAATCTGCTTACTGCGCATGTCAGgaGC
AAAATTTACGCCCAACCATGGAAGTTGACTTTGAGATTGAGAGTTTTGGT
TTGTCTCTGGTCAATGTTGATAAGAGAATGGAGATTGGCTACTTAGCTAT
CCGACAAAGCAAGACTGTATGGGAGCAACGCAAGAAAAAGAACCGCTGGA
AAGCTTTACCGCTTGCCATGTGTGAAGCTCTCGAAGAAGGTTATCTCAAT
TATCAAAACAGAAAAGGTGCAGTCAAAGAGAAAGTTCTGGATAAGGAGGT
GGATTACGAGAAGATGTTTATTACGAAACCTGAGAAGATTAAGATCAGAA
GAACGTACCACAGCGGTCTTGGTTTCAAATACACAATCTCACCCAATGAA
ATGCGTGTGCATGCTTCTATCAGCTCAATACAGTTGGATAGCCATGTTCC
AGGTTCGACCTTTCCAACAGTCTTGCATATGGTTGAACCACCAAAATCTG
TTGCTTCAGAAAACGCTCCAAAGCCATTCTttgaattgagtttaatgaCA
AGGATCGGTGATAAAAATGTGGTCAATGAAGTcagCTATTGTCACGTGTT
GATTCAAGAGATGGATGTGAGGGTTGATATTGGATTTTTATTGGCTCTGA
TGGAACTCTTCAGTCATGCAAGAGCTCGAACAACCGAGAAAGAACAATAC
GCGCTTGATATTGGCCAAGCAGCAACAAAGTTTGAAGAAAGCGCTGAATT
TCAGGCAGCCAAACAAGATCGATATTACGTTTTGAACGACTTTCATTTAT
CACCGCTAAAGATTCACGTCAGTTTCTCTTTGACGGGTGGTTCCAAAGAT
GAAAATGCTATTGCTTCATTACATGGTAACGTGTTGAACTTGTTGTTACA
AAGTGTCGGACTGGCCTTCACTGAAATACAAGACGTACAATTCAAATTAG
CATGTTACGAAGTGCATAAGTCCATGCAGAGTAATTCGCAGCTCGGTGAT
GGAATAACTAAACATTATCAAACACAGGCTATCAAGCAACTTTATGTGTT
GGTACTCGGGCTAGACGTTCTTGGTAATCCGTATGGTTTGATATCTGGTG
TTGGAACCGGAGCAAAGAATTTCTTCTACGAACCTTACCAGGGATTAATT
CAAGGACCAGAAGAATTTGCGGAAGGATTGGCGTATGGGGTGAAGAGTCT
TGTTGGTGGAACCGTGGGTGGAGTATCAGGAGCTGTGAGTAAGATTACCG
GTACCTTCGGTAAAGGTTTGGCTGCATTGACCTTGGATGAAGAATATCAA
CAAAAGAGACGTGAAAACATGAGCCAACGCCCAACTAACCTCGGTGAAGG
TCTCGCCAAAGGTGGTAAAGGCCTTGTAAAGGGTATCGTGTCTGGTGTTA
CAGGGATCGTTACCAAACCCTATGAAGGTGCCAAGAATGATGGTGCAGGT
GGCTTTTTTAAGGGCGTTGGAAAAGGCCTGATTGGCGTGGTTGCACGCCC
TGTTGGTGGAGTGGTAGATATGGCCAGTAACACGTTTGATGGTTTGAAAA
GCACGACATCTGGCGTGAAAGCGATCGAGTTGAGCCGTGTTACTCGCGTC
TTCCACGCAGATAAGGTTTTACGACCTTTCAATCTGTACGAAGCAGATGG
AAACAAAATTCTTATGCAATGTAACAAAGGAGAATACGCCAAGAAGAATT
TTTATATCACTCATGTAGTGGACAAGAAGAACTATCTCATCCTCACTCAA
TCaaacATTTTGTATGTTGGAAAGAACGAGTTGAAAATGGGTGAATGGGA
ATCggtttgggttatcgagttcaATGAGCTAAAACGTGAACCAGAAGTGA
AAGAGACAAAGATTATTTTCCATATCCATAATACGGACACGCGACGTTCA
ATTTTCAAGAAATCGACGAACACACGTGAAGTGATATTGGAGTCTAGTGC
TGTTGCAGACTGGTTTATCTTAAAGCTTAGAGATGCTAAAATGTTATAGA
ATGAAAATTGTGCCAGGTTTTATATTCAATTTGTGGGTTGTTACGaaaga
attattttaaattaagttgttggatttttttttgcttcgatGTTATATTT
TTTACTAATTGGGAAAATTgtctatttttttgatttttgagtatttttaa
aCGACATTTTTTCGACTTTTATACAAACTCTTCTTCTTTAGGTTTTCTTA
TACAGCATCTCTCATACATCCACACAATTTGATAGAAATACGACAGaaat
gcactttttgaaaaaagatgacAATATTTCGCACGACGCTTCGCGCTTTT
AACGGTAGCTGTACGAGCTCTTGGGAAGACTTAGTTCTCGATATCCTCGC
ATATCCTCGTTTGAAGTATGATCTTAAATATGGGTCACCAAGCCACACGA
CATGAAAGAGTTAAAGAGTAAGGGATAAATGTGCGATTTATTTTAGGGTT
CGACGGGAATTTATTCTGAATTTCGTACCTTTTCAAGTATTCATAATAGT
ATAAGGAGCAAGATATCGTTATTTTTGCTGATAAAAGCCTTTTTACTGTA
GCTTCATATATTCATTGATCTTCGTTTAATTCAGTTGTAACGGCTTTTTA
GGTTCAATTGGAAAATATATGCATATTCGTGTCTGATATTGAATATGTAT
TCAAAAGACATTGACAGACTGTACTTTTTTGAGAATTGCTTTTTTGGGGG
GGAGATGTTATTAAAAATAATACCTCGTTGGAAGGATGATTTTAAGCAGA
TTGATGTA

protein sequence of TCONS_00072678-protein

>TCONS_00072678-protein ID=TCONS_00072678-protein|Name=TCONS_00072678-protein|organism=Clytia hemisphaerica|type=polypeptide|length=3630bp
MVFESLVADLLNKYLGQYVKNLDASQLKIGIWGGNVVLTELELKDTALDD
LDLPIKVVRGYLGKLVLSIPWKNLYTESTVVDIQDLHLVAKPNFDIKYNE
EREEKSKHDKKQQQIHNIEEARQREEDKKKGAKKEESDGFAEKLATNVIK
NLQVTIKNIHVRYEDSISDVNGPFSVGLTMESLTAQTTDEDFVPKIIKES
VSLIHKMVKLDNLALYWNPGDELIDPSLDTKQWLEVSTKQISTHQSKPEK
TKYILSPMVATKKLKLNTKPGSNLDIPKMFLNLVLEELGIIVARSQYHGV
VQLIESFERMNRNQPFRKYRPHTSVLGNESIWWKYCMSSILEVDVKRRSQ
MWSWKHIQKHRVLCKAYKVKYKEKLKQKNPSKQILTELESMEDELNIASI
TIFRQLAATEVLTEQKKKGTKGSFFSFFSRSKEPEKSAANKIGDLMGDDQ
EKEMQKLYDAIGYTENEVITPFPKEYVAMSVESILQKLFISLIDDTDKAK
EFKVLDFSLNNIIVEVFQRPSAQALKLCAKIGEMKLFGTASAQCTPLIIK
NMLQGRGMEFLPLVDFIFETNPLKKPDIDQCITAICQPLEIIYDANTINH
IISFFKPPEHVILQDLQDKAYSTFEDFKVSSTAGLLHAMEQRTVMDIDID
VGASHLIIPEKGSYNGCTDMLVIDFGKITMSSDPSQIRHLDPKDIEDVNE
VQSKAYDRFLLSLQALQILLVREGEDLKSAKSNVSKASSHILHPINFDGK
LAKAILPQDPRLKQICVSGELSSLFVSVSDDKVSRLIKLADSIPLPQSPS
HDNIDGEEKPEGLFTKALSMISLTGDNDTGVDIGGFSIPVPTSPTSVTSD
EDEYGTPPDGSILQLQQEAGPDFSSGVANQVKVDLNFKIHKVMIAIGLTD
KALKQEKECLKFIVDDINTEVILRRWDLFVNAEVGRLVLNEMTWGVDGEP
FAIMSTPKNTKMLKFSYRRCEFNESLNLGPSYFYSKEAQVRALHFKDEFG
ATDQILDVQVATLFLMLHQEALLSIMSLIYQVLEPLNKHDKEATQKIKRS
LSTAGSRLSLSIEEKEKERQIQRKLANPKALEAANELKQQVGLEEEKKMR
VTAHLDGVGIMICSAKVDLAQAFVKGLSAKVLMKDDLLEVKASMKDMQVQ
DNVGETKYKDIISMRSDEVFDLELAIYENGSSGSKQYDMSCVDTSVKLNF
GQMRVVFLYRFIQDLMSFTENFEEAQKAVVEAGKAAKDKALETATDLNRH
SSRVKLNVVLKAPTIIIPVGSNNELALLVDLGELRIYNTFKLLNDDQYHK
KSIITDNMTIKLSNLKLLKALIQDGKDFLHQRAIIEPMMLQITIVRNLTK
GNHSIPDVSVQAKMPAILLSISEEDVTVALKIVQGNLAEGESHAPKKQAK
PAKQTLNVPQDRLADIYEEPEDEDENRQGYLQTKLSFDLAKIDIKLYLKP
SDMTFEDEFLARTDDLLLALFTIGNLCVDGDIMSTQAMKMSVRLDTLVLD
DMRPIEEHEGVKRMINYSPEPLLEEVKTSSHKRPIDNSRMIEIQFDQTSS
QDKNIDIKLCNMLCIFNVEFIMVLLKTLQAAIPKDDSLQHGHSMSSLDSA
AGSGGSDDEDSLEASEIVLCTGDQERPETKVSIFVHNPQIVLLADAKDVK
TNALFLTTEINFQYFELRDTQKMIGAVSNTAILSTAFKNDHRSDISTVLS
LDSINLHSSSPINGKPHMSVSTTLIKLNISPKTIRTLSACAGYISNDPTD
EEIKEARKAMRDLWQIQTFTNKRPWYLNHPPQQVLSAGSFVLARTRTGEY
KHGFLAKKDVSYQVYFSEERGTASHRAMDISSVVLDIVPLIGDLCVGCNV
LAVESKEHGYRTGRITQVWDSNVDKDSSDGAKQSVSVKTTAIAPIKYLVN
FYDNQTENFFPPDELRIIGKPIKGVVPGLGACVYARFNDGFYYRGKVDDI
EDYRIRVQLDEISGEIEHDIDDPSAVILNLTPQYRQVKKHFKVIASKGST
TKGYHPGKVTAIQGEGNNRLYSIRFEDGTINQVPITKLILMPKAPFDALP
EVGTYVYSRVSRDAPLYEKGIVAEKNTMICVKHLNGRKLAHEIQNIHFVV
RNIVPLVSSLKVGLDVIVQPDNDDQKMYLAVIREVTKKEGDKTNRYLVEF
TDGSKKRVTPSRIRILSQYGSAETSEENADIITTRQEELVLDVQGISLRV
EGYLGGVLTPMLKMDSKITANLKDWSSQMNAHATVSLEASYYNENVAEWE
PVIEPLMEKRRERPWQLSVNYTMEGDDNSASSTSNELVLQKPESNLKIKS
QDNLELTISKSCLALLGELGQVFGDAVESVDVLPQVLVEKEPFMIENLLS
KKVTVTLNELLQGPNGDSTIELASSSNPVGITFAPKKFEKRKTNDLYTIN
LSVDGFHDIKDIVVQRKRSVIYDLVPIKLLSAQSSYSIVVQVKTTDGQRI
IVLRSPLQLKNHFPMPLDVSYISKENQPVKLTTVGSGDIYSFPLLLTYHS
VFHLKPAGFDYGDCTEALNWSDLKTSNEKQFSCPSPDKSADPFYMQVVMK
EETYSSVHGMLDCVPRYTLECFPVITLHNYLPCTINYKIKGMAKSESLPG
GHNWPLFTVNFSDKPSIYIEIESYNNQRWEGGLTLPTKPVDSLNKPSLSF
VMMSGERKMELGVYYQLDGSLNITLYSPYWLLNKTGKPLVYQPAGSSIQQ
VHQENDVNALMMLVKGKHKKAKVKVKNSESWSNEFSLDTVGSGGSLKCNG
PRDRVYEIGLNISLSYFGLTKIVTFTPLRMLSNHTKYTISMAESNSKSSE
WHTVNPDENIPFWPTKLPLVNLYININGQDSVKFNPEVGKTLLLKFQNEV
GGVCVDYQEKDSSSVLSFNPYFAGAAPVRLENLCKKIGMIAYKQAGSVMG
HVLTHDQSVLYTWDDPTMEQELICSIVNDEASETRIKLDANDFGRMRVGD
GAIYWVSFLDGLQRVLLFTDNFKSAYCACQEQNLRPTMEVDFEIESFGLS
LVNVDKRMEIGYLAIRQSKTVWEQRKKKNRWKALPLAMCEALEEGYLNYQ
NRKGAVKEKVLDKEVDYEKMFITKPEKIKIRRTYHSGLGFKYTISPNEMR
VHASISSIQLDSHVPGSTFPTVLHMVEPPKSVASENAPKPFFELSLMTRI
GDKNVVNEVSYCHVLIQEMDVRVDIGFLLALMELFSHARARTTEKEQYAL
DIGQAATKFEESAEFQAAKQDRYYVLNDFHLSPLKIHVSFSLTGGSKDEN
AIASLHGNVLNLLLQSVGLAFTEIQDVQFKLACYEVHKSMQSNSQLGDGI
TKHYQTQAIKQLYVLVLGLDVLGNPYGLISGVGTGAKNFFYEPYQGLIQG
PEEFAEGLAYGVKSLVGGTVGGVSGAVSKITGTFGKGLAALTLDEEYQQK
RRENMSQRPTNLGEGLAKGGKGLVKGIVSGVTGIVTKPYEGAKNDGAGGF
FKGVGKGLIGVVARPVGGVVDMASNTFDGLKSTTSGVKAIELSRVTRVFH
ADKVLRPFNLYEADGNKILMQCNKGEYAKKNFYITHVVDKKNYLILTQSN
ILYVGKNELKMGEWESVWVIEFNELKREPEVKETKIIFHIHNTDTRRSIF
KKSTNTREVILESSAVADWFILKLRDAKML
Run BLAST on NCBI

transcript from alignment at scaffold_82:20022..160963+

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00072678 ID=TCONS_00072678|Name=TCONS_00072678|organism=Clytia hemisphaerica|type=transcript|length=140942bp|location=Sequence derived from alignment at scaffold_82:20022..160963+ (Clytia hemisphaerica)
GCAGATCtgcaattaaaattaaaatgattgactgacaataaaataacaaa caaaaaatggtatttgaaTCTTTGGTTGCTGACCTCTTGAACAAGTATCT GGGTCAATATGTGAAAAATCTTGATGCTTCTCAATTGAAGATTGGCATTT GGGGAGGTAAGAAAATTTATCTTCTTATTTTTATCCTAGTGCTTTGCAGA TATTTATAGATACTGCATTTCAGTGTTGAAATCGCCTTTATTCATTATTT AGAATATTACttgcagggctgcaaataaatatttttggtcaCTCGGACAT TATGTCCGAGTGAaatcaaatccagtcggtcagACTCAAAATCCTCTCAG TTATTCAGTCGCCATAATTTTTCAACTAGCAGGATATATTTTCTAACCTC AATAAGAGGATATCGTTTAAAAGTTAGTTAGAAAGCTAATATGNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGCAGATT AATTTACCACTTTAATTGAGTGGGAGGAGGGAGAGATGATATGTGTGAAT TGAACCCCCCTCTTTCCAAGCCCTGAGATTATAGCACAGTTAAATGGAAT GAAATTCAAGTGTAAGCAATTATGGCTGAAAGGCAGGATCCCATAGATCT CCTATTTACTTCCAATCTTGCCAAATGGCCTGGGGAGATTTGGTTTCGTA AAATTTGATGATTTGGACGAGAAATGAGAATATGTGTTAAGTGAACTATG TGATGTAGGCATATCGCTGAAAGAGAGGTGAACCGCCCGTACAACGGTTG TAAATTCCTGTTTACTCCCGATCTTGCTTGTTTTGCTTGGGGAGATCCTT GTTTGTTCTAACattatgttttcttttcttcatgTACATATTCCTTGGTG GTTGAACGTATGCAACGCAGGTGGAGGAATAAATGTTAGTTTTATGGTAG AAAATGTTTGGTTTCAAAGACAATTAGGCGGTATATATCATCATGCCNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNAAATATTGTTACTCTAATAGTTATATCACCCccac agaaaaaaaatctgcgtcCAGGTAGCCATTCCATATGATTAGACGGAAAC GTCTATTGGATGGACTCCTGTCCTGCATCCCCTCccctaatttatacaaa cttaaatatgtaaatttttaatgatatgcaggcgaataaataagttttga attgaattgaattgaattttgaattgaattgaattgaatcttgtaaacat tccaacaacttccatcaaaatgatctatcGCAGCTAAGTCTACATTTTTA GCGTGGTTCGAGAATTGAGCCGAGAATGCTTGCAGAATGCCCGCAGAACG CCTGCGAGCTCCCGCGCCGGTGAATAACTTcaaactgtcaatcattttct caagcaaagagtacGTGAAGCGATTCCATAGTATACAATTATCATTATGG tatacctttattttcattcttaaaaattttgcgaaaaaaaggaaaaatag aaaagttgtattttttactgctctattcacattactggatttgaaagatc ttctatgtggcatttttttgcaaacttcaaaaaactgatttttgttccGC TTTTGCtggactttagcttaagtgcttacgtgcagcatagggtacaaagt tcaaatatgcgtttcctgtaatttttgtatgaagagttaagtCTATACTG TTTGAGAAAATTCTACCGATGCAAAAATCCAGtccagtcagggaaatccc tcaattgcagtatactgcaattgcagtagttttcatttgtggttagccta caaaggcttttaacggctacatatagtgctggtcgacaaagataaacaaa catccactgtaaaaaatcgaacgagaagaaagcttttctttgctaaaaga atctgatctatggaaaaaatattttgtctgtgccttaaaaagatatgatt atAATTATATGTACAAAAATAGCCtattttctccttgaatcttgaattct gtatcttgaatatactgcaattgcggtacatgaaaaatgtaaaagtgacg tttatacCACGCAATTGCAGTTGAAAATTACTACCGCagttgagggattt ccctgactgcaGTCTGCTTATACTTATTACTAAATTAAGGTTTGCTGTAG ATGTAGGGCGGTAATCACAAATATCTTGGTTTCGCGACGCCCGACTGACA AACATTGAGTAGAATTGATGcagtgagtcggtaaatttgtccgACTTTTT CTGTCGATATGAcatttccttcgttcaaaaattttattatcgcCAATTTT TTGcaagcgatttctagcgcattcgcagcattttgactttgtttatcatt acatgcgtcATTTTGGGTCGGAGGCCACAGTGTTCAAaagtcataatttg aaaccacccattccacgcggttgttttggctgctggctgggcTGGaagtt tccttcaagaatacactcgaaaaatggatgatggaggtaaggggtcactc acaaatcgattttaggtaAGAAAAACATCAATTGACATATATGGGTGGGT GGGTTGTTTTTTCAAATCCAGAAACATCGATTTTCAttccatgccaaata ttacttcTCACCATGTTTCTGTTTATCGCTTCGtctgttttgaaaaccaa aacaaacagcccaatgtttatgtcttttctttgtttgacggcccgaacgg cccttgaatttttgcagatggCCGTTCTTTCTGTCGCTGTGAACAAGTTT AGCAATTATctctgtttcttttttttcaaatataaactatgcgagctgta gtgaaaatcaagatggctgacgaaacagcgACGTAGGcagtttttcatcg atttttggggatatcaaggtgtttgacgtttttgggtgtgggtgggtcgg tcagcttttaaaacgtcaattgacaatcaaaaatatgttccattcaGGTC GTCAGACCGCctgtttatttacaagaaaacccGATTCAGAAAGTCGGTAA AATCGTCGGTTTTTTTGGGCGCTGTTCACAGGTTCGGATCTTTCCCATAA TGGCGGGCACGGGCGAACGGAGCAtgtctttgaatcattattttttgttt acttaacccacattgagtcccgttcaagttttttcatgtacccttattga aattttcatgccaAAATTCAGCAACGCGATAGGGCCAATACCCTGCCTGG GGGCCAAAAATAAGGGCTGCTTTAAGGTTAACACATGTAGGGTGGACAgg acaaaattttcccctcaattttaaaaaaccaaactaattttatttgaaag tccttacctttgtgagaaaaatgaggNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNtagggtggggcgtcaaatgtcaaagtcagaaaattcaagatgtagt gtttttttatgaaaatttaacctattgtgaggcattctacgcaattttta aggtcagaagttcaaaattggccgaacccccctcAAAATGCTACATATTT CCATTCGATACATCATaattgactaaatattttgtatattatatTAAGCA AAGAATCTGAATTTACAAtcctttaatttagaaatactagttgaaatata ttatttaaaaaatcccatttcactcaacaattctttatagcccacttaca tttccattttcaagacttgtttcgtcaaaaaaagattgaattttagcttg aaatattttatacattttaaaactggcttCAGTTTCAGTTTAAAAATTGC GGTCCCAGAAGCATGTTATACCTGAATAGTTTTTACCCCTAGAGTATTTA CAGAACACTATCACtgtaaaaagattttaggttcatgtctattgccatat tagagcagtttttaagtcaatatgggatttttgcttgaaatgttgcaatt tagccagttttaacagagatttcatttccataagggtggatgtaaacaaa tctcagactgaaatgattttgtttttccaggaatattcacagaatactat cacttcaaANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAAACGGGgcttttgct tgaaacgttgtattttagccagttttaacacatatttcaattccataatg gcggatatacccaaatcctaaacccaaacaatTTAGATTTCCcaggagta tttccagaagactatcactgcaaaaagattttaggttcatgtctattgcc atttttaagattttttgagtcaaaaattggattttTGATTGAAATATTAC GTTTTAGCAGGAATTTCAATTCcaaaatggtggatatacccaaatcccaa gcccagatgactttgattttcctgtagtatttccagaatactatcactgc aagaaaatttggatccatgtctattgacattttagagattttttcagtcc aaatttgggtttttggcctgaaaaatggctcttggcagggattttatttc cataatggcggacatagacccatcccagacccaaatgattttgatttccc tggagtatctccagtatactatcactgcaaaaataatttcagtcagtatt taaactcagtttgtagaagcttgccttaaaaaatgctattttttgagaaa tatgattttttgtTGCTAAAAAGCANtagaaactttaattctcttacccc cgtcccgggcccccctgatatgagcaaggcaACCATGTTAGCCAcaccta ctgaaaatttcagatcaatacaaacaaggaattaattcctgtaacttgat gaaaattggaaaaagctggtttttgactgtttctgatcctaaaatGTNct taaagactttattgaagacttccatctctgaaaatttgaggCATGTGAAT CGataagtttaaagtttatgagcttgcaaaattggccttaaaaagcattc tgctacccaaaattggcttaaaacggctcttTTAGGGCTCTAaagggcac aattttcaatccaatatgattattttgttgtttcttcataaaatttagta cagcaagtgaaaaaaataagatttgcaatagttttaaCATANNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNatcgcaaatttaaccgctaaaaatcgcgaattt ttcaaccaaaaatacattcaaatatagcgcttttgattctctaaaacaag caaaaaaaaatttcataattgtatttgactataaaaagttacaggcattc ttatttccactgccaattatatctggacagactttaagaaGGCGATTTAA TAAAAGTAATCTTAGAAACGCTCgtaaaagttatgaaaaaagtGATTCCA TAAaggtgatcttagaaacactctaaAAAGCAGtaaaaagttacgaagaa agcgatctGATAAAAGTAATCTTAGAAACACTcgtaaaagttacgaagaa ggCGATTCAATAAAAGTAATCTTACAAACACTTTTAAAAGTTACGAGGAA AGTGATTTGATAAAGTGAAcctagaaacactcttaaaagccCTGTACTTA TGATATGTTATTTTAATGGGTGGGAATTTTAAATCCTATTTAAAGCTAAC AAATTCAAGGGGGTTTGGGTAAAGTAAGGCTCTTCTGAGGATGAAATCTA GAGTATATTTTCAATCGGGACTATTCATGTACAGTATTTCCACACAGTAG GACGGGAATAAGTCTGATAAATGTTATGAGTATTAATCTTATtactattt cttttttttatctttccaGGAAATGTTGTCCTGACAGAACTTGAACTGAA AGATACAGCTCTGGTAAGAATTTTATTCATAATAGTTATTATTGCTTAAA cataggcttttccagaaatagtctgtgtCCCCTCTTTTAAGGATATCGGA CATCAAGGGGTTCAATGCTATCTGCATATTAAGGGAATAGGACGTTATTA GAGGgtgaggatatccaggggataCAGGACAAAATGTATGGATTTCCAGG GGGTACAGGACAAAATATATGGATATCCAGGGGATACAGGACAAAATATA TGGATATCCAGGGGATACAGGACAAAATATATGGATATCCAGGGGATACA GGACAAAATATATGGATATCCAGGGGATACAGGACAAAATGTATGGATAT ACAAGGGGTACAGGACAAAATAtatggatatccagggggtggAGGACAAA ATGTGTGGACATTCTCGACCCTTCTATCCACTTGGACATCCAGGAAATCC AGCGGTCTTTATTTTTGGCCAGACATCCAGAGGGCTGTGGAACTTGAAAA atggatatcctcaacaggggggagGGGTATGGAAGAATTCTGGAAAGGCC CATTACACTGATGAGTTTGCTTTctttttgaatgtttgaaaataTGCAAT AAAACATGATGATCTCATTCTAATGGTAGTGTAGTTCTATCAAGTACACC TGCACAATCTGTCTTCACCAGGAGGAGCAGTAGATTCACAACTAAAAGCT TCAACATTGATGAAACCTTTACATTGATCAGGAGATACCAAAGGTTCTGC GTCTATATGCCAAAAACTAGCACCATCGTGAGTTACATCAATCTTGTTAT TGTTGCAAATCTTTCCAGCTTTGTAGAAAGGATAGATGGAATTGGCAGTG AAGGTTGGTTGACAGGTTCGGCCGATTTTCGTACACTTCATTGTACAGCT GATCAAAACAGAGAGAATGAAGTGCGAGTCTTTGTCTGAAAAGAAAATAG TATTGTTTAGAATTTAGATTCAATAATGGCTGCTCCCAAAATggtcaaat taagaacatcttcagatcatatttttatattaataatttaaaattcaaaa agttaagaacattcgaaggctttgAAAATataggatgttcttataaaaac gtgtacctaACCATAGATTGCACTCCCTTCTCTTTATAGAGGGATTTCAA TTTGTAgcaggaggggggggggggtaccaagATTTGCCAAGAAAAATTGA AGGCGATGGGAATGTAGGGTGGGATCAAATAAGAAGCCAGGGTTGGagat ttttggtcaattttatcACATACAAATGGCTACAGTatgttttaaagtaa aaatatgtACCAACAAAGCACAAAAATGTACATCATGCTAAAAACACACT AGCTATATTTTTTAGCGCATAGAGCGAGTtcagattttctgtaaaaaagg gggataagatttcattacaaaaggggggggggggaaaaagggaagggggg gggggggggtttttttttgaaaaagggggggggggggatttgtGCGTGTG GGGGGGGGGCGGGTGAATTTaacttggggggggggggctcaccCTTTCTA CAAACTATGCATCACAGTTTATTTTAGCTGGGGAAAAATTCAGTTCATTA AAACCGAAAACTGTGtcaacatcctttggaaaagtCATCTTAGAGGTTCG AGTTGATCAAGTTTGACTCAAGTCCAATAGTTGAAAGATTAATGTGCTTT GGTAATATAAGACATACAAAttagaaattattttcattgtACGGCGATGA TAGTCAAACAATACCCACTACTTACAGTAAGGATGATTATCAATCAATGT AAGCAATCTATAATTCATAGATTCATCATAATCACTTCCATTGACATAAA ACAGGTGATCAGCACTTAATGTGTTGACGTTATGGCATCTCCAAAGAAAA TTACCATTAATCACTTGGAAGATGGCAATTGGTCTGTTGGGATCAGCTTC TTTGCATGTTTCGTCTAAGATCACCTTTGGATCTGTTTTAAGAAATGATG GAACAGCTTGGTTCAGAATGTACTATATCTGTTTGGAGTTTATTTTCGGT ATTGCAACCacaattgggctattccagaaaaaatttgtatcCCCGATGTT GAGGAATATCAATCGCCATTGtattttggtccgttattttaaAGGCCTTA AATTCACACAGCTCTTTCAAAATTAAGCAAATTAGTATGACCATTATATA TACAAAAATTGGTGTACGAAGAACCAAGTTAACATACATGGTGTGCAAGA AGAACGGAATATCAAAGATGATTAAAGTAAAATCATTGTTTCTACCACTA GTTCCACCCTATATTTAggaagataaacaaacatcaaCCTTGATCTAGTT TTGGAAATTCAGGAGCTTGTTTCTTACACATGTAATGGAACATTGTGTCT taaggccggtttccacttgcgcgcgctgtgatcgtactttttgacttcaa tcttttttgcttggaaaaaagattacgtcataaaaatgtagcgcacgctg gaaaaaaaagttgaacacattttaacttttttcaaccgttacgtcagatc gcgccaatggagttgcttcatttttcttttgaccaatagcgtggaagctt tgctcgaaaatacGCGATTGAAGCGCGTGCAAGTGGAGAGCGGCCTTTAC ACGGTGGTAGATGTGGCGAGAATTGattctcttttcaatttttaacaCAC GTACACGTCacaaagaatattttgaaaagaacaATGAAAATGTAGATTTT AGTAGACTGTAGATTTAGAACCCCATGAGGGGtctgaattttcaaatgta ttNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNgggggggggggggggttcctaCCTAAGAGGGGGACT AGTAACTATGAAACTTCACCTATGATAACTGAACAATTTCCACCAATATG ATATTGGTCTACACAACTCATCGTCTTTGCTTTAAATGTTCTTGTTGCTT TAAACTAGAAGGTAGAAAGCATATGAAATACATCAGAAGCCAGTCTCTTT CATATTTTTAGacggataaaaaaattcactccattaagaattagtgaata agaactTAATTACTGAAGATGATGTAAAATATCGAAAcatgttttaaaat aaatattgataTGCTTCATAGTCAAGTTCCCCCACTATGCTACtttattg cctttgttatttttagtcATATAAAATTTATCTACGGTAGGAAACTGAGA AAATAGATAAGATACCACAATAACTCTTCAATTGCATGAAAAAAGAAGTA TCAGTTTAGGGCTACTCAAACCCTTATCTGAAAACAGatgttgaaatttt cttccgatacGCTAAAGCTCTGGATGTCGGAAAATTATCAACATCTGGAA AGTTTAGATTAGTTACACCAGGCTGCGTCAAGGATTTCGCAGTCCTGTCG GGCCCAATGAAGTCATTTTCAGGCAAGTGTACAATGGCCCAACTGGGGAT GTTGCACGTTAATGGCCGACTATCACACCCATAAAACGACAAATTGGCCT ACAGACTGAAATAATTTACCTTTTGCATTTTTCTTGGGACGTATAAATCT ATTCCATCGTCTTCATCAAATATCATCATTTGTTTGCTTTCTTCGTACAA AATACATGCTTCGACCAGGGGTAAATACCCCACCACATCACATTCGTGTA CACTACACATCAACAAACATTGAACAAGCGAGATGCTCCCTTTTGCAATC TTCCCCATCTTCAAGTGAAATTGCAACTGTTCTGTTTTCTCATACAGCTC ACTGCAATCAGAATCTTTGTTTAGAAACAACAGAAGAATCGTGAACCACT TCAGCACCATTTGAATATGCATCTTCGTCATTTAAAAGCTCTTTTAAATG ATGTTTTCTTGATGTTTTCCCTATCAATTATCGGaagaaatgtttaaaat tttctcaactAATGATAagacagaaacaaaaaaaatcaatttttttctac tATAATTTCTTCGCGTTACATTTTTCTAATTGCATCAAAATTCAACGACT TCGAAAAATTGATCCCCCGTAAAATCGAAGTCGCTACACGCTTGCTAGGC CtatagatttagaacgccacgGGTAAGAATATCATTTATTCGATGTTTCT ATACAGATCATGGATGTGATGTTGGTATTGAGGCGTTACTCTTTTTAGAG AGTCTTTGCCCAATAGACAGAATATCGAGTAACGCTTtcagctctagttt agacggcccacttttcgccctgcctattctaattgtgaattaaagtgggt agattgttggctgtctaaagtcaatgcattgcccttttttgacgtcaatg caatgtcttctttcaatcttttccgagcaaagattttaactgccaacttt gtgcccacttttAGCCTACtcaaacaattagaataggcagggcataaagt cggccgtctaaaatAGAGCTcagaatttttgtgtgaaaattGCGAGCCTC ATTCcgcgaattttttttcgaaccatggttaaaaaaacaaatgaaagttT GCGTGTAGTTTTCTTCTTAAATAAGTAAAATCTGTGTATCAAAACCGACG CAATATTCCCTTTTAATAAACAGGTGTAACTAAATGATAAACGCTCCTCT TTTCGTTGAAGAGATAACCAAAGGCTAAATCATTTTGGATCTTTCTATTC ACTCTAATTAATCGATCGAGAATAAAATCGTCCTAGTTTTTAGCAAAAAC AATACCATTCGTTATATTGAGATTCTTTTATTGAGGTTTTGACGAtttaa aaacagataaaaacaaattatttttacaatataacttttaatataatata taatatgatATATTCCAAATTGATTTTCCATTGTATAATCATtgtaattt tgtttgtttttttttcttgggAAAAGGCACCTGCCGGCGATTAATTCCGA TTTAACGCACACAACATGTCGTTTTTACACCACTAGAATTTTGAGCTGAA AACAGTATACTTTAAGATTGTACACAATAATTTAAAACTATGATTAGCAA CACATCTATATAATAATTaccataaataaaaaaatcaaattatcatGAAG CTCTTCTCCCCCAACAAAAAAAATGATACTAAAGATACCCTAATCCAAGg ttaaaatcacaaattttcaaGCATCGGAAGTCTTGACTTTTAACGTTTCG ACACTAACAGCCACCAAATCCCGGGCAAACCCTGCATTTTGACTTGATAC AGGTCtttctgaaaaatttttcaGGGTGCATGGTCTACAAAACGTTTTGT GCACAAGATCTAAAACACAGACTCGAATACACGCTTCTTGTAACGCGACT TGATAAATAATTTTCTGATATTTACCGTGGACTTTCAGCcagtaaaataa atctataaatgaaaataaagaaagataCGGAAAAAAGCCTCCGTAGGCAA AAAACAAGCTACGACAAAAAAGACTCCGGAGCGGACCCTGCGAGTACATG TTTCGCAAGGGTGTTGCACCGCCCCTGGAGAAGGCTTAGTTGTAAACCCA AGGTGATAGTGAAGTACTTGGTATTATAGCCCTGCaatacaactgtcaat catttttaagaaaactgattGGATGATTAATGTCACGTTGCCGGTCAATA TTTCTCCATAGTGACCagttatgaaattgacatcattaaaatgtcaatta cttttattactttatttttgcaggGCTATAAATGGATTATTGACCGAAAA GCCGGTCTCTCTGGCAAAATATCGACCAAGTTCGCGACGTATTGGAACGA GCTAAGCGAGGTCCAATACGAGCGAATGAGTACGCTGAGTACGTACATGG ATTAGGAAAACAGCATTACTCTAAACACATTTCCCCAGTCATCATGTAAA TTATacgataaaagaaaaattatcagtaggaatctatatattaatggcgg tagtctgtatgtcgttttgtcNTTAAATGATGTTTTCTTGATGTTTTCCC TATCAATTATCGGaagaaatgtttaaaattttctcaactAATGATAagac agaaacaaaaaaaaatcaatttttttctactATATTCTTCGCGTTACATT TTTCTAATTGCATCAAAATTCAACGACTTCGAAAAGTTGATCCCCCGTAA AATCGAAGTCGCTACACGCTTGCTAGGCCtatagatttagaacgccacgG GTAAGAATATCATTTATTCGATGTTTCTATACAGATCATGGATGTGATGT TGGTATTGAGGCGTTACTCTTTTTAGAGAGTCTTTGCCCAATAGACAGAA TATCGAGTAACGCTTtcagctctagtttagacggcccacttttcgccctg cctattctaattgtgaattaaagtgggtagattgttggctgtctaaagtc aatgcattgcccttttttgacgtcaatgcaatgtcttcttNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNattttaattcactttttggaactaatttgaccaaatttctatc tttctgggggcaaaaagttgaaattttcctatttttccaattcttagttg gactgaagtttgattttccgatttttcaaactgctaTGTTTCAagaaagg cacccttaaggccggcacatacccatacccttctcttgcgtaagtacccc ctcccccgggctgccttttttcgacgaatcgcgtgtcatgtctattNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNaagaactacggcaaatataacgcgagcgaagcgagaaaaa aaatctaattgcagagccgtctcggacgtcgctggtcgccggtatggtgt aatttgggaaggacaccctttctgttttctgatcatttttgccacaaaaa tctttttcaaaatatggttaaagatacgtcacccgggagggatagagtca aactttgaagagaattcttccctttaattttgatttcatcatgtttaagc caccttcccaacatctcaaaggactgCGTTCAGCAAaaagctaaaccggc gtgcgacgccgggtaccggctagtaaattatatttttccaaTGGATTTCA AGGACATAAAATATGATTTATTATTTCAACCAGAGCTGATTACATAACTT TGTATCGGAGAATGAAGTTATCTTCAACGGCTGAGCTTGCCATTTTAAAA AGTGTTGTTCTTCATCGAAGTTAATGAAATAGTGGAAAGTCGTCTTTGAT GTCTTGGACTACTAGTATCTAATAATTATCTCTTGCCATCATTGATCTTc caatagaatttttttcttttgtgccGTGCCAGAAAATCAACTATACAGTT CGTGTGTCTACGCAACCTGGTTCATAATTGTTGTCATAATCGTTGTCAGA AAACAAAGACCACCCAAGATATAAACTTTGATAGTATTAATTATTATACC CCATCAAACACATCTGCAGACCCTTTGTTCATGTGAACCTGACGGACTGC TACAACTGAATGTTTGAATATTAATAAAACCCTGGCACTGGCCAGTTGAC GACGTTATAGGGTCTTTACCGGAACGCCAAAAACTTGTTCCGCCTGATGA TTTATCTATCTCGTGGTGATGACAGCTTTTCCCGGTCAGGTGGAAAGGAT AAATGGAATTGGCCGTTTCGGTTGGCTTACATGTTTTCTGTATTTCTGTG CACTTGTTATCGCAACTCTTGGATGCTCTGCTCATCTCAAATTGTGCTCC TTTATCTGAAAGTAATATTAAAAAACGAACTGTTttaattgatttgaaaa attgtcatCAATACATAATTCCCTGGGGGGAGGGGTGCTGAATCGTAATA TAAGACCGATGACCCTGTTTGGGGTACTCCTACCCGTGTACTTATACTGC GACGATGGCCGAATGTTCTTTCTTCGATGGTCCCCCTCGGAACGATGATT CGACTTATCAGAAATAGATTGGCAGATATATTCATAAAATAACGAAAGGT AGGTAGAAAGAAAAACAGTGCCTTTAATGCACCGCAGTACCTAAAAGACG GGCCTTAATGTAGTCAAAATGAAGTAATTAATCAAGATAAGGAGACTTTT TTTTGACAGCtaaaatacactctttttattttacgagaACAGTGAGGCTC AAAATAGGATTTTGATAATTTCATGCTTTTTAAGGGTCAATGTactaaaa attgggtataaagcctaaaatacctTAATTTCACCCTATAAATACGAACA GGGTAAAAACAgtttgaggctcaaagtaccaataaaataagaacagccga gcctcgtCAAAATACAGACAGCTAAAATACTTTCAAAGTTGATAAACGGA GGGTCGTACTGTCTGGAGAGGAGGTTGTTGCAGCAAAAAATGATCGATAG ATAAAGAAAGGAGACCcgcttattaggtacctgagagtagaGCGAAGAGT CAGTTCATCGTTGTTGAAAGGACCTTTGCTGACAGAGAAAGAGAAACCTT TGCGATTAAAAGGTGCAGAAAACTCACAATATGGATGGTTATCTATCCAC GTTTTCAACTTGTTGTGCATCGATTCATCATAATCACTTCCACTGACATA AAACAGGTGATCAGCACTCAATGTGTTGACGCTATGACATCTCCAAAGAA AATTTNATAATCACTTCCACTGATGTAAAACAGGTGATCAGCACTCAATG TGTTAACGTTATGACATCTCCAAAGAAAATTTCCACCAATCGCTTGAAAG ATGGCAATTGGTCTGTTGATGTCAGCTTCTTTGCATCTTTCGTCTAAACC TTGCTTCAGGTCTACGAGAAAAACAAAGCGTATATTTGTTTCATTTGACA TCCAGTGTCTTGATTATTGTAACTGctaaatgggctattccagaaatagt ctgtaccccctatgttgaggaggtgtgacgtccagggtggtatggaaaat aaaaaatcccggGTGGTCCGtttttttttagtgaaaaaatccagtttgaa aaaaaatccagggtgtcGCCTTTCCCgaaaaagacctcctcaacataggg ggtacattttttctggaatagcccaatgttatagagttttttaagcttgG GTATAACACTGAGCTTTATAAACCCTAGGGAAAGTCTATATGTAGGCAAT ATATATAACAATAAACCTTTGTTGTCTTGACAGGTGGGACCAGTTTTGTA CGGATCAGTACAAATCAATGGCCATGCAATTGTTGTTGTTGGTGTAGGGG TTGTTGTTGGTGTAGGGGttgtcgtcgtcgtcgtcgtcgtcgtcgtcggt GTTGTAGAAGTTATCGTGCTGGTTGTCGTCGGTGTTGTAGATGTTGTCGT GCTCGTTGTTGTGGACGCGGTCTTCGCTGTTGCGGGTTGTTCAACATTTG TTATTGGGTGACTTTCAGCGTATTCCTGTAAGGTGGAAAAAAATGGAATA ATGACGTCACTGTATTCTTAATTCCCACTGGTGGTTTAATGATGATAGGA GCCCTCCCCATGGGAAATGGGTCCCACTTCTTATGAAGAGGGAATTCCCT CTCAGACGGAGTCACAATTACACCTGATAGTTTACTTAGAGGGTTATTCC CCGATTTAGGGTGTGGTTAACCTACTTTTTTATGACGTGATGGAAAACCA TCAATGACGAATGTGTAACAAACATCCAAAGAGTGCACAATACAGTTGTA GTGCttcaaaaatatgtatttttcaaaaacatatttaTGAAGCACTAGAC GTGATGGAAAACCGAAAAAAAGTAAACCAACAAAGTTTTTATGATAATGA TTACTTGGTGATTTGTTCTTTGGACGTATAAATCAATGCCATCGTCTTCA TCAAATATCATGGTTTGTGTGCTTTCTTCGTACAAAATACATGCTCCAGT AACTGGCGAATATCCTGCCATGTCACACTCGTATTTTCTCCTGCTACACG TCAACAAGCATTGAACAAGAGATCTGCTTCTCTTTCTCATATCTATTGAT TCCTCTACAAACCAAATTCTCTTATCTgtcttttgataaaattgtttGCA ACCATCAACTGTTCTATCCAAGACCATGGACAATATGACAACAATAAGTA GAAGCATTTGTCGTTGCATTTTGTCTTCGTAAAGTTTTGTTCAATTCCAA AGAATTCAATTTTGGAGATTTAGAATTATAGCACCATTGTTATCCAATGA ATCAGAGTTATATTTTTAGTTATTATTGTAtcttaaattaaaagaaaata attttcatgcgattttctttgaatttgaatttgactgAGAGCAACCAGCG AGTAACTTCAAAAATGATGCGAACTCTGCTTTGAACAATCTCTTGATTGA GCTTGATATTActttcaatttttggttttgcttACAGAAATATTACGTTT GTGAAATATAACTTGACTTTTAGGGGAAAAAGCAATTTAACTAGTAATAT AACACTACTGAATTGTTTTTTACTTGTcttcaaatttctattgaaacTGG ACACCTCTTTTTCAAAGAGAAGTAATTACTTTAATCATGACTGAAagtaa aatcctttaaatataTTGATTATCGGAAAtatttttatggaattttaaTC ATCTTAGATAGCTGTTGAGATCTATTTTATCACTTTTGTTACACGAAAAC TGGGTCAATAATGGGAAGTAAGGCGAGACGaaattgttctacgggcccga ccactctgaaaaaaaatttatgataatattgaatttgcaaAGCTGGAGTA TGGATTTgaagtttttaacaaaaatttttaactGGTTTTAACAGTTTGAA AAAGTGTAAATCCCAGAACTTAGACCAATCTAAAATATTACAATGGCAAT TGTGCGAAAATTGATCATtgataaagaggaaaaattctACTTCTTCAAAA CGCCACAAACTTTATAAATCTTGACCCTCCGATCCTACATTTTAAgaatt tatatttattgtttGTACCGACCGGCCCATATTTTTCTCATGGTCAACTC GTTGAACAACGAATTAAATTTATTTCGCCTTATGAACTAATATCCATATT GtatgtttgatttgtttttgtgATTACTTTTTAGGATGATCTTGACTTAC CCATAAAAGTTGTTCGTGGATATTTGGGTAGGTGTACAATGATAAATTCT CACTATAATAATTATCCTCGTATCACTTCCTCATACATTAGTTTTCAATT TCTCCTCCGCTCATTTTGGTTTATTTAAAGAAATCCTAAAAATCTCTCTA AAACCATGTTTGCNTCTCCTCTGCTCATTAATTTGGTTTATTTAAAGAAA TCCTAAAAATCTCTCTAAAACCATGTTTGGATGTAACGATTCCGTTTCGC Tatgaaacaaaatgaagccattctattggtcagaagtgacgtaaaacttg aatttaaccaatagaatggcttcatttcgtttctgCTTTGTCAACATTAT TAATGCACCTGCTTCGTGAATAAGccaatctttctttttcttctttttag gtAAATTGGTCTTGTCCATCCCATGGAAAAATCTTTACACTGAATCAACT GTTGTCGATATTCAAGATCTCCACCTTGTCGCTAAGCCTAATTTTGGTAT GTTTTGGTAAACCCCTTTTTTAATGAACcatttaataaaatcttttttct attttctgcgggtttaaccctttgagtgccagggtccttttttctaattt ttttttaaaaaatcgctagttcaaactttaagggcttatatctcctgatc tagaaggaattagaagctcgtatatagctcgttggatagcttaNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNacaatctaattcctacgagttcgaccaaaaata acgatttctaactcaaactgggcattacaggagggcttcgccctcctata tagcccatgtcgtatatatacgacttcggcacttaaagggttaaattttC GTGAAATGAGATGGCTTACCCGATTGGTTTAAATTCTTTTCTGGCATGCC CCAATATACAAACTTTTTCTAACAATTTGAGTAACGAAATTAGTCATTGC CTTTTGGTTAATTTAAAAGTAGCACAATAAACATTGGGCTTGAATGATAG CCTcactttgatatttttcgttGTTTCAGACATCAAATACAATGAAGAAC gcgaagaaaaatcaaaacatgacAAGAAACAACAACAGATTCACAATATC GAAGAAGCGAGGCAAAGAGAAGAAGACAAAAAGAAAGGTACACAGGCTAT ATTTTCATAATTGATAGATAATTTGTCGTGATATTTAGAGTCAGTGACTT TATTTTAcgttaggcgagaccaatttgattagttgttttacggacccgac cgaccctcttttttagGTAGCTTGgcctgtaaaacaacaaatgaaattgg cctcgccttatgttttttcaatgttttaatatttcattcattttcatCAT AAGGCGCCAAGAAAGAAGAGAGTGACGGTTTTGCTGAGAAACTTGCAACA AACGTCATAAAAAATCTACAGGTAAAAAATACATACAGATTTCAATGTGT CACGGTTTTCAAAGTCAAAGTCGCTCGTGGTCAGCTTTTTACTGCCTATC CCGCCTCGACTAAAACCAATTTATCTTCAGAGAATAATCAGAAATGGAAT GATAAACTTTTGAACGAATGTGTCTTTTCTTTGCGTCTTATAAAAACTAT GTCTTCATACTACTTTAATTTTACGGAAGAAAACGTTCGATTTCCGTCAG GGACCACCtttacagattcgaacgtttgcttccaaaatggcggaaattac gtaacttaaaaAAACACGATAAAGCTATATTCTGTAATAAAACCGTTTTC GATCGAAGAATTCTCAAAAACATTAGTCTAATAAACGAATCAAGTTAAGA TGAAGATGAGGATTcgctttttactttttttctcgTTTCCAGGTTACGAT CAAGAACATACATGTTCGATATGAAGACTCAGTAAGATTATTCtctcttt aaaataaaaagaaatgtttCTCTTCAATCGACTCAATGTGACAAACGGCT CTTCCTTAGTTTtcattgattttacttttttataactGGCGAAGTTTAAT TAAACTCTAAATTCGTCTAAATGCCTAACGAGAATATCAATACTTTTATT ACTTTCCACTATTTAATTCCCAATCTATTTTTTTATAGATCAGTGATGTG AATGGACCCTTTTCAGTCGGTCTTACAATGGAAAGTTTAACAGCACAAGT AGGTGGCCAGACAATTTCATTTCCCTCGTTTAAGTCTGATTTTCTCTTGA CTTGACTTGAGttaacaaaatttacaaaaaggtGATCCAACAATTTATGT AATATTTCCATGATCCCACCAATTTCTTTATCTCTCCTTAATTCTAAAAG ATTCGTTTGTTCAGGgagaatttctttaaaaatgcttataaaaagttcAA CAATTTTCTTGCTTTAACAGAATACCTGTTCACCTTCTACCTACAACTGT TGGAATTTCTAAgctattaaaaaaagaaaaatttgttgTAATAATATTGG CTTTGAGGCTTGTTagacctttttcaaaagaagtCATGATTAGGACTGCA AATGATTACGTCTTTTCTATTGACTTTTTACTTCTTTTCGACAACAACTC ACATATAAATTATTTATACAAACTTGTGTGTTTTAAGTTGTAATGCAAAA ACAACTTCAACTTCATTCAGTCaagtctctctaattcgaacctctattat tcgaatctctctgtaattcgaactaaagtatTTAGTCCCCTCTGCTGAAA AGATGTTttaattactctctgtaattcgaatctttccctaattcgaagaa aacttttgacccttgaagatcgaattatagagagtcaTCTCTATTACGTT AAATACCTTTGAGGAACTTGTCTCTGTTGATGATGAATAAATGatgattt tttcttccttttccaGACCACAGATGAAGATTTTGTTCCAAAGATTATCA AAGAATCTGTCTCATTAATTCATAAGGTATTTATaatcactttctttttt tttgctgtttttttagGCAAGGAGATCAGATTTAACCCTTTTTCAGTACG ATTGTTTAGGAAAAATGCAAGATTTATAACCATAATTTGCTTGTCACCTT GTCAGAAAGACATAACGTCTAGTTCACCTTTCAAAGAAAAGCTACCCTTT ATCAGCGCAATTGTCCAGGAAAAATGGTAGATTTACAACTAAAAGTCAGG GAAACTTATTAGGGAGACTGCTTGCTACCCTGTCAGAAAGGCATGATaat acttttaaaagttttttcttcgACTATCTACCATATATATTGCTTACTAT CCAAAAGATCGCCCAACAATTCAATCAACTCGATTGgtttaatctcaaaa ttatgATGTAATTAAGCTAAAGCAACCAATCAGTGCTCGGAAAGggattt tgattggtcgagtGGACTTTTGGATAGTCAACCGTAAGGACATCTAGATC TAGTTTGGAAGATCCTTGATATATCAAGTTTTTTTTCAGATGGTGAANCT TTTGGATAGTCACCCGTAAGGACATCTACATCTAGTTTGGAAGATCCTTG AtatcaagttgttttttttcagatggTGAAATTAGACAATTTGGCTTTAT ATTGGAATCCAGGAGACGAACTGATTGATCCTTCACTTGATACCAAGCAA TGGTTGGTGAGTCATCACATAAAAACCTTTTAtttaccctggaccaagtt atatccaccatctttgatttgAGTTTTATGAAAAGTGGCACCCTAGTCGA TGTGGGCCAATTCAttattcaatgaaattttcattttaaatatttttcac ccttattgagtagtgctaccattaggatACCACTTTTGCTTGACCAGAAG CTATAAACTTTGTCTGGGGTATATATAAAGGTTAGTGCCCAGAAAAATTA AGTTCGCCATTAGGTTACCTCCTTTGGAGAAGTActtatttgttgttgtt gatgatgCTGATAATGACACCCGTCTCACAGACCCgcgggaccccagccc cactggaaagttTGGTAAAAAATTCGTCCCGGTGGAATTTCAGCCCTGCT GGGAacttgactttgatttcatccccactcgaaattaaatgtttaaaaat tgcacatCAAACCATCCCCGTTGAATTTTTAAACTTCGgaacaatagaaa ttctatcTTCTTTGgtatttcaataggaatttttgtccccactgtggaaa aaagttccagcggggctgtgagacaggggtgtataatgTAGAACCCACCA TCCACCATAAGGTCTTAGAAAACCATCAGTTATCAGTTATTGTGGGTTTT TTAGGTTATCTACAACTAAagtttttctgttttatttttcaggaagtTTC AACGAAGCAAATTTCAACACACCAATCGAAGCCAGAGAAAACGAAATATA GTAAGATTAATTTTCTAATTTGGAATGTAATTTTATTCTCACAATTGAAT GCATTTTAGTTTGCATGTTTGCATGCTTgtttttaagcctgaaattatGT ATTATTTCTTTAGTTTTGAGTCCCATGGTTGCAACGAAGAAATTGAAGCT GAACACCAAACCAGGTTCCAACCTTGACATCCCGAAGGTAAGCTTATCGT TTGAAATACATGAAATAGAGAATGCTTGTCGAAATTGGACTGTTCCATCG gttccataaaatttccatacacggggatggacgaaccttttcaaggcaaa aaataTTTAGAGACACAGTAGATAAATGATGGTTGAGGGGGGCAAAAGAG AAGAGCATAGCGTCTCAGTGACTCATTTTATTATATACCGATAAATCTTC ATAGAAGTCATGAAACTCAAAGTATtgtactttttttttacttcaaaact ttgaaataaattgataattttttttagatgttTTTGAACTTGGTTTTGGA AGAACTTGGTATCATCGTGGCAAGAAGTCAATATCATGGCGTGGTGCAAC TGATTGAATCATTTGAACGAATGAATAGGAACCAACCTTTTCGTAAATAC AGACCACATACCTCCGTTCTTGGGAACGAAAGTATTTGGTAAGTGTCCGG ATCTGTTTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTTTGAAataaattgattat tttttttagatgTTTTTGAACTTGGTTTTGGAAGAACTTGGTATCATCGT GGCAAGAAGTCAATATCATGGCGTGGTGCAACTGATTGAATCATTTGAAC GAATGAATAGGAACCAACCTTTTCGTAAATACAGACCACATACCTCCGTT CTTGGGAACGAAAGTATTTGGTAAGTGTCCGAATCTGTTTTCATATAATT CAGATtctttaagaaactttttcgaaacttttccGTTATAGAGAATGAAC AGGAGCGTAGCAACCTTTGAATTTTCATAtttgctttttttcaaaaataa gtaGGTGAGTcagcgaccgcagtcgagggcgacccgaaggcccCCTTCGG ATTGCCTTCTACCCGAAAGTAGAGAAGAGCGGTATTCTTTCTCCCTCGAT TGCTCCCCGCACCCTGACCCTTCTCCTTTTGATTCTGAGCATCAAACAGC TTAGTATCTAAGTCTTTAGTGACTCGGCCAAGGATTGAACCCACGATCTT ATGCACCGTAGCTAaataccactgacctttatataccctggacaaagctt ctcaatcccagccaagcaaaatctttgatcggagttttttgaaaattggt accctaatgtcggcacaactcgatagcggtgtaaatgcatcgagagcgct aggtctactttccctcaaattcttttgatgatgtagcggcgttagacgtt aatttttggCATTGAAATGGCTTCTctttgggtaccaattctaaaaaaac tctaatcaaagatggcagatattgcttggtccagggttaaaTAAAGGTCA GTGCTAAATACAGTACCTTTGCACTATGGTTGGTGACTAAACTGACCATA CATTCTATTGTATAGTGGTTTTGTGATTTCAGGTGGAAGTACTGCATGTC CAGCATACTGGAGGTGGATGTCAAAAGACGATCTCAAATGTGGAGCTGGA AGCATATTCAAAAACATCGGTAATGATCATACTCGCTGCGCTTTTTACAC GCTTTTCGAAAACATCCAGTAATCTCGGTTAATAATGATCAAACCCATAC TCACTGTGTTTTTTACACGCTCTTCAAAAAACCTTATAGTAATCTCAGTT GGTCTtcatttttcgacaatttaTGTTAAAATGAtcttaacgtgttcttg tttttactttttttgtgcTATTTATTTGGCCTGAGTACATAAAAGGAGCC TAAAATTGACATTCCATTATTTTCTAAGCATCAGATTGAactataatttg ttcttagataTTACCAGGTATTATATGCTGCAAAACCCAGTTTTAACTTC TAAAATTATTCTTGATGAGAAAGAGAATGTAACGGTGATGACTTTGTTTT TCTAGAGTTCTTTGCAAAGCTTACAAAGTGAAGTAcaaggaaaaattgaa acagaaaaATCCATCCAAACAAATTCTCACTGAACTAGAGGTAAAACATT AACAGTCTCGTATTATTAATCGATTTGTTTCGTTctagtagtaagtaagt ctgcgaccgcagtcggaggcgacccgaaggctcttttttctatagctatc tacccaaaggtaggggagggcgccactctctCCCTTGATTGCTCCATTTA CCCTTGAACCTTCGCTTAGGTACTATGGTCGCTACGTTTCGCTTTTAATT GAGGCATCAGGAAAATTTCTACCGAACCAACTTATGAAAGAAACCTACGT GTTTATATGAAGCCAATCGAATCGACTTTACATCAACccatttctttttg attttgttagaGCATGGAGGATGAGTTGAATATTGCAAGCATCACCATTT TTCGACAGCTTGCAGCTACAGAGGTATTACtacttattttattttcaaaa aaatgaacatGAATAGCCGCTAAATATATTCTTAAAATAGTCCGACCGAT GTAAGCATAAAAGCAAATTTATGTATGTCTGTTTTTCATACCGGTCATAC AGGCTTTTCTTGTACCACTCCTTAACGACTGATTTAGTTAGTctttaaat gaattttttcacACAAGTTCCTTGTTATATGAGGTAAAATTCGatagaaa gattttttgataACTAGACTcattatgcttatttttaggcagatataaaa aatgttctcaattcAAAGCATGAAAAAGTGTTTCAGCAATGCCAACTTTG ACTTTCCCTTTCTTTTCAGGTTTTAACGGAACAAAAGAAGAAAGGCACTA AAGGAAGTTTCTTCAGTTTCTTCTCCAGATCAAAAGAACCAGAAAAGTCT GCTGCTAATAAAATTGGAGGTAAAAATTGATAGCTCTATACATTTCCCTT TCGTTTTAATTCAAGGGAGTAAACCCTTAGGATCCGTAGCATCTTCCGTC GGACACAACCGCATGTTATTGGTTCATGTTGATGCAAAATACAACgcgtt tttgtttgttttggtggaACAACCAGGTCACATTCACAATGTCCCTTAAA AGCAGAGCAAGGTGTATatagaatggatgatctgttacgAGATTAGTTTA ACCTGATTTAATCTTCTTTTGCCCATGGCCATTTCCAAACCACACCGTTG GATGTTTttcattagcgagtttatgtaatCGAGAAaaatcgaaggagacg gtataaagcaaagttgacatgtcccCAGAATCGCCGTCCACACGgtgaaa acaccaaaataccgttgTCTGTTTAGGTAAACAAAGGCGATAtggagccg tacatcaactattgACTTTGTTTGCGTCGAACTTCCTGTAATCATCAAAA TAGATTTTCCAAAACATTTGGACTATCAAAATTATTGGTAAAGTAAAAAG TACCTTTTTAATTGTTTAGATTTAATGGGTGATGACCAGGAGAAGGAAAT GCAGAAATTGTATGACGCAATCGGTTATACTGAAAATGAAGTCATCACTC CCTTTCCTAAAGAGGTACTTTTATTACATCACgcttttaaaacaattttt cagtAGTTGCGACTCTTTTGGTCGTGGAACAATTTGGGCCATAAAAATTG TATCACTAATTGGCTCAAATTGACTTCCCTACGCCCTGTGGCTTCTCTCC CGATTAAGGTCTTTTGTTTCCGCCATAGCCGTAATCCTAATAATTTTTAG TACAAGAAAAACCCGCACAGTTTTGCCCGAATTTAACGGTTAATTGACat ttcttgatatgcgtaagtcatttttatAACGGAAACATCCGACAAGAGCA GGGATTTGACCACTGTCTGTTacttaaaaaaagaaacacgGTTGTCAAAA AACCCGGCTTTTTCGGGTGTTCCCGTTAGAAATTTGATGTCATGTTATCT TACAAATATCAAGAATTCCCTGCAAATCTTTGTACTAATTGATCTCATTC TGTGTGTTTTATTCAGTACGTGGCGATGTCAGTGGAATCGATTCTCCAGA AATTATTCATCAGCCTCATCGATGACACAGATAAGTAAGCATCAACTGTC TCAATTCAATTAGTTTGATCATATTGTCAGTTGTAGGcagacccgaaggc tcctcttttgatagctatctacccgaacgTAGGGGATTGCGCCATCCTTG ATTCCTCTTCAATTAAGCAGAGATGCATTATTCACCAATTTTGTACTAAA TCCAAGTACACAGTCCTTGATATGACCCGGTCAGGGATTAAACCCACCAC CTTGTGTACCATAGCCAAATGCTACCTTTGCACTACGGTTGCTACTTTGA TGATACACTCCGACGATTTTTTGTTTCAATGCTCCTAAAACTCGGGCAGA CTTTTTACTGTTAAGGGGAAATAGTCAAGTTTTAATTCATAATACCTTAA TTCCATCAATTTCTCGCGCGCCTTTTATTTTCGCGCCTCTAATTTTCGAG CAGCTCGTAAAATAGATCATTCGCGCATCCTTTAATTTTTGGGCATCTTG CAGATTCTGAAGtattttttgagtgttttgacgATTTAAATTGAGTTTTA CCCactttaagtgtgtattcaaaCTAGATTTTACATCCCAGAGGCATATT TATCATGAATCTAGGTcccattttattaaaaaagccttcagaTGAGATTT CTACACGTTCAGAACGATCACTAATTCGTGCATCTTTTTATTTTCGCGCG GCCAAgtgcgcgaaaattaatggAATTTTAAGGTATACATTTTTGTCATC TTTattgaaagatcttctaaatAAAGTGGCTCACGTTATGAAGAAGAAAC ATCCCCATATTCCATTTCCCGAATCCTAAGACTTGATTTTAACACTTGCT CGCTCTGATAATTTTGTCTGGGTGTTTATTTTTTAAGGGCGAAAGAATTC AAAGTGTTGGATTTTTCACTCAACAACATCATTGTAGAAGTTTTCCAAAG ACCTTCTGCTCAAGCTCTCAAGTAAGAAAGAAACCTACCACCATTTTGTA TTCCTTAGCAACAAACCCTCCACCATTTTGTATTCCTTAACAACAAACCT TCCACCATTTTGTATTCCTTAGCAACAAACCCTCTATTCCTGACTATTCA ATTCCCTTCATTTTAAGAAGGGTTTAAATACGAACTCTTTACACGAAAAT GACTTTTTGCCAACGAGCCTCCATCAAAATCATCTTTTTATCAACAGTAC TGTAATGTTCCAAAACGTATTAGTAGTGCTTTTTCAACGTTTCTATGTTA CCTAAACATTGAGCCTGTTTGAGTTCCATCGAAACGTGGCATCAAAGATT GTTAAGAAATCGAAGGTTGTCATAATTTTATATAGAATATCTACATCGTT TGTCTGATTGTCATATATTTAGATTATGTGCAAAGATAGGAGAGATGAAG TTATTTGGTACAGCTTCTGCTCAATGTACACCTCtcatcatcaaaaacat gttaCAAGGTAATACACCAAATCCAAAACGTCCATAGCTTCTTTTCTAGC TTCTAGAGTTTAAATACGGTAAGTCCGAAAGCCACACAGTTACTGTATta ctcgaataaacgccccttcgaATAAAGTCTCCTTTGAATAAACGCCTCCT CCCCtaggaggggtgtttatttgaaACAGGTTGTAATTTGAAAGTATACT ACGAAGAAAAACTTAGATATACAACAATAATTGTATTCTTTTTGTATTCG CACTGGTTTTGACCCGTTTTTACATCCCTTAATTGACATATTTGTACTCA AATAATAATGAGAAGGCAAAATAAGTTACAAATTACATTACTAAAGTGAC CTTGTTTATAAATTACTAAATAAACGCCCtctctaataaacgcccctccc aaAACCCAAAAAAATTACGCCTGGGCGTTTATTCGAACTAATACGGTATT AGACTACCTTGTGAATAGCCCGAAGGCGCTCAAGGTAAGCGACCTATCGT ACGTGCGGATATTTAAGGGAACGTGTTTCAGGcctcccaaagtgcactgt ttAAGgatgaaaaatgagaaaaacgtTTTTGAGGCAAGATTTAGGAAAAT CTAATCTTTTACCTTTGAATGGAAAAAAGTGCACCGTAAGGGTTGAATTT TCGCACATGTTTACCCAGATTTGGTTAATACTATCTGAGCTGAAAGAGTC CAATTTTGAGACCCTAATTTGCTGTCTGCACATACGGtaattaccgagtt tatgtatgtgtgtttttcagcgacggagacagGTCAGGTTCTAATTAGAC TACATCCTGACCAACTGAGAACGACGGTAAACGAGCACTTTTactgtcct cgattttgcggatCAGAAGTgcaggtttttccaaatcgcttcagtcactt tgccgtcctcaaaagtacaaatacataaactcgctattttagaccaagtt acggtaaggAATTTCTTACTTTTAAGGTCGAGGTATGGAATTTCTGCCGT TGGTGGACTTCATCTTTGAGACGAATCCTTTGAAGAAACCGGACATTGAC CAATGTATCACTGCTATTTGTCAACCCTTAGAAATCATCTATGATGCTGT AAGTGGTGTAAAATATAACTCTTTTCCCTTGCCAACTTTAATTAGCAAAT TTATGTGTGTTTTGGTTTTTCTACGACAAGGATGTTTAGGTTTTGATTCG GCTAGATCCTGACCAACCTATACTAGATGTCGCatgcgttttttctacgc aattaacttCTATTCCACTTTgggactttttcgaatgttttgagccggGT TTTCGGGATGGTAAAGACACTGAAGTTATTTTCTCAATTAATTACCGCCT CTTTCTTGCATGGTAGacatattttctattttctttgtaGAACACGATCA ACCATATCATTAGTTTCTTCAAACCTCCTGAACATGTTATCTTGCAAGAG TAAGTACACTGAAAATCACCTTCAACAAAACTTCCCACCTCTCATTGCTA ACGAAACAAAACCAATGAGAAAATCCTGTGTACAGTCTGCTGATTACTTT ATCACGAAATTGATAGTGAGATGGTTAAAAGCAAATTCTTTCAGATTAAG AAATACTCTGAAACAAACAATAGGATTGGTAAATATTAAGCAGTTAATTA AGTAAGTGACCCGAAGCGAAggttcctctttcgatagctatcgaCCCAAA TGTAGGGGAGAGGGCTACTCTTTCTCCCTGGGTtgttccacttacccttg atccatCCTTTTAATTGCTGAGTATTTAAGCTCAGATGCATTAAGTATTA TTTCGTAGTCTTTGGTATGACTTGGCAAGGGATTAAACCCACGACCTTGG GCGTCATAGCCGAATTCTCTTCTTTACCTATTTTACACTGTGGTGTAAGT ACGTCGTTAATTAGTTCGATGTCTTTTTTTTAGTTTACAAGACAAAGCGT ATTCTACTTTCGAAGATTTTAAAGTTTCAAGTACGGCTGGTCTTCTACAT GCTATGGAACAAAGAACGGTATTGTGAAGTTTTCTTTAACAATAGTATTT ACTACTACATACTAACCAACttcaataataaaatattcAGATTTCAGTGT TTAAAATTCTTCGTCTATATAGATGAAATTTCTGACACCCGTGTCAataa aaagttctaaaaaattctaaattttcgaAGTCCTTGCAGACAGATTAATT TCTTATCTTTCAATACCAAATCATTAAAGCCATTATGTTTTTCCGAATTG CTGCTTCAAAAACGCTGAGCTTGCATAAAGATTGCAGttattcaaccaat catcaataCAAAAGATAGCGTGTGACGCAACTTAATTGTTCGATTcaaca ctgcaatgtcttcactttaatataacattttaatgaccagagaGTCAATG TTTTGAATGCAAAGTGTCGAAtaagaattggaatgaattgtctgcgtttt taatggagctgtgGAATGTTTTTGCAGAATAAGCAAACAGGCTCATAAAT AGATGTACTGactttaatcttttttttattgcgTCCTATAGGTTATGGAC ATCGACATTGATGTTGGAGCATCTCATTTGATCATCCCTGAAAAAGGTTC TTACAATGGGTGAGTTATTGGATTACACAAAGGGTTTACGATCGCCAGAT CCGGAAATTTCCCtttaaaaaagcggttttttgggattttctcgaaattt tctcattagtctttactgattttttgttttcggTTGACCAGCTAGGTCCA TATGAAAATGACACTTTCTTTCTCTAATTTTCAGTTGTACAGATATGCTG GTGATCGACTTTGGTAAAATCACGATGAGCAGCGATCCTAGTCAAATCAG ACACCTTGACCCTAAGGTAAGTCATTATCTGCGTGTGTATCAGTATGGTT ATGAGATCGTTATTAAATAATTACTAATTAATCTCAACATACagccaact ctctctaattcgaactaaaatatttgtcCCCTCAGCTAGAAATTAGCTTA AAATATCTTCttaaattcgaatctttctctaattcggagaaaattcttgg tctcttgaaagtcgaattagagagagtcaattgTATTTATGAGGGGGAAC TATTGATTTCGAAAGAAActtcgaaaattttgtttttacctATTTTGCTA AAATACCTTTATATACTTTAGGTCTGGTCTAGTGACCATATAAGCCCCTT CTCTTTTAAAACAAATAagccagccgaggctggaaggtcagccaatagag cttagctagatagctttaataagtgggttaacagaagAGATGCACTGAAA AAGAGTAGACTaaatatgttgaataatgtacaaaatgtgaaacatttgat aacttgatttaaaattaagtaaaacaagcctgagagctcctccaacNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNcaagtccaaaaaagca caattgcatccagtctttatatcaaatttatacagtagctgtacttttgt aaactttatcaaatcccaataacattataacactaTCAAttcccctagag gcaaacaagaaaaatatgtttttattgcaaaaactatttataaaaagcag caataaaaagcaacataaacaaaaacttgagcaaacggctttaaaccttc aaaggatgtagaaaaagaatccccttgatgaaaatcatgtgtttgatctg ccgagttaaaaaaataaatgacagaaattgaagcttgcaacagatttaca ctggaaatactttggtacaacactaacttatcacatctgacttatcgctt gagccgccatcttgaaacaccacattatgatctgtaaaaacaacgcacgc taaaagtacccaaaaagttaacccgatcggaagaaagtttagaaatcaaa gtgagatcggaaaatcggattttttttttgtcgtcttatgatgatggtga tgatgatggaagaaaattttacctatttgaatgctcagcttaggctgacc aataagacttaaactttttaaatataaactCTCGTATTATAGTTATTTTG CAAATAGGAAATCTTCATGTTATTGTACGCAAAAATGACTAATAGCGATT TCCAATTCGTTCGAcgtaaaatattcaaaagtcTTAACCATAAAATTGGT CATTACATTACACCATCATTGTAAAAAGGCCTCTGTTGTATATGTTGAAA AGGCTTGTAAAAAGATTTTGGTTTTGCAGAGAGGCTgtttacagttgact ctctctaactcGATCTTCACTGGACCAAAGATTataatcgaattagagaa agattcgaataatagaagttcgaattagagagaattgACTGTAGTTGTCT AAAAAAGCTTCACATCTCATTATAGGACATTGAGGATGTGAATGAAGTAC AAAGCAAAGCTTATGATCGATTCTTGTTGTCGCTTCAAGCTCTTCAAATA TTACTCGTTAGAGAAGGTTTGAACTTTATCATTTCAAAAGCGACAGGTAT CTTATAAAATACACAACTTGAAAAAGACACATAAGAGGTCGAAATATCGT TAACGAAAAATATGttacgttttatttttatttggttgCACATAAAAACC ACAGGTATCTTATAAAATACACTAGATGGAGCTTATTTGTCCCTAGCTGG AACAAAATAAAGCGTCATCTTTAATAGGTAGACGACAGTTCGGTGCCGGT AATTTAATCGATCAAGACCATTTGGTTCGCGTCATGCAAGGTGCTTGTTT TGATTTGTGTTAAAACTCCTAAATTATCAATTTGTATTTTAGGTGAAGAT TTAAAGAGTGCTAAAAGCAACGTCAGTAAAGCTTCATCACACATTTTGCA TCCCATCAATTTCGATGGCAAACTTGCCAAAGCTATACTTCCACAAGATC CACGTTTAAAACAGTAAGAATGTTGTTTCGTTATTAGCACTCAATTCTGA AGGATGGCATGGCTCCACTTTCTAAGTGGTTAGTAGTTTCACGACTGTAA GGTATTTGCCACGAAGTAGTATGCTGTATCCGGTTAAAACAGCGAAAAGA ACCCGAGAATGAGAAAGTCTTGCCATCATATGGCACCAAAACGATATATA TGCCATGCCTCGTTCAAAAGGTTGTTAGTCTTCTGTTCTTATTCTACTTT AAAGAGTGTGGTGGTATGGGAGCTATGCGCGAGTAATAAGGGTTCGAGTG TCGTGAGATTCGAAAAGTTCCTCTCATACAAAATAATACGATATTCTGAA ATGAGGACCGCATCTATGACAAAAGCGAGGGTAAAAATCTCCTTGAAAAT TCCAATTGCATCTTTATTAGGCTTTACTGTTTTAGCATGATTGCCAATTG CAACTACCTTgataatcaaatattttttccttattaGGATATGTGTCTCT GGTGAATTATCTTCGCTGTTTGTTTCTGTATCGGATGATAAAGTCAGTCG TCTCATCAAGGTACGTTATCGCGCCAACACCCTCCAATCCTGTCTTGCTT TGTGTTTGTTCCTTCAAAAATATAGTCGAATCTCAAAATATAGTCTGATT TTCAAGGGGCCAAAAGTTTTATTCAAATTATAACAAGTGTGGTAAATCAA TGCCATAAGACTGCTCGATTAGTAAATAACCAGAGGcatatatcaatatt ttaaaagttttatcttcCATATTACTCCATCCAGATTACTGTACATATGA TNTTAGGATATGTGTCTCTGGTGAATTATCTTCGCTGTTTGTTTCTGTAT CGGATGATAAAGTCAGTCGTCTCATCAAGGTACGTTATCGCGCCAACACC CTCCAATCCTGTCTTGCTTTGTGTTTGCTCCTTCAAAAATATAGTCGAAT CTCAAAATATAGTCTGATTTTCAGTATAGTCTGGTTATAACAAGTGTGGT AAATCAATGCCATAAGACTGCTCGATTAGTAAATAACCAGAGGcatatat caatattttaaaagttttcttcaaTATTACTCCTTCCAGATTACTGTACA TATGATTATAGTACCTAAGCACGGAACTCAGAGTGAtgtactttttagtt ttttaatcgaagataacttttaaaatattgatatttgaaGTATAGAAAAA TTCGCATATACGACTTTCTAGTTGAGGGGATCGATTTTTTAAGttagaaa taaataaagattccaataatgggctgttccaaaaaatttcaagggggttg gacgaaccttttcaagtcaaaacatatttctttcaaatgtttggataccc cctgaaaaaaaataattttcatgtcTTAAAGTGAGTGTGGACGAACTAAT ATCAGTCGTTTACCCCTTGGAGGTTTAAGAAtagctttttaccccctgaa aaaatgaaaaataccccCCTGGAGATTCTTCTCAGATTGCCCCCTGGAAG AGTTCGTCCACCACCACCATTTTATGGATATAAAATAGAATGGCCCAATT TTAGTTGAACTGTTAGCAAACATTTGGAAAAGAAGTTGTTCTATCTATAT TAATTCGTGGTTTTTTTTATTGCATTGTTAATCCAAGCTATGATTTTTGA ACAAATGATTTCTCCTTTTCTATAGCTAGCAGACTCGATACCACTCCCTC AATCACCTTCTCACGATAACATCGACGGAGAAGAAAAACCTGAAGGACTC TTCACCAAGGTAAATTGTCGACCGCTGAGGAAGGATTTCATGACAATCAT GGACAGATCTAACCGGAATCACTTTCTTTCGCCCTTCCCGTTTCGAAGGA GTCTTACTGTGACGTGGGTGTATCATAAGTTTATTGCTTATCGTACACTA ACGCCAGCTTATAACCAtccactacacgttttttataagaacgttcaaaa tgtttgaagccttcgaatgttcttaacatgttcttaatttcaccattttg tgagcgtTTTGACCAAGAAATCGGGTCTtttagagtctacaaagccttaa attgtttacttgttcttaatatttatgTTCATATAatatttagtttgttc ttatagccATAGTTTTCCGATTATAAGTTTAAACATGATTTTGCGGCATT GTGGgtataaactttttgtttttgaactATTTCCATCAATTCCAAattat tgattttgttttgtcGTATATATTCTTTCTTTGGATTGATTCACTAGTTT TGGGTTCAGTTTTGGCCTACATCAACAGTTCTGTATTGCTTtcttcatgt ttttgatgggaAAAACTGAGTGAATGTAGAAACATACTTCTTTTGTGGTT GCATCTAGAGATAACTTACTGCATATGTTCAGATAGATCACTAGAGTTGA TGCTTTTTCATGGTCAAGCTTACAATGAATTTCCAAATTATCTATTCGCA TATTTTAGAAGAAGAACAGctttgtttcaatatttttttctactaGGCGT TGTCAATGATAAGCTTGACAGGTGACAATGACACAGGGGTGGACATCGGA GGATTTTCCATCCCTGTACCGACATCTCCAACATCAGTGACGTCAGATGA AGATGAATACGGGACACCACCTGATGGCTCCATATTACAGTTACAACAAG AGTATGTTGTTGTTTACGAAAGAAAGGAAATTAATGAAGTAGCATACCAG TAGCCtagacaagaggggcgcaaaaaattttatgacactgtaattatcta tttatACCGGGAATAGATTATTACTGTGTCatgaaaatctgctctcctac acaaatttttcgcccctcttggctacgctattGCATACATAAAGTAGTAT GCTGGGTATATTATTACTAGGGTCTTTAATTTAAAGGAAGGAGCTGTTCG TGCGTGAGGTTGGCGTATTGTGAAATTTCACACATTTAGGTTCCGCGAAT TCTACTTTTCGAAGGATTTAAAGTCATGAATTTACGGATAAAACTggtat tcttaaaaaaaaagatttgaaaatcaattaacaacattttttgtgtgatt ttctaTCTGCTCTTAAATTTCACTCCTTTGCAAAGTTTCTTGTTCGTATT TTTTTAGAGCTGGTCCGGACTTTTCATCAGGAGTGGCGAACCAAGTCAAA GTGGACTTGAACTTTAAAATCCATAAAGTGATGATCGCCATTGGTTTGAC TGACAAAGCATTGAAACAGGAAAAAGAATGTCTGAAATTCATCGTGGACG ACATCAATACAGAGGTGAGCTTCATTCCTTTTACCATATATTATTTACTA TAacagactggagtcgtttatggCGAGTACTTGATATCAAGTGATATACA GTGGAGTATCTTTAACTCGAAACTCTATAGCTCGAATGTCTCATTAAcac gaacaagttttatggtacCTTCAGTagcaatgccttataaaccatactct acaactcgaaatttcctcaaGTCgataaatttgtgttccccgtgcgtgtt cgagttatggagactccactttaTGTGTTTTATGATGATTCGGTAGTTGG TACGGAATAATATCAGATGTAAAAAGTTGCTTTATTCAGATTTTCTTACA ATACCCTCAAGATATCATTCCAGGGAGAGGGTACTACTCTTATCTACCGA CGGGTTTGTGTCGCTGAGGCtcaaaaaatggaccctacacGATGAACTCG TCTTTTTGAACATCTTTgggaaaaaagtgacccttaattggattgaaatt cgaaaatttcctcaaaatctTTCACAAAAAGGTATCCTACCAgtgactga tttttttaatttgatgtttttgcgaccctacctgggactcacgGAGGCAG CACATCCCGTATTCCTTTTTGCCCAAGTCCTCCGNGGGGCGCAAAAaatt ttatgacactgtaattatctatttatACCGGGAATAGATTATTACTGTGT Catgaaaatctgctctcctacacaaatttttcgcccctcttggctacgct attGCATACATAAAGTAGTATGCTGGGTATATTATTACTAGGGTCTTTAA TTTAAAGGAAGGAGCTGTTCGTGCGTGAGGTTGGCGTATTGTGAAATTTC ACACATTTAGGTTCCGCGAATTCTACTTTTCGAAGGATTTAAAGTCATGA ATTTACGGATAAAACTGGTATTCTTaattaaaaagatttgaaaatcaatt aacaacattttttgtgtgattttctaTCTGCTCTTAAATTTCACTCCTTT GCAAAGTTTCTTGTTCGTATTTTTTTAGAGCTGGTCCGGACTTTTCATCA GGAGTGGCGAACCAAGTCAAAGTGGACTTGAACTTTAAAATCCATAAAGT GATGATCGCCATTGGTTTGACTGACAAAGCATTGAAACAGGAAAAAGAAT GTCTGAAATTCATCGTGGACGACATCAATACAGAGGTGAGCTTCATTCCT TTTACCATATATTATTTACTATAacagactggagtcgtttatggCGAGTA CTTGATATCAAGTGATATACAGTGGAGTATCTTTAACTCGAAACTCTATA GCTCGAATGTCTCATTAAcacgaacaagttttatggtacCTTCAGTagca atgccttataaaccatactctacaactcgaaatttcctcaaGTCgataaa tttgtgttccccgtgcgtgttcgagttatggagactccactttaTGTGTT TTATGATGATTCGGTAGTTGGTACGGAATAATATCAGATGTAAAAAGTTG CTTTATTCAGATTTTCTTACAATACCCTCAAGATATCATTCCAGGGAGAG GGTACTACTCTTATCTACCGACGGGTTTGTGTCGCTGAGGCtcaaaaaat ggaccctacacGATGAACTCGTCTTTTTGAACATCTTTgggaaaaaagtg acccttaattggattgaaattcgaaaatttcctcaaaatctTTCACAAAA AGGTATCCTACCAgtgactgatttttttaatttgatgtttttgcgaccct acctgggactcacgGAGGCAGCACATCCCGTATTCCTTTTTGCCCAAGTC CTCCGCCcttattattctgaatctgatTTTGTGTTTCATGCGTtatgttt tcttcttttcaaggtGATACTACGAAGATGGGATTTGTTCGTCAATGCAG AAGTTGGTCGTCTGGTGTTGAATGAAATGACATGGGGTGTTGATGGAGAA CCTTTCGCCATCATGAGTACacccaaaaacaccaaaatgttGAAATTCAG CTATCGGAGGTGTGAATTCAACGAAAGTTTGAATCTCGGTCCAAGTTACT TTTATTCCAAAGAAGCGCAAGTCAGAGCTTTACATTTCAAAGATGAATTT GGCGCCACGGATCAGATTTTAGATGTACAAGTGGCTACTTTATTTCTGAT GCTTCATCAAGAAGCACTTTTGAGCATCATGTCATTGATCTACCAAGTAC TGGAACCACTCAACAAACATGATAAGGAAGCCACACAGAAGATCAAACGG AGTTTGAGTACGGCAGGTAGTCGTTTGAGTCTCTCCatcgaagaaaaaga aaaggagaGACAGATACAACGAAAATTAGCCAACCCTAAAGCACTGGAAG CTGCCAACGAACTTAAGCAACAGGTAAGTCAATGCACAGAAGAAAACTCG ACACTAAATTCTACTTTTGGGGAGCTTGTAGCCCAACACACTCTTGGGAT ATGAGACCATTTTACATGCCTTTTAGCAGACCCTGCTTTTCCACTGTAAA TAATGGAATCCAGTTTCCTTTTTGATCTTCAGTGGACGCTGTCCTGTCTT TCTTCATTTGGAGAAGATTATTATAAGCTTTGCGTATTGTGTTTCAGTTG cgattttcctttgttttaaaAAACATCGAATTTAGGTATTCATAGAATGA TAGATAGAACACTTGTTACACACCTTACATTGAATACACCAATCAACCCT TAGCATTTTTGAGAAGACTGGTAACGAAAGAACAAGAGAAATTCTTGGTA TCGAAAACACAAGTGTAGAAGTGCTTTTTTACCCATGCATTAAAGCGATA AAGTAACGTCAATATAGTTAAGTTATTCGAATGCTAACAATAGTTTGCGT TCTACCGCAGAGACTCTAGTGTTTTGGTTGCAATTAGCTTGGTTTTGATT TAGTTGTTTTTCTCTTTGGAACAGGTTGGcttagaagaagaaaaaaagat gaGAGTGACCGCCCACCTGGATGGTGTTGGTATCATGATTTGTTCAGCCA AAGTTGACCTTGCACAAGCCTTCGTTAAAGGGTTATCTGCTAAAGTACTG ATGAAAGATGACTTATTAGAAGTGAAAGCCAGCATGAAAGATATGCAAGT ACAAGATAATGTTGGCGAAACAAAGTATGTTGCATactcgtttaatattt tttttgagttatctaaacttttttattttcagtgaattatgacttttttt ccaGTACAAATGAAATTCATTTTACATTAGTTTGGCGATGTATAGCTTTG CAGTACCGTGCAACAAATTGATTGATTAAATTTGTCTGGGCCGAAATTTG TCAtcctatttttgaaaagtttgaagcAAACGATAGTTCTTCAAAATGCA CGTTTTTGAAACGTTGTTTTTTTCGCCAACCACGAGAAATTCAAACAGTT GTAAAGCTAGAAAATTTGACAGCCTTTTGTTAAATTAAAAAAGAGGGTAT TATTTACAACAGTTCATCAGAAACTGTTCACCAGTGTTCTAAAATCAGTG TTGTAAAATTTGACAAAACTGCGAATCTGTGCAATGCACCAAAATGAGCT AACCATGTAATACTCCGATATTTGACTTTTCAGGTACAAAGACATCATTA GCATGCGATCTGATGAAGTGTTCGATTTAGAGTTGGCTATTTACGAGAAT GGATCTTCTGGTAGCAAGCAATACGATATGTCGTGTGTCGACACCAGTGT CAAACTGAACTTCGGTCAAATGCGCGTTGTTTTCTTGTATAGATTCATAC AAGACTTAATGTCATTCACCGAAAACTTCGAAGAAGCACAGAAAGCAGTT GTGGAAGCTGGTAAAGCTGCCAAGGATAAAGCTCTGGAAACAGCGACCGA TTTGAATAGACATTCTTCTCGTGTCAAACTAAATGTGGTTCTGAAAGCAC CGACTATTATCATTCCAGTTGGATCAAACAATGAATTGGCTTTACTGGTG GATCTGGGTGAATTGCGTATTTACAACACATTCAAACTCCTCAACGATGA TCAATACCATAAGAAATCTATCATCACTGATAACATGACCATTAAGTTAT CCAATCTGAAATTGTTAAAAGCACTTATTCAAGATGGTAAAGATTTCTTG CATCAACGAGCCATTATTGAACCTATGATGCTACAAATAACTATTGTTCG TAATTTAACGAAAGGTAACCATTCCATACCGGATGTTTCAGTTCAAGCAA AGATGCCAGCTATTCTGTTATCAATCAGTGAAGAAGATGTGACCGTAGCT CTAAAGATTGTCCAAGGGAATCTCGCCGAAGGTAATTACTAcagtactct gtaccagagtatATCTCaagtttatcgcttcgtagtacactctgtgctcA TTTTCTGTTTGATAGAACAATTCCCGTatggagacctctgcgatgaagta tgacttataaatagcaacacttctcttgttgtctcccctctctcaccacg CTCCATCGCAACGGTCGGCTTGAAAAGTATCAAATGAGAAAAGGTTTTGG GGTTTGTGTACAGATAATTACTACAGTGGCCTCTCCCTAATTTGAATCCT TCTGCATTCTTATTGATTCCTTTTTCCCCGTCGATGTATACAataatttc tttgatttgaaTCTCTTTGTAATCCATATGGTATCAATTTTCGCTTCAAC CTTAAGTAGATTCAATTTTGCGTGGATTTATTTTCGCACTTTTGCTGAAT TTATGCTGCTTTCGCCCAAACATTAGtccttgcaaaaaaaaaaaaagcca aattGTCGCCAAACCCCGTAGGATTATAAAAGAGGAAAATTGAAATAGAA GAAGTTTTTAGAAGAAAAATAGGCTCACTAGCGCTGAATTTTAGATTCTc aattcgcgaaaaaaaaagtcCACGTGAAATTTAATTCACATAAATTAATA TTTTCCTTATTATAAGGTGAGTCACATGCGCCGAAGAAGCAAGCCAAGCC TGCCAAACAAACGTTAAACGTGCCACAAGATCGTTTAGCAGACATTTACG AGGAGcctgaagatgaagatgagaaTCGACAAGGATATCTTCAAACCAAA CTATCCTTCGATCTGGCTAAAATTGACATCAAGCTTTACTTGAAACCATC TGATATGACATTTGAAGATGAATTTTTAGCGAGGACGGATGATTTGTTGT TAGCTTTGTTCACTATTGGTAACCTGTGTGTTGATGGAGACATCATGTCC ACGCAAGCTATGAAGATGAGCGTTCGATTGGACACTTTGGTGTTGGATGA TATGAGACCTATCGAGGAGCATGAAGGTTGGTGTTCATCTTAGCTCTTAG TCCTAATCACCATATCTTATATGAAACACTTGATAAAGCTACTCTCTCTC TGCatttcccaagcaacggcaggtgaagcaaaatagtccgccatctttgc tgaaagtagaccACAATAgaccaaaaatatttgttttcactgttgaaact ttttcgacactgcaatgacttcaagaTTTAAAGGATCGCGCAAGTTAAAT CTTGACGTCACttcattcaagatggcggattattttgtttttcgaaaatc tctATCTAccatcatggtcgtaatatttgagaaaaaagggaaattttatA GCCACAATCGATTtagcgctctaacttaggttggaagggtagaattTTGA CTCTGatttttaacatgagacttaggatctgaggatccaaaagttcaaaa atggtccaataaagctcaaaatatagcctggaagtctataaacccgagcc aaattgaaatatctgaTTAAGTTTAAGAGATGGCCCTggatggcccaaaa tcgactttctcggcCGAACTccgaatttcgaaaaacgaggaaataagatt aattctcaatagatgtcgaccatgattgtagttaaAGATGGGTAGTCAGG ACTGCTTGCACCCTCATAACGGCTTACCGTTGGTTAGAGGGGAAACATTT GATGTTTTTGACCAAAAGAGAGGTTTGGTTTTCAGAGGGCGATTATCCTT GTTACCCATGATTCCCTTCGCCTGTGAATTGGTCCATTGTTTATGCCTCT AAGTCCGCTCcattttgtaaacaaatttCCTCTGTTACTTAGATGTCTGA TGTGATGCTATTTTCACCTGAAGTCTGTTCCAATGAAAGTGGCAGTCCGc acattttgattttaatacaTTGCTCTTGAGGagaaaacataaaattaaaA GGAATacatcgttgaaaagataatcttaAGTGGGTCATTTTAAGACTTCG AAAATTTcgtaaatgaaaatgaaaaaaaagaagattttttaactttaacc AAAGAAACTTTTCGAGTAGAATAACTTGATAAGTGTTTTCCGTTTCTTTT TGAAGGTGTTAAACGTATGATCAACTACAGTCCCGAGCCACTCCTTGAAG AAGTCAAAACCTCTTCTCATAAACGACCAATCGACAACTCACGAATGATC GAAATCCAAttcgatcaaacttcatcgcaagataaaaatatcgacATCAA ACTTTGTAACATGCTTTGTATATTCAACGTTGAGTTTATCATGGTCCTGT TGAAAACGTTGCAAGCTGCCATACCTAAAGATGATAGTCTGCAACATGGC CATTCAATGAGTAGTCTAGACTCGGCGGCAGGGTCTGGCGGCAGCGATGA CGAGGACTCTTTAGAAGCCAGCGAGATTGTCCTCTGCACTGGTGATCAAG AAAGACCTGAGACTAAAGTCTCTATCTTCGTCCATAACCCGCAAATTGTT TTACTAGCAGATGCAAAGGATGTCAAAACAAATGCACTCTTTCTTACAAC CGagatcaattttcaatatttcgaaTTGCGAGATACTCAAAAAATGATTG GCGCTGTTTCTAACACCGCTATTTTGTCAACTGCTTTCAAGAATGACCAT CGGAGTGATATATCAACAGTGTTGTCATTAGATTCCATCAATCTCCACTC GTCATCACCCATCAATGGTAAACCTCATATGAGTGTCAGCACAACTTTGA TCAAACTGAATATCTCACCCAAAACCATCCGAACTTTATCAGCGTGTGCT GGTTACATCTCCAATGATCCAACAGATGAAGAAATCAAAGAAGCTCGAAA AGCCATGCGTGATTTATGGCAAATTCAAACGTTCACCAATAAGCGACCGT GGTATTTAAACCACCCACCACAACAAGTCTTAAGTGCTGGCAGCTTCGTC CTTGCGCGAACGAGAACAGGAGAATATAAGCATGGTTTCTTAGCTAAAAA GGATGTCTCGTATCAAGTCTATTTTTCAGAGGAGCGAGGAACAGCCAGTC ACCGAGCCATGGATATCTCATCTGTTGTTTTGGATATCGTACCGCTGATC GGTGATCTATGTGTTGGATGTAATGTTTTAGCTGTGGAATCGAAAGAACA TGGATATCGTACTGGTCGAATTACTCAGGTAATACTTTTGgtaaattctt aatttttttaatacacCTGAGAAGAGGGGGCTGGCTTCAAGGTTGCAGTG ACGGTGCATTGTATTGATGCATTCATAGTTGTCTAAAAAGTTTGATGACA TCACATTCATTCCCGTGATTTCTAAACTCCAATCCAACtttctaaagtct atttcaaattggctggcagtgtttttcaaacctcaataacttttgatcga atttgaattaagtagcgattttgtgctcgttgaactTCAGTTTGACTCAA GACTCAAGACTCTGTATATTTTGATACGTTGTtcttgttggacctacccc ggtggggtgttggacctaccccgatGGGGTGGaagtcctataaattaacc gtttttcgttcgttcgttcgttcgttcgttcgttcgttcgttcgttcgtt cgttcgttcgttcgttcgttcgttcgttcgttcgttcgttcgttcgttcg tgattggctcattagttatttctgattttttgctcaaagatgtgtaacta taaaccctcgaatgtgatggagcccgattttcgaagaaaaaatttatagg caaatttgggccaaaaaacggctaaaaaacgggttttttggactttgtga aaaattggatcattaactttttctgattttttgcatgaaagtagggtacc atcNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNgtagggtaccatcataggtaaaagatg gctcaagcagattttttcaaaaaaaatttgttggctcaaaaaacgcatgt ttatctataagaattactattaataagcatacatcgatgttcttagttaa attactcgatttatttatgagatagatgtttttcttgctcatgagggctt acttttgaagaatgtgagtgtttagacatgaaattttggttgcttggcgt gtttttatagaaaaactggccaaattcgatatttatttataagcacatta tcaattacttaggtattattttttctcgagattggctctttgattcttta tgattttttgtacaaagatgcataactataaaacCTCGAATGTGACGTAG Cccgactttcaaaaaaatttcttggggcaaatttgggccaaaaaacggct taaaaacgggttttttggactttgtgaaaaattggatcattgattgtttc tgattttttgcatgaaagtagggtaccatcataggtaaaacatggctcaa gtagatttttttcaaaacaattttgttggctcaaaaaacgcatgtttatc tataagaactactattaataagcatacatcaatgttcttaggcaaattac tcaattttttgatgagatagatgtttttttgctcacaaagtcttgaatat gaaaaaatatttcaagagtatgaaattttggtttctaaacgtttttttaa taagaaacaaacgactacacgtttttttttataagaacgtcgaaaatttt tgaagccttccgatgttctaaactttttgagttttaagcctagaaatgtt cttaaaatgttcttattttcacaattttgtgagtatttttgtgcaatttc ctaagcaattgggtgttttcgagtccacaaagccttaaaatgttcttaac atgttcttaatatttcggccatcgaagccttgtgttcttatatactttgt tcatAAAAGTATCCCTTGTTTAATAAGAAAAgatacttaagggctctgac catagtgaatttttaatatttgccacttacaaaatataaatttctacttg atgtagcccacaaaactgtgggatgttatacatattctgttaggccaatt atcaaaaaatttgatgaagaagaaaatgaagacttttgcgaagaagagta ttttcaactttgaagagcttagtttcggtgaagaaaaaacattttgaatt ttttttgcggtagatggtgtatcttttatcgaactaagattattttttcg gaaaatttttctaaaagcttatttgcttcaaaatcttgaaaatagtgctt tttgaccaattttccaacccaatttttcatagaaaatcagccataacttt tgatgcattaatttagaaaaactttccgaaaaatttaaaacagttcaatt ctttgcggacagtttgaaaaaacttcgaaacaaaaaggttaattacccat taaaactttgcactttttataaaagaaggtgatgcaacatattattaacg tctttttaaagttcataagttcatttttgcaattaaattcttaattactc ttaagggatttgattaaaaagcaatttataaaggcaattctttgttgaaa gtgttaaagaacctaaaacataacttttatgttcaaatactaaaatcaat tttccgactatgatcagagcccttaactTAAAGTAGGCTTTCGTTTGAGG GATCATTTTAAGTTATAATAATGATAACCGGAAATTGAGTTGAAAAACGg ggaaagaaaaaatgaatatttcagaccaaaaattttgaatctagCTAGGT CAGCTAGGTATGTTTTTGTGAACAGAGTTGAGATTTCAAATTAGGATTGT TACCGAGTATTTCAGAAGAGATAGCGTTAACTCGATGTATGGTTTTAGAC CTTCCGTTTAGATTCGCCAAAGGTAGATTAAGGTAACACAGTAATCGGTA GGTGGTTGGGCGGGACTTTGGACTGACCTGGGAGACAAATTTTCGAGATT AGTTCTTTTGCTTTTGCTAAAGGATGTATAAAGGATAGCAGAGATCAGTG ATCAGCGATCAGAGGTGCCTTTTGGCGCCATTTTTGCTTTTTGTGCCCCC AAAAGTCGTCCGATTGGGGGAGGGGGGTTTCAATTTCcttaatttttttg ctctaCTTTTTGAGTATCTACATAACAATGCAAAATGAAACTttgacctt tctcaagcaaaaaaaagtgaaaccttgaGATTTgagttttggatgggaaa taattgATGGCTTCATTTTCCATCCAGGAGTTTCGAGTCTAAAAGCGACT TTCCTTTGATGCactaaaaattcaatttaaaacTTTATAAGTACAAAGAG AGGCTGTTCAATAAGAGTGatgtcgtttgcttactcatcaattttaatta acaaactttttcacattggattgacacggatgtggagcaagattgcttaa aaagaggattatatcagcataatataacaataagcagacactgtcctgat atgaagtTTGTCTGATATGAAAGTGATAGGACGCCTGTTGGTACCgtcta ttttacagaccagcccAAAGGATACTGTATCTAGTGATTGGAAAATgcta ttaatttgaaattttggcaagTGTTAGTTTATGATATTACAAGCTTGCAG CCAAAATTTCAGCATAATCGGATGAAGTGAGCATCTTAGGTAAAAAGCGG CCGCTGGCCAGAGTCCCtgttttaggctctgaagatatctgacagggtca taAATTTACTAATTTCCAAAATGTTTATCTGgcagggtcgacttttggta atttttgacaattttcagggtggaaagtagaaaattttttaattttgtgt ctacttttagtcattttggccgcttttcagggtgaaaatgggaacaCTTT ACGATTTTTCGTTCCGAAAGGGTCTCAAATTTACCAGATAATCTTATCTG ACAggttccatttttcaaactctagtggcacgtccccgtcgaCCGTTAAG GTTAGTGCCCCCGGCGGGTTTTGCCTCTGGAATCTCCTGCAGGTTTTGAG TAAATCGGTTTTAAGTTATTCGATAGAATTTATTCGGTGTCTCGTTACAT CATTCGTCTTATTTGATACTAACGGATTCAGTGGGGAAAATTGATAGAGA AAATGTAATTCCTTTTTGAGACGAGAAAACATCAGTTTTGGATGTCAGCA TTTTGTTCGAAATTTTCTCATAAAAATAACAACCTAACAGTTGGGTAGCC CTGACTTACCTTAAgggtacaaattttcgcggggattatatttcgcgaat tttcgcgaattcgcctttttcgcgaaatataatccctcgcgaaaattttc aaactctcaTCTCTCgctaaattcgcgaaatttaatcctcgcgaaaatta agttttttacgctaaaaattctttcagctaagaaattttcttgaatgagt ctccattactcgaatgtctctataattcgaataaatCTTCATCCCTCGTA gccgttcgagttatggagactctactgtacacACAAAATCTCGTAATCAA ACTAacggaaaatctgaaaatctgaaaaaatttgcaaattcgcgaaatta aatcctctCAATTCAGCATTGCGGACGAAGTAAAactcagaataaaaaca tactggtttaaaatatttcgctctctcttagagcatcttcagtttttttg aataacaaagacgtttaaggacatgttttttttNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAATTT TCACATCgacctcttttttttggaaaaaaccggaggaaaatgggatcaaa ttgatcatttttgaaatctaggtgctaattctaatcgtatatattttctt gacaagtctatctatcggggaagtgatttgagatttttgtttagttgaaA GAAAGGAACGAACTAAAGGAAACGGGAATtgttaaaatgaatgaaaaatg attaaaaaagtcgtgatgattgttttgatcataactcactccggccttta aaaaaattactcctcaggctattttatgattttaggctTCCTCAGAAATG CATAGAAACCTCCTCAGGACCGAATAATGAGTCATGGAGTGAGATATGAT CCAAAACACTCCATAattaattaatcctgaaatactccgaattttgaaat ttcaaatagctcattttaaagcccttccgaaatttcaatacatatcaaaa ttttgggaaaattcatcATGCGACTGACGAAATAATTAACAGCCctttcg attgacttccaaatttgccatacttaccaactttgccaaatccacaattt caatgtcaaaagatcacagcttcatggcaaatttgtacatcgcttactcc gccattatgatttccgttttgtgatgcttagtcagcagttttctgtcggc gtttgtaaagcgaacgattttttaaccaatcaaattgccgatcGGCATTG TNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNtc gtgggaacagtgttttgtatggagacgtatggaggtaagttccaaatttg ccaagaatgccagattcaccacttcttttttatttggcatttatggcact tatttgccaactttgccaaatttttgtcaatcgaatgcaaaataattggc aaacagggcaaaattggcatattttgaagtcaatcgaattggctgtaaga taaagtgattttcacgattttcgaaaacctgattttggtacagtcaaaaa aaaacatgtccttaacAATTATATTTAACGACGCTAGAACGGCATTACAA TGACTTCTTCAGTTTTTGACGTCACGGAACATCTGGTACACTTCTTTCGC GTATCCGTGGCattaaatcctcgcgaaaatttacAGTCGAAgttagaaaa acaataaaaccaATTTAGTAAACATCGGCACTGCATCGCAGAGTGTGATA Aatgattaattgctctctacaggatgcaattaacgattaattgctctctt tgagagcgcgccaaataagaaaaaataacccatcgtgcgattacatatac taattatCCATTTGAATAAATAAAGCTTAATGAGGATATCAAATTCTAAT TACTAACAAGCCAGATTAATAATGTAGCCCCAAAACTAAAAATCTTTTGT ATGGAATCTCGTATTAACCTTTAATGGTGGAAATGTTTTGTCATTTCCCC GGTATTAAAAACTTAATAATAGAATAATTAAAATGAACAATAGAGTATAA TGGATGAGGGTCTCAAGCGCTTAAAagacaaatcaaaaaaaaaattattc attggataagaaaagttatttattttatttgaattaCTGAAATACACATG AAATGCAAAGATTACAAATTTGCCAATAACGAGTAGCAAAGaaattttta tgatttgaaaaaattctaaatttatacagggtgtccctaattaaagtatc gagtttgaacatgcgattgagtagaaaagtttgtgtgtgttatcgctaaa atattaggctgcatgcatccccaaattagttttgatataggggatgcgaa tcgggctctgatatcgcttccgagaaaattaccgaatagctatgtatttt gcagaattttggcgacttgtatttttcaaaaaactcgatgtgtattgttt tagttatttgatgacgtaaatagaaatcaaataaagattcaaataaaaag aacatatggctagaaatctgggagtttctaaacatcgaccagaaatggcg accNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNaaagtt tacaggcatcacacttaattgccctgtcaatatttttgtcaaaaagtgtc actttgtctagaaaatgactggtaacgtcaaaggtcacttttagGGCAAG CTTGCAATGTATGAGATGCTGAAATCGTCGGATTTTTCAGTCGGAAAATG AAACCGTCGGATATTTTAGTCATGTATTATTTTAGTTGAGATTATTCTTA GAGCTAATATAATAGTctctagttctatagttctatatagttctatagtt ctatagttctgtagttctatagttctttggtttcttagttctatagttct gtagttctgtagttctatagttctgtagttctacagttctttggtttctt agttctatagttctgtagttctgtagttctatagttctctggtttcttag ttctatagttctctggtttcttagttctatagttctctggtttcttagtt ctgtagttctgtagttctatagttctgtagttctatagttctttggtttc ttagttctatagttctgtagttctatagttctttggtttcttagttctgt agttctgtagttctatagttctatagttATCTGGTTtcttagttctatag ttctctagttctatagttctctggTTTCTTAGTTCTGTAGTTCTGTAGTT CTATAGCTCTCTGGTTTCTTAGTTCTGTAGTTctgtagttctatagttct ctggTTTCTtagttcactggttcatggttctctggttcatggttcactgg ttctttggttcgtggttctccggttctttggttcgtggttctttggttca ctggttctttggttcactggttcatggttctctggttcatggttcactgg ttcactggttcactggttctttggttcgtggttctttggttcactggttc atggttctctggttcatggttcactggttctttggttcgtggttctccgg ttctttggttcgtggttctttggttcactggttctttggttcactggttc atggttctctggttcatggttcactggttcactggttcactggttctttg gttcgtggttctttggttcactggttcatggttctctggttcatggttca ctggttctttggttcgtggttctccggttctttggttcgtggttctttgg ttcactggttctttggttcactggttcatggttctctggttcatggttca ctggttcactggttcactggttctttggttcgtggttctttggttcactg gttctttggttcactggttcatggttctctggttctttggttctttggtt cgtggttcgttggttcactggttcgtggttctttggttcactggttcttt ggttcactggttcatggttctctggttctttggttcgtggttctttggtt ctttggttcgtggttctttggttcactggttcatggttcactggttcact ggttcgtggttctttggttcactggttcatggttctctggttcgtggttc tttggttctctggttcatggttctctggttcactggttctttggttcgtg gttctttggttcgtggtgctttggttcactggttcgtggttctttggttc actggttctttggttcactggttcatggttctctggttctttggttcgtg gttctttggttctttggttcgtggttctttggttcactggttcatggttc actggttcactggttcgtggttctttggttctttggttcgtggttctttg gttcactggttctttggttcactggttcatggttctctggttcactggtt ctctggttcatggttcattggttcactggttcactggttcatcggttttt tggttcactggttctttatAGGAAACTAACTTTTGCGAAAAAATATTACT TacgaaaatggaaaaaaagtgaTGGGTCATCGAAATTATTTCTTGCCAGG ATTAATATTTATGGtctttaaaatcgaaatttccccTTTCTTAATCgaaa ctaccttaagggaagaaatttttcgcggaatttaatttcgcgaatttggg cgtaattcgcgaaattaaatttCGTGAAAAACACCAAAATGGCTAAACCG CAAAATCAAATTCCGCGAAACACGAATATTCTCACAATTAAAAAAATCAC TCCTAAAATTGGTCTTTTTAGGGCAAAATAGGGCTTTTCGTAGACAAATA ATTCCCTCAACCACGAAATTGAATTCTGTGAAACTTTTGAAATCGGCTCA CTCGCGAAATTAAATTCCGTGAAATTTGCCATTTTGAAACTCTGATTCGC GAAATTAAATTCAGCGAAAATTTCTTCTTGTGAAAATTTCTTCCCTTAAG GCATAAGTTTTAGGCTGTCATTCGCCAAATTATGTTCTCACCAAAATTGA AAGAAAAAATCGATGACTCGCCAAAATAACTTTACTCCAAAGTGAAAATC GCCTCCAAGGTATTtgcttttgatttattttgtcAATTTATTTAAACGGA AATAATTTTTGCGAATTGAGATTTACGCCTTTCCCAAAAATAGAAAGAGA GGTCTTCGGCAAAAATCGTTATAATCACTTAAATTGGACCACGACAATTT TTTGCACATGATTGTATTTTCAATTCTACTTTCCTGACTAACTATAGAAA TTTTCTCTGTTTGTGTAAGCTTGATAATAATATTTAATTAAGAGTTGTCG ctaccttttctttttcaatattgACTATaatattaaagaaattgtacGTA AAGATCAAATATTACAATAAATACAACTGATACAAATCatatcattttca atttaaagaactagaaaagggaatttccttataATCGTATNTtctcacaa ttaaaaaaatcactcctaaaattggtctttttagggcaaaatagggcTTT TCGTAGACAAATAATTCCCTCAACCACGAAATTGAATTctgtgaaacttt tgaaatcggctcactcgcgaaattaaattccgtgaaatttgccattttga aactctgattcgcgaaattaaattcagcgaaaatttcttcttgtgaaaat ttcttcccttaaggcatAAGTTTTaggctgtcattcgccaaattatgttc tcaccaaaattgaaagaaaaaatcgatGACTCGCCAAAATAACTTTACTC CAAAGTGAAAATCGCCTCCAAGGTATTtgcttttgatttattttgtcAAT TTATTTAAACGGAAATAATTTTTGCGAATTGAGATTTACGCCTTTCCCAA AAATAGAAAGAGAGGTCTTCGGCAAAAATCGTTATAATCACTTAAATTGG ACCACGACAATTTTTTGCACATGATTGTATTTTCAATTCTACTTTCCTGA CTAACTATAGAAATTTTCTCTGTTTGTGTAAGCTTGATAATAATATTTAA TTAAGAGTTGTCGctaccttttctttttcaatattgACTATaatattaaa gaaattgtacGTAAAGATCAAATATTACAATAAATACAACTGATACAAAT CatatcattttcaatttaaagaACTAggaaagggaatttccttataatcg tattaatttttgcgggatgAAATCTTGcgatataaatttttgcgataCTT ATTTTTCCGAATTTGGCCACCTTTCACAAAAATCATTCCcgccaaaactt ttaaaaacaaaagttcatttatcataaatttattttattttttttttgaa aactggCTTTCGCAAAATATAGTTTCGCAAAATTATTGCAATTTTTCCAG ATCACCTTCCTTCCAGATCAttgcaaaatacaattttttggcCTTTATTT GCAAAGAATTtatcccgcaaaaattaatacGAGTAAGGTAAATTGGTAAC TAAAGACAACCTAGCACAAGTACGTTTTTGTGTCTAATAGTAGGGGGGTC TAATAATAAGTGGAGGAGTGatgttctgaaaaaaaaaacccacaAAATAG GGGGGGGGTCACAACAAAATGATATTGAAgtgattttactgattttccct aggaaggaaaatgaaggtttatggcctttttggaaaaaagtcataaaatg ggggAGTCGTAATAAAGTGATTTTTGGGGGTGAAAAATCAGATAAATAGC AAAGTGACACCCAAAAAAGGAACAGAAAGAgcttttgatctcaaattttc agGAATGATTTGGTATGACAAAAGCTTCAAATATTTCAAGTTCTTGTTTC AAACTAATGaggtcaaaaaaaaaacataatctCGGCAAAGGTCTAATAGG TACAAAAGAGtacaaaaataatatcaaatatgGCTACTgttataaaatga aaacaaatataGTTGACAAATTCAAATGAATATACTTTCACTATTTTTGT TAGAGTATCTTTCTGATCTCGgaaaaaagcaaaagtcaaatcTATCCCGC CGCTGTTacagaaaaaatttatcttaGAAAAAAAAGTACTCAGGAGTAAA TCTTTTCCAGGGAATTAGGTACTCCGGGAATAACTTTTTTCCGGGGAGTA CTTATATTCTGTTATACCGGTCAAAAATGTCTCGATATTTCACTATGTTC ATAGAACACAAACAATTTAAAGTATTTATCTGATTCAATTAAAAATGAGA AGTCAGTGACCTATCGGACCTTATCTCAATCCCGNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTTttct aacctccacgagtcccaggtagggtcgcaaaaacactNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNagggt cacttttttcgcaaatttcgagtcccacgtagggtccatttttcgaacct cagcggagcacccccgtcggtcgacaagggtagtacccccccggatCTCA ATGCAAAGTGTTCGTAAGCCTCTTATGAATAATAAATGAATATCAAGGTT TTAAAGAATATAAACGAACGTGTAGTCTTTATGCACTTACTCGTCTAAGA CAACACCTTCTCTTGCCAAGTTATCCGAAAATGGATGAAACAACATTATT TTCTCATGTTGGATTTGAGAAATTTTCGAGTCTTTCTCTCGAAATAAGCC AGTGTAACGTTCCTCGTTCAAGGAGTATTCATTCAATGACGCATCCATTA ACCTTGACGGTAAAGTTTTGAAAAACACTGTCAATCTTTGGATTTTAACG ATCGTACCAAGTCCCTTATCTTTCAAAACTTGCATTGCAGATTCAACTGC TTTAGCTAGCGGAcggttttttgaagaaaagctGGTGGCGCAACGGCGAG CAGTGACATACGTTCCAGGTAGTTTTATCAATCGTTCTTGCACGGTGACA TTTTCGATTCCCATTTTGACGACCTCTccgtttttcactttttcacactG AAAAAAAGTTCGGAAAAAATGTTTGGCATAAATAcctatatttgtatttt ttcgatAAGGATCAGGATaaagatttgaaataaaattgcaCATAGTATAG TCCTCCATAGTTTAACCCTTTCAACGCGCAGTCTTTTTTGAAAGCTTGAA ttttctcttcattttttctttttaaatttaaaacttcaaaatggcctaaa agcttgtagcttgagagttagacaatgattttggtaccattgaaaagtta tttttatatactctttttaaaaaggctCAGTTTATGTctctttaaatcaa gtggtcacgagttatgaccaaaagtcGGGGGTAAGGTATTTTGACCTGTT TTGGATGCATATATGCGTGTTTCGGAGTTACAGGGTTAATGACGACAAAA AAGATAATACTTTATACGGGGTGATTCTGTCAATTTCGGTTCACTGGGGC CTgggaaattgcccaaaaaaccCCAAAATCTGCAATTTttgccgatgacg tcatcactcgTACATGAAGTTTTACTTTCTTAAATCAGGGTTTTGtactg aaaaatgacgtcatgggaaattggcccaaaaagggTCAAAAACCTATCCA ATTGATTGCGCTTTTTTTCTGGTGTATCTATAATGACCCCTAAGGAGCCT CtacaaaatttcagcctcatactatttttttcaaggtaAAACCCTAATCC CACATATTACTAGCACAGCAATTTCTCCCTAACTATTTTGTTTTGCGACC TCTGCTTAGGCAATTCTAAAAGTAGAAAGGCCTAAGTTTCTAAGGCcatc aaaattgataaaattccATGCCGATAAAGTAGAGTAATCCACCCACAAAA AGTGTTTGCATTTTACCCGACAATGTTCGCTATTTGCCGACAATACCGAT ATTTTTTATTGCGCTTTACCGATCGACTCGAAAAGcgaaaattgaaatga attgtacaaaaatattttaaaagggTTAATTTAGTtgactgaaaattatt tttcactgaaatagatTGTACGCAGAGAAATTAGCCAAAATGTAATTGTC CGCAATTCGACGACATGACTTTATGCGTAAACTTTTTTTCGGGTCACCCa atgaataaattttgatatttttcacgAAACCTTTTAATTTTATCCTAACT AAagcataaaaattcaaaacaaaatttatataGCTATTACTAAAAGGCCT TTGTATCAGCAAGCAACAAGTAGTCAATATTTTggctaaaaagaaaacaa aaagaccGTATCATAGATGTCGACCTACTTCCTGTCTATTAAAGTTTGTA TCAAGACCACTAATGCttgtttgactttttttataaatttcacaTACCAT TTGCATGATTCCGGAACACCCAACAAAGTAATCAATTAAAGCAATTGCCA TGGAAAACGTTTCCCCACTGATCATCGACGGCGTTCTTCTTCTGACCTGT TCACCTGTAAGTTCATCGCCGATTGAATGCCAAGTCACATGCAAAACAAG CGCCAAGCGTAATaagttttttgaagattttggttCTTGGTCGGTTTCTG TGTTTTTTGAGTAAGTCTTGAAGGCATCCTTGGCTGCTGGCGAAAGCTCG TATATCCTGCTGTTATCATGATGCTCGTTAAATATTCTCTCGTATATCTC ATTTAGATTTTTAACGGGTGACTGTTGTAAAGAAGCATAATTCTCTTCAA CAACGTCGAATGAAACAGGCTCGCGGGCCTTATACATTACAAGGAACCTG TCACTTAAACCATTCTTGTATTCGACTATCTTTGGCCATACTTCATTTAA AAATCGTTTAGGTGTAGTGAATGCAGCCAGAGCGATGCGAGCTGACGAAA CACCATGTCTTTTCGCCTTTCCTGTACCGGACACCTTGAACCAACGTTCC CCGTCATACAACTTACAAAGCCTTTCCATTGTGATGTTGGTTTGGCTTGA GCCTTTTGAATTGTTCGCAATTGTTGAAAAGAAAGTAAATGCCTCATCTA TGCATAGAATCGGAATTTCATCTTGCTTTAAGGAGGCAATAAGGTTAAAT AGACCAGCCGAGCTGGCCTCATCCAACACCAAAGTCTTATCTAAATTCTT TTCTAGATGGTCAATCACTGGGTTGATACAGCCAATATTACAGGCGGGTG TCTTTCCTGAAcctaaaaacaaattatatacaAGAAAAGATTACTCAACT AAACGGAATATTTTGTACCACAAAAAGCGCTTTTAGACCACGTCGAAGAA ATACGATGGAGTGACTTTTAATTGATTTGTATTATCTTTTTTTACAAGGA TTGCACTCCTTTGAATTTTCTCGACGTGGTTGCTCTATTGTCTTGGATCT GACTGTTGATGATGTAATGTTATGATAGTTGTTACAAGTATAGTTatagg gtgctttttcactacgctagatagataagtggttctcatcaacggtcctt ttcataaatttctaaaggttgtaaaaaatatacaatgaagattcgtgctt aacatcagattttgatcgcttcatatcagcattccagatttaatgtcgaa aattggtcattaaaccttttgttctccaagagagggataaacctctcttg gcttaatgaccaattaagcgaaaaaggcagcataaataaattgattgcca taaaagtagcagaatgtgcagtgggattcttttgtaaaaaattagtcgta tgggaaaagtgttttctttcccgatagagttgaagagcaaactttcatct gtattgatttgatacaaaagacgagggatcttgtcacagaaaatgttcat tagaaggttgtaattctaaatcccttgatatgcgagttgataatttttaa taaaattttcttcaaattcaaagggttgtaaacgctttgacaactgtttt gggagtcagtaatgctttcctatcaattttctttgtttcagctaatcgat tttcgccagacagtctcagtgaaaaaccacccaTAGTTGCTAGCAGCTGA AGTGTAACTTGTAGTCGGAAACAGTCACTTTAAATCATTGAATGTTATGA GTATACAATAACCACGTTATGAACTTCACAAAGAATTCGAAAGTCTCATC GATTTATGCTTTTTTCCATGGGGAATCAAATCATTcgcttcaattttttc tttcacttttcagAAAATAGTTGATTCTTTTAGTAAAATTTTGTCACggc atttttgaagacttttttcatgaaaagttTCGACGAAAAGGTGCCATAAA CAAACATTTTGAAGATGAGGTTTACCAGGAAGGAAAATTTATCTATGAAA ACTTGATAATTTTCCATCTAGGAAAAATCATAATAGggttttctaaaata tttttctaaggCAAAAATTACTAGGTagtaaaaatagaaattcaTTAACT AGAGATATGTGTTTCTTTTTGCCGAGTGGGAGGTTTGTAAGCCAGGTTTC CATTCACACCGAGTGGATGGGTTTTAGAGATCACGCGGACACTGTTTGAT TTCCATTCCCCGAGAGATCGATTAATAATTTAATTGACCAATCAAACTCG TTATAGATCTGAAAAAATTATGACTTAATCTTTCCATTTTCAACATGCAA TTCACGAGTTCAAAATGGTAGAGCTatactttgatttcatttttagattt tgtttCGTTTGCTATGAACATTTTGTTGTGTTAGTTGTGTTAGAGCCCGT ATATGCGTACATAATATATCCGCAAGAGATGGATTGACTAACCTGGAGGC GCAATAGTGATGAAAAACAAGTTCCCTCTTTCCTTCCACGACCCAAGCAC ATTCAAACAGGAATCACCAAGCAAGGAGCCAACAGTTGCCAAAAGATTTG TTAATAGTAGATCTTTATTTGTCCCATTACTTTTTGCGAGGATATCCAAC CAATTTTTAACATTTGTGGGTGATATCTTGTCCCATAGAATAGCGGTTTC AGCAAGTTTTTCTTCTAGTTCGTCAACGTTGTGTATTTCTACTTGTgaca tttctttctttttcttctaaatgaaaaatttctttatattAATATGTATG TATCATCTCAGTGAGAGAAATTTGGGCAGGTGTACATGACATTGATAAGG GTAGTTATGTCAGTCTATTGAATTAAATGTAATTTATACCATTTTTtgag ggagtttctaaacatcgaccagaaatggcgaccacgaccagcgaccacga ccggcgaccagataaattttggttatcgagtttacctgctcNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNgacaaaaatattgacagggcaattaagtgtgatgcc tgtaaactttattacaccaaatattttaattgtaccgaatgagatgcctt tagtatgaatagatataaattgtcagtaggaaaaagctgggaaggccact tttagagatttcaatctcatcaattattctattgtccttagattgtcaaa atgacttattttgacaaaataatgatctgatgatcaaatataaagcttcc taaATAAATTCCAGCAAAATTTTGTCAGTAATTAGtttgatgccgaaaat acaaaaggatagaaattgacactctattcaagctccaagagcgttgaaat ggctgctctacacgttttgcacgtggctttataatcACTGTAGGTGAAAC AAGGGTGAGCTTTGctcttcaattcgataaataaatgatcataagagaaa gactctacggtggagaaagagaaaaactcgataacccaactttatctggt cgccggtcgtggtcgctggtcgtggtcaccatttctggtcgatgtttaga aactccccttTTTTGACGTGATTTtgcatttttcgaaaaataactTTGCA AGCTTACAGTATAACTTTTCAACTTATAGGCCAAAATTAAATAGTTATGT TATACCTCAAAATTTAGTTAGATTATTTATTCTCTTTCATAGAAAAATGA ATTTGGtttcaatcaagatttttacGACCCTAAAGAGTCGCCTACCGTGC GAGTTTTCATTCTACTTATACCGGGTGtcccacaaaaaagtttcagtGTT TAGCGgcctcaatttttttttaaaagaataaaactTGGCAAATACACAAC tcattttaaaaagttatactTCAGAATTTATTAAGCTCTTTTTTCtaatg aaataatgaaaataattctTAGAACACCATCTGTTCAGCTCCAAGAGGCC GCCAAACACTGAGACGTATTAGGGACACCCGGTACATTAAGATTTATAGT AAAAACTGAAATCTAAAGAACACTGCGTTTCGAGAAAAGTTGTCAAAATT CACACAAATTAGTCCCATTAATTCATCGTAAACAAAGGTGAGCAAAACCC TGCTAAAAACCCACAAATTTAACTCTTTAATTTTATTTGATGTTATATAC TGGAATATCTACTGTTGCATAGAGTACCATAcataataaatcaaaatata gtttgtaaaattttattttaaaaaagcaacaaaaattttttttaaaaaaa gttttctgaaAACCCAAGATGCAGATATAACTCTTAggtatgttttaaaa ataaactaaaactttcaagtttttatcCCCTGAATTTGACCCTTTCAGAC AAATTTGGGTCATAAATTTAATACTAACTCTCAtgaattaaatttcgcaa aaattccTTCCCATCGAAATTATTTTAAGGTATCTTTTCCTTCATTCCTT CACTTGTCAAGGATGGAGCCTTGATAGCTTCAAATCAGCTCAGGGAGCAT TCATACTGCATATTTGGCCTGAAAACtatctgttttttttcaaaatatag atAAAAGGGACGAATTTTGGGCTTATATTTCCAGAGTGGTAGGGGTCACA TCGGGTCTGTGAGCCAGGGGTGCTACtagtatatataatataatatttgt ACAACTCGCATATTtgctaatgaaaatttctacaAAGTTAAGTTTGAAAA CCACGTATGAGAATCTTTTACAGAAGCAATTTTTGCTGTGATttcttttg acaattttttgtcGATTTGAAATCCATTGATCATAAAAAGTGTTGCATGT TCATTGAACTTTGCTGTAATATCATCAGGGACATTTTCAAAATCGTCGTT CAGCAGATACATCAGTAATAAGTACTCAACATCTGACCAAGTACCCTTTG AAGACTTCTCTCCGACAGATGTCATGTATTCTTCTGATGTTTGACGAGCA GTTGAAAGTTGTGGTTTCGATCTGTTCCTTTGATGTGGTTCTTTTCTATT GCTTTCTTGCTTTCCATTCTTACAATTTCGACAAACACAGGATTCGGTAC ACACCAAATTGGCCTTCAGACAAGGGCATCTGGATTGATAACTAAATGTG TTACAGCAAAACGATTGGTCCTTGTTCTTTGATGATCTACCACAGCTACa ttgaaacttttgttttttcgcCAATGGTGCTTCCACTGATTCTGATTCGA TCTCCAAAACAGGACTAAACTTTTCTTCTCGTGAAAAATTTAAGTAGATC CAAAACGTTGAGAAAATTGACCCACTCGGGAAAATTGATAAAACTGGAAT TTCTGTAGATTCGGTGAAAATAATCAAAGTGATGCCTAAGAAATTAGAAG CAAACTGAATGTTCCCATTACAGCAAGAGCAGATTTTATGAATGTTCAAT AGTAGGTCAGTTGAAAACCCTTTTGCTTTTAAGGAAGCTGTTAAACTGTT GGATCCTTCTGACATTTTTTCCGAAATTTGAAATCCTAATGCAGCACAAA GCGAATGGAGATGGCCGTTAGATTGTACACCGACAACGGTGAAGCCATAT TTTGCAGCATTATTGACAGTACCGGAacactttttcaaatgtttcagAGG ATCTTTCATAGCCACTAGCTGAATTGACAGTTTCCAGTCGAACTTTGACT TCAACATCCTATAAGTATATACTTGGTGGGCCACGGGGTGTTCAAAGgat ctacttcttgtttttgtcCACTTCCCTGTGTGATTATCCTCTTTGGATTG AATCTGTTGTTGTTCTACGCCACCCAATCCAAACCTCTCGATTGGGCTCT CTTGATCATTGTTTTCAACGCCTTTCTTCTCGTTCCATTTGTTGAAAAAC ACTGTAAACAGTGCAGTAGCAAGTTCTGGACCCATGGCTTGCCCTTTTAC AAATTTGTTCAAGTATCTACAAATGGAAATTATTTATCGGATATATTTAA CTATTTTCTGTAACTGAAATATCGAAAAAGCGTTATTAaaaggattaaat tttgcggaattgAGTTTCGCGATTTATATCTTTTTGCCGTTTTCGCGAAT GTTTTTCTCGCAAAATTGCGTGCGGTCGTcaatttgcaaaattaaatcca tcaagcgaaattttttaaaagaccATATTagtaaaaaatgaagttttatt GAATTTGGTTCCGTAATCAAAACATCCCCTTTTCAGGTTCAAAACTCGCG GAATTTCATCTCTTTAAATTTATCATCAGTAATCTTCCATCTACCATAAG TTACCTGAACTCACCTATGTAAGTTTTCATTTGCACCGGTAGAGCAGCCT GCAGGAATATCAGAAAGACAACCTTTGTTGATATGACGTCTGAGGTTGCA AATTGCCTCTCGTGTCTCAACCGTGATGAGTGATCTGCCTGGCACAAGAT GTTCCATACGCTCCCATTTTGCCAAAATTGTCTCTAATCTTTTAATGATA ATTTCCGGCTTTTCTGTTGCTTTTTTCCGAGATTTTCCACTGTCATCATC TTGGCGCAAAAGTTGTCTTAAATCGGCACACATGTTTTCGTAAAAAGGAT GATTTTTCCTAATGGTGCGAATGATGCGATTGATCCCGTGAAACGGATCC AATTTGATCAAAATCTCCCCAAAGATTTCTTCGATCTTGCATTCCCATTT ACAACAGTTGTCAATTATCATCATGTAGACGTCTGTTCCAGCTCGATTTT TAATACGTATCAAAAGATCCCGAACAAAGTCAAATTGTTCACGCCTAGTG AAGTGCCAAGATACGATTTGCTTCTTTTCATTCATTATAATGAAAACAGA ATTGTATTGCTTCACCCATCTCTTCACATCACCTTTTTCATAAATTCCAA CATTTGCTGTTaccttaaattttcaaaaaatgataatatAATAAGTACCT ACCAAAAGACCTTACGACGTGTgaccaaagatttattatacactggataa acgactcataaaactatggagagcgatcattgtactTTCATtatttcaga aaacaattgatgttctagctttgtctgCAAAGGAccactgtcatggcggc tcgaagatgtctgatttttgaaaatatttatcagTCTTgttattaaaaag ttctctagctctttctttttgtacatttgcagaaaaaaaagtttgaaagt aaggctagcattccaagctggatacatttgtgaaatttaatgtgagaaaa acatcattagacaagaaattcagagaaaatgcttatagtgacacgaaatt ttcaattggaaatatctttccaagactgtccctagaagagctgaaattag catacataagacttgagtgtcttggctccattGTGGtgtgaaaatccttt ggaggcacgtggtagCAAGGTGGTTTTTCTgaggttaaagtttgaaaatt tccggtgtcaacattaaatttcttatacacaacacgtcttttgcatcttt ctcacggcttgaaacgtcataaagacttataattagcaattaagtggaat AATctaactctcacaggaaagttttaattctctattgggaattggatgag tgattttcgataagaaatgcaataaaaatgNaagttttaagtctcttttg ggaattggatgagtgattttcgataagaaatgcaataaaaatgcttcgaa aaatcatttaatgagggaaggagagtgagcaataatatcattactgcgga cataagtagtacacgagaaatcggcaaaaatctgttacttgtatatccag tgtataataaatccttggtgtGACTGCGTCTTAGAACCGAACAACCTATG TAAACTCAAAACTTTTCGTGAATTCCGCTAGTTAATTATTCCAAAGAGTC ATCAAGTTTACTATAACATTTTCctgttaaccctttgagtgccaaaAGCC GACATGGGGTATGCCCTGCTGCCAGCCCTATTTACGACTTGAAGTCTTCA TTTTTAGCAAAGATAAGTCTAAGTAAGGCAAGGTCGAAGGTATTACtttt tttccccaatttttttgCGTGCAGAAGAGATAAATATATCGATGAAAGTt tcgttaaaaaattatttatttataaaattatagTTCCTAGGTTTAAAAGA AGTAATAATTTAGGTGGAGACAAGAAATTTTTGGTTAAACCGGCTAGGTT AAACCCTAAAAGTAAAAAGAACATAAAACAACCTTTTACGCTCTCTTTTG CTTTGAATTCTTTGAAATAAACATCTCCTTTTTCGAAGCTTCGAATCAGT GACGTAGTAGACCCAGTCCAGCTGCAAAAAGTGCGGTTGATTAAAAAACA CTCTTAAAGCCACTCTTTGACTTGAATTTTAGAGAAGAGGGATACATTAg acgaaaaaatatttatattagtgtgtttttttaaatcagtttttggaaag gattatcataaaaaataaatttccgaAGCCCCCCTTTAAAACAACACTTA AAAGTGGCcttggcactcaaagggtttaAGTATAACAATAATTGTTTACT AACTTTAAAAGTATGATCTGCAGTAAGTATCCTAGCTGATAACCGCGACA TGGTTTCTGTGTAATGTTTTTCATTTACTTTAAACCAAGCTTTAAACATA TCTTCTAGAAGGTTAACTTTTGGAAACATTTTCAAGATTACTTCTTCGAT TTCAGCAAGTTTGTCAAGGTCTGCTGTTGCACTGTGAAAATCTAAATCTT GACAATATCTTTGTCGACATTGCTTATATTTGGTTTTTGTCCTTTCTGCA AGTATCTCTTGAATTTGATGGAATGTCAATCCTTTTCCAACGTAACTAAT CAAGGATTCTAAAAACTGTGTTCTGGCAGCTGATTTGTGCAAAAACATCA CATCAGATGCATTGTTTTTACATTGCTTCAGAAGCTCTGAGTTTGTTGTT CTTAAATAATGATTGCCTTTTTTGCACCTGTATATACGACCGATAAGCAA CATTGGCCCAGTGATGTCTTGCAAAACTCTTGGGTGTCTTGAATTATCAG AGTCAGAATCGAACCACTTGTCCGTTTCTGTGAGTGGCGCAATGTGATAT GGACAAACAATCGGATCATTTTCTTCAATTGATGATATTGGATCCCAAAC AATAATAGTTGGAGTAAAGTATGAGAAAACATCTTCCACTGTAGGTCTAA TCAATTCAAGTGGATTTAATGTTAGTATAGAGGTTTTTAAAACACGTGAC GTATCAAcgcatttttttattgcatttatCCAGGACCTGGGGACGATCAT AATTATTTTTATCCtacatttcaaagaaaaaagaaaatattaatactaat aatattttaataagTACCTTAACTCCTTCCTTACCATTtgcacattttga aaaacaagttCAACATATTCGCAAGACCACTTCTCCATTTTGGCCGGTTA AAGTTAGGACCAGAAAGGGTTAATTTACTGATATTCAGAGGTGATATTTT CTATCGGttcgctaaagctctaaagacaCAAATCTTAGTAAACTAGACTC ACTTCTAGAGCTTATTCTGACTCAAAGAGACTAGGGCCCATTAATTTATT TTCAGATATGGAAAGGGGAAGGGTAATACCaccaaattcttcaaaaaaaa ctttgtaaaagtTAGGGCCGCAGACATTATAGACCGCGAAATTGGAAACA TTTCggactttaaaaaatttcaaaatggtggtAGAGGCCACACCCATTGT TGGcccatgaatttttttgtgtaaATGAAAGTAAGTtcagggcccggttg ttcaaaagtggattagcgGCCGATTAGCTTAATTTTCGATTAAATCTCGA TTAGCGCCGATTAGCACAGAACCGTCggttgttaaaaaaaattaggcttT TTTAAAATCTGGATTAAATCCCGATTAAATCGGCCTATTTTTAATCCTGC TCTGACCCAGGATTAacgtagcgagcacctcactaaaaaccgggattttt tatcGCGTTTctttaattgcgtaaaaaaacgcgggtgacgtctagtatag gctaggaTTAACGAGGATTAAGAAGCTTTTTCCTACAAAAAGAGTGAAGT CACTGCATTgaagcatagtataagaaagccgcggctggaatgatgacgct attgtttttgtcgtaaatggatgttctatctgtgtctcCGTGGNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNaattttcttcaagttcttaaagcactgacattctgacgttc tagtacttttaaaccaagagtcttttcttttactttgatgtTATGAATGC TTGAATTATAAAGAGATTTGCgtttatgagcaaaattacgTCTATCGAGG TagtttgttaaaagtcaaattaaattgacaatAGAAATTGTCACCgaacc ataaaaaaattcgttcttacgacatagatagaacaacagaaattcagttg tactcattccagccgcggctttcttatactatgattgaagtgagaaattc gaacgaaagaatattttcgaatgttttgaaaacgttcgaaaagtgacgtc aagattaagatttttgaaaacacaggcaaaatgtccacgattagttaatc tgacgttcgaacaacggaagttaatcgccgggattaactaatcgaaatct aatcgcgattagcgctaatcgggatttaatctaatcgacttttgaacaac cgggcccagTTGTTTATCAGAAAATCTTAACTGGTCCATGTAGAAGTGAG GCCCAAGTAAGACATTTGATCTCAAAAAGGGCAGAAATTTGGCGAAAACG TGGTTTCGGCCAATTATTTCTAGACACCGAGGAATATTCAGAgccttgtt ttttattttttgtgtagAGCTTATCCCATATTTTCAAGAAATGGAGAAAC GGGGACCTCTTTAAGCTCAAAATGGGCtaaaaatcatttcaaagaAGCTC TTTCAATTCGCAAACCCAAAAATAGCCGAAAAGATCGAAATTTCAATGGG CCATATCTCAGCAACCGGAACCTATGTTTTTGtgtcaaaaacatagaaat acaaggaaaaaaatctaatgaaaatctgcaaaaaacggcaatttccggca ttttaaactggaaaaaaaattctcaaaaatcgaactcagctaTGTTTtca gcattgcgaatacgcatctttctgcaaaagaatcagaaaaaactaaagat gacaattcgagaaaatgtaaaaaaaccggtttttccggcaaaaaatgttt ttcgaaaatcgggctccgtctcattttaggcattgtcatattgcatcagt gtgcaaaatttcataaaaaaaatataaagtacagcttgagaaattcaaga aatactgtctttccgtcgaaaataggttgttcgttccggcgatttttaaa tagttccggcttcaaaagtCAATTTTATTGAAAATGCTTGATGGTGGGCA TTgctattaataatgtttttgaatgaaaaaacaaccaattataaggaaaa agtccaatgaaaatccagaaaaacggcgatttccggcatatttccggcat tttaagcccgaaaaaaaaatttctgacattttgcatcattgtgcaaaatt tcacaaaaaaatataaagtacagctcgagaaattcaagtaATACCGTTTT tctggcgaaaatcggctgttccggcgatttttagtaAGTTCCGGCttgaa aaatcagttttattgacaattgaaccatgcttcatgataggcattgctat taatattgtttttgtgtgaaaaaactatgaaataaaaggaaaaagtcaga tgaaaatctgcaaaaacggcgatttccggcatatttccggtattttcggc cggacaagaatttttctcaaaaatcggactcgaccatgttttgggcattg ctaatacgcatctttgtgcaaaaaatcagaaaaactaatgatgaatatcg agaaatgccaaaaaaccagtttttccggcatatttccgccattttcggcc ggtataatttttttttcaaaagtcgggctccgtcacattttgggcattac cattttgcatctttgtgccaaaaatccgaaaaaactaataagccaatctc gagaaaagctggtaacagacggacaaaggttaatttataggacctccagg taggtccaaaaataataagaatcattaaaatcaatagaaaaataaaaaaa ataaaaaagatcaactaaaaaatcaaaaaacttaaaaaatcaaacaacaa atcaaaaaaatcaactaGAAGGTCAACAAAATCAAGtccaaatttgaata aaatctgaaaaataaaactccAACGGAGCTACAAAAACccagtgaaaata aaaataaatcacaagaaaaatctacaaaatcacaatagaaaaatctagaa aatctcaaaaaaaataaaataaatcagaaaaatcaactaaaaaataaaaa aaatcaagcaaTTGAGTAATCCGCATGCAGGCATGTTccgttcaatcaat ttttgacgacatttctggtcaaaaaattgaatttcgatggtaattttcaa ttttcaatacaaaaagtttatattagaaaatcaaagatgaaaatggaaat ttcagttcatttctggcagaaataaaaataaaattgaaactttcaatcaa aattcaattttcaatttttgagtcaaaaaattgaaaattgaattttgatt gaaagtttcaattttatttttatttctgccagaaatgaactgaaatttcc attttcatctttgattttctaatataaactttttgtattgaaaattgaaa ataatattttcaaatactgaaaTTTTGTCGTGAAgaattgaatttgacaa aaccaaaccaatttgtaaaaaaacgtCTCgggtgaaaaaattgaaagttg aaaacGATTTACAATCAGTTACAAAGAAGACgaaggaaacaatagtttta ttCAGTCTCTTCTTTGTTAGTCTAATTTTTCTCTTAATGTATCGATTACA CACGCGTTTACTTCATTAAGAGCTGAAATGGAAGTGGCGAGAGTAAATAT GCACATCCAGACTCAGCCGAATTAtgggtgttctaataaaaaaaaatcgg cTTTAAAGTCAGTacctttttaaaatctgaaatctgaggcccacattttt tttaatccgggggggggtactacccttgtcgaccgacgggggtgctccgc tgaggttcgaaatttgcgaaaaagtgaccctgaacgGGACtacaattcca aaattttctactttttccccaaactttccaaaaataggcaccctacgagg tactgatttttctattttggtgtttttgcggccctacctgggactcgtgg aggtttaaaaaaggtaccctaaccagcggagcatccccatAACTCacctt gccctagtacccccccccgggttcttaatatgttcttagNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAaaaattggtttggtt ttgtcaatttcaatttcttacgacacaattttcagtatttgaaaatatta ttttcaattttcaatgcaagaagtttatattcgaaaatcaaagatgatac tggaaatttcagttcttttctggcaataaacaaaacaaaaattgaaattt gcaatcaaaattcaattttcaatataactcgaaaattgaaaattgaatat tgccatggaaattcaattttttgaccaaaaatgtcgtcaaaGATTGAATG AACGAAACATGCACACACGAATCCGTGCACCGATCGTACCATTcgatttt ttaattgaaatcaaaattaattgaaaataaaaaaaacgccaattttttaa ttttcaaaaaattaataaatacaaaaattgtgtcaaatttttgatttcta aatcagtttgaaaatcaaaaaattggaaaaacaaaattggaaaatttaaa gcaatttttaatttttgaaatttatttcgtGATATTTGCGATTGGATGAT CAGTGTGTGACTTTTATGCCCGTCCCACTGGGAGGGATAGTTATTCATAG TTCCACCGAGGCAGTGAGACAGGGACGTCAGTAAAGTAAATGCTTTTTAC TTATCACAAATATCAcaaaatagaatttcaaaatttcaaaataactttaa atattaaaatttttgttttttcttatttgaaaatcaaaaaattgacataa tttttctatttttaatttttgaattaaatttgaaaattgaaaaataaatg attttttgaatattCAATCCCGGGGCCTATGTACAAAAATTCTCTTGTAA GAGAATCTTGTAAGCCGTACAGACCGTAGagcaagaagaagaaaaaacta aataagCTGTCTACCAACTACCAACAATCAATTTCTTCTTCCAAAACCAT CAAACTAAGAAAAATATCTTATAACGTTAGTATTTGCACCTTGTCCTCTC GCCATGATGGTCCGTCGATGTGTGTAACTAAAGTTTTCAAGTTTCTGCTC TATACTAAATGAAAGTTTAAATTTATCACAATAGGTGAAACCAAAGTCAT TCAATTTCCTGATTTCAGTCAGAGGCGCCGCAAGTCTCCACCCATAAAAC GAAAAGACGTTTCGTTTCTTTCGTCTAAAAAGTTCTTTGATAATTGGATC TCTTTTATTGACTACAATTTTAattgaataaagaaaaagaaaatagaaga GAGATGGAAATTTTCATAATCGAGTGTGCACGCTTTATAAGAACTATTTT ATATAAACGtatggctgaaatttggcaaaaccttagaaaaaatTCAGAAC AATCTGAGTCTCGGATTTAAGAGATTACAAAAACTACTGATTTTAAGTCT CTTTTAAGCTCTTAAGTTAAGAAACTAAAGTGTGCCAAAAAAAACCATTA TTTTTAAGCCtgcaaatttcgaaaaaatatgaACATCCGAAGTTAAGCCT AAATAtattggttcttttaaaaaaagcgtAAAGTGACACGGAATACATAA CTGACAGTTTCTTTTCCACAGTGCAAGAGAATGAGCCTGTCTGCTATCTC TAATATAGTCGCAATTAGAAACTTAATCGCATCGGGCTCAACTTCAGTTT TAAAATCATTCACTTAAACAAATtctaggcccaattgtaaaattaATAAC CAATTTCAACCAGATCGAACCATTTTTTATGAGTTCACTGATTAGGGGCA GAGAAGGCGACGAAgaagtgatttttaaaaatacaaaaagtttgAGTGAT CATAATGAGCCCTTAGGATAGACGAAATAGTTAGTTTCTAAGTCGTCTAG GGCTGACCGCTAACcagaaaaaaaacttgtaaatgataaaagattatttt ataattttattattttcggacAAAAAAGCAGTCAGAGTAGACTTCAGGAC TGATTCAAATTCGTCTGGATTGGGATAGTTTCGCTGTCAGACTAGATCGT TATCGCActataaattttagtttcaatacggcgtttgtgtaaaaattaCG CGCGGGCTTTCTGGATGGAAAACAGGTGgcttcgcctctagccctttatg cttgaaactcaatgagaTAGCAGACaaatattttctccattttcttttgt tcaccATTTTTTCGCGCGATTTTCTGTTCCGTTTTAGAGACTGTTGTCTC AAAAGCAATTTTTGCCATATGATACAAATTCccctttttcacaatttttt tcaggTGATCAAGTGATATACTTGTAACTTTCCAATCCTACTTTCttcca aagaacattttaagcctaatttgaggtttgtagcaccaacagaacagatt ttaggttttatttccaggcaaaaccccgTTTTTCCCCGATTTCGGTCAGT TTTGGCCTAAATCTGCCTAAATACCtaattctttgaattttatttaCATA GTAaaggtatataattgttacattccaatcctacttttttccaaggaata tttaagcctaatttgaggcttgtagcagcaacagaacagattttagattt tttaccGGGCAAAACCCCGTTTTTTCGTGGtttcggtcaattttggccTA AATACCTAATCATTTGAAGTCTATGTGGTAcaggtatataattgttacat tctaatcctacttttttccaaggaatattttaagctcAATTTGAGGGTGG TAGCACCAACAGAACAGGTTTTTTATCCAGGCAAAAATGCCCATTTCGGG CATAAAAAAGGCCGGAGAAccgtcaaaaattgaaaaaatcaaaaaatatc tcaGATTTGTGTTATTTGGGTCCCAACGgaccaaaaaaattatgcaaact taattttgaaaaaaaagtcctTATAGCCCACTGCTATTATAATATAACGG TCCTTACATAAACTCGCTTTTAGTAGAAATACATGGAATGCTCGAGTGGA AGTGAAGGGCGGTACGCGACCAGTACCTCGAAAATTTTAACATTCCAAAG TTGGAAACCTTGgaaatttcaacatttctatGTCTGCAAACCTCGgaaat taaacttttaaagGCCAGAGTGCCTCGGAAATTTTACTCTTTACGGGCTG GGTACGTCGGAAATTCCGCTACTTGAAAGTTCAACTCACCTCGGAATTTC CGTGTCGTCCGGGCCCCATTAAcggacaaattctggaatggcccaatcat tgttctactatttattatcattttaatcatttGTTCATTATTGGGGACAA ACTGTCTgggtcgaaaaatgaatcaatctcctgaatgtctaagacaggag acagattggtatatgtatattcttgtttaatccgaaagtcaaaagtaaat gcgtataagtattttgactgcaggaggagagagcttgaatttaaaaaaac ttccagaaaATTCTCCATTCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCCATTCCATTTCC TGCATGTTgaccaatcgggcaaaattctacaagcggaatagaatctactg tcgaaagctgagtaaaatgcccgcggcgcctgctattatacagaaaaagt ttttaggctagcaactgccatcccggaaaaaaaaccgaacatttacggaa gagactaactacgggtaggcttgcgcgacaacaacaacaacaaaacaatt cgcaaaattttgagattccagtccaatatctatgcgtgaaactatgagtg cctcctcgtcgctacgctcctgcgggggcaaaaatcGATTGATACGATCG GTGCACAGAGTCATTTCAGAGATTAAACAGTTCCaggagaaaatcaaaag aattgcaagaaaaatgaaaaaaaaaaaaatcaaaaaaatcaataaaatca gaaaaaaaatctagtACACTTTTTTGGAGTGCTTTTTAACCCCTCATAAA ATTTGACCAACTCGGACTAATTTCGACCAACACGGACTAGATATCTTACT CGAAAAGTTTGCTTACAACCTGCATAGTATAAACAAAAACTCATGCTCAT ATTCTGCCTACTTTTTTAGTCCTCAAAATTGCTTATTTAGATAACATAAC TAAACAGATTATATTAAAATGATAAATTAAAAACACTCACCAACTTCTTT GATGATATCGATCTCATTCAAATCAAATCTATCAATAGTTTAATTGAAAA CTTTCGGTACTGTGGTCTGTGGTGATGATAGTGAAGGTAACATATCGCAA ATAACAACGAAACAATCAAAAACGGTAAATGTgatagaaatataaaaaaa cttgcTGCAACCTTTTAACCACGTTCGTTTGTTAACTTCGTTCAAAAACA GGCATGCCCTAAAAACACACGTTGTTAAAAAGGCGAGGTGAACCAACGTG TTGAATGGGGTTTccaaattttgacgttcgaatgTCGtagcaaaagacgg gggtaaacgTTCGAAAATACGCCAAAAAGCCGCTACGAATGTTTTTCGTG TTTTTATAGTTACAAGTTAGTCTTTTATTATTGTAAATAtgaattgaaaa ggaaaatacaATGTGTCATCtttcatttgtctttttttctacgcccaatg tcaattttcaggagagaACTCGAGGAGTGTTTATATCAGAGGAAACCCCG CTCTATTTGATTGTTAAAAGAATTCCACGACACAGCATTCGAAAAGTAGA ATAATTGGTTTCtctcaaaaactgaaatgacttattttttgtaaaaactt gCATCGGCAACCGGTTAGTGTAGAACACAGGTCACAGgccacgggtcacg ggtcacaggtcacaggcagtggcgttgtgggaaaatttttctggaggggc caaagtcaattttttttaaatggcgcctcCCCCCCacctccaatttttca aagtggtgTCCCACCCatcattttctaaacttttaccaaattaatttgcc taggcataatgcggaaggaaatatttagtgggaagagtagatttatcttt gatgaatggaaaagggaaaaacaggccccaccatggttggggccgactag aaaaattttttaaatcaactgccaagataccctaaatcactaactaaaaa tagacaaatttgacacttgctagagtgaaaagaaactgaaagaaacaatg tgttatgcaagcgaagcgagcgaaaaaattgatgttttatgatttcaata ttgttgtcagcagattggtcttggggcgcagttagatttccatttaataa tgctatattgtacacaaaaaaacttgtaattcagctagattgcaaagaag ttaccaattaactgtattgcgagcgaagcgagcgaaaaaaattgcaagta ttttaaaattatctcagtaaaattggtcctcggcgcaatttaaggcgcat aaagtatgatttttaagattggggcgtttaaaaaaatctcttttggcgcc ccttgctcttcggcgcccctttaAAAAAGCTNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAAAaaa acccccgggggggggggcccgccccccccccccccccctgccacaacgcc actggcaCAGGTCATaaaaattacagaccggaaaactgtaacgcactcgt aacatacaactcataacataagttcctaaaaatattatatgtattggaaa tataatatcaaaatatgttatttagaagacttaagcgacaaatcatcaac cccaaatattgacaacaaatgacactttaACTATGTAAATAATGACGTTA TCTCAAAGTGTGAGGGTTTGTCCACCaattaacatcaaaatatttttcat gctgacgctgcaagtggatatatattgacaggttttgaaaacaataaata ttcCAAGAGAGCTgatttagagatatgaaaatagtgacgtcattttatca aaaatacaaagcataaaataaaaataaaataaaaatattgaaacatttat aaatatataatccccaaaacaggctcagagagaGATGCTTAGGTCAAAAG Cttgataaggctgaaaaatgcttgacggatgcttatatcctaccgtcaac tgctctaacttgggactccTAACAAACACAGGCAGTAAGGACCTTTCTCG TAATTCTATTTCATAATACTGCGCATGCGTAATTTTCAACCGGTAGTGGA TATTTAATGGCTtttttcggtcggggttgtggacggccaAATCCATTAGA TGTGACGTTCTTTAGTGACGTATTTGTCGCTTATTGGGCCGCtaccagtt agggtcagggttggactcGAGAGTCACAACTGAGTGCCCTGGACCCTTTT AGAGTCACTTTAGGGTCAATTGGACCCactgacaaaattgaaaatcttcg tttttataagattttagATTGCTGCGAATAAGGTCCTTTCTTCCCCtcca aaacatgggacggcaattcagccatcatttcactgaacctccaaagtcat ttgatttgagttaaggaacggcgtattagaaatacacgatttctctttcg attttacagtaagtgaaaatacagaccagatatgcaacagtgccatgttt tgaccaattgtcccaagttagagcagttgacggtaatacTTAATACTGCT TATATACTGCTATACTACGACAATACTGCTTATACCCATACTACAAAGTA GCGTATACTTTTTTCATAGGCTCCAGGTAATGCTTAATTTtcccccatat ctgagcctagaatatgcttacaagtgcaatgcttataaaaaacatgcaaA AATATAGGTAGACAATATAGATAATAAATTAATGTTCTTTCTACTACAAA ATTATAATATGGAATTTGAAACTCCATACATAATCATGCAAGTAGAAATT TATTGTTTCGAATAAATGATAAATAGAAATAAATTCAAAGGTTAATAAAT TACATGTTAAATCATTACCATTAAAAGACACTTTTCGAAGAAGTAATATC AAAGTCAATTTAGAATTTATTCTGAAAACTATTGGATTAAAATAAGATAT AATTGatctagattttttaaattgatgaaaataactAAGATCCAAAATTT TACGATCTTTCTACTCCAAAATTAAAATATGCAGAGACAGAGGCCCAACA AAAGGAAAAACAAGATGGCTGCCATGAATGAGAATGAATGAAAGCAAACA CTGAAAAAGGCCACAcctacaaaaacaaaatggctgccatgaaagaaaaa caaggaaGGCAAAACCTACCAGCTTGCCGGATATAAAATGCTGTGATTGG CAGCAAAAAGTCAAGTGAATGTATGATTGATCCACAAGaccatgaaaaat atattgagtTGAGTTAGAGAGCTCCTTTCTTAACTGAAGAAAAGTGTGAG TGTGCACTATTTAAGGCCACATTAAAGAGATAATAAAAACTAAGGAGATA AAGTTACTAAGCATATATGATAAGATTATCAGTTAGCATAAGATTATCtc tataataataaaaaatgtaaacaaatgaaCTGTTCTACAAATTGACATTA TGGAGATAtgatattgaaataaaattgtaaTTTCTCATAATATTGAATAA AATTAGGCCAATGCACGCTACGAGGAATTGTTATCTCCCTTTCTATGATG CATATTCGACAAGATGGCTCCTCTTCCAAAGAAACGATAAAATCAACAAC ACCAACAAAACTTTGACCATCCATACAGGCACATTGAGAGAACTCTTTGG TCAATTATCAAAAAACGTTCTCACAACAACTTTGAATGTATCATAGACAA CACTATAGAACTTGATTATGTAGCGCCCGATTTCCGAATTATTTCACCTA AAGTTATGCAGAACACTGTTTTCAAGATGGCTACCTCATTTTAGTTGTTT TGGATTATTTTAACGACTCTTCTAACCAGTTGGAATGTCAGTTACTAAGA CTTCAGTTAGCATGTCCATCTACCAGGAATTGGTATCTCCCTTTCTATGA TGCATCTTCGACAAGATGGTTCCTCTTCCAACGAAACGAtcaaatcaaca acaacaacaaaactttGACCATCCATACAGGCACGTTGAGAGAACTCTTT GGTCAATTATAAAAAACGTTCTCACAACAATGTTTGAATGTACAATAGAC AACACTATAGAAATTATGTAGCGCCTGATTTCCGAATTATTTCACCTAAA GTTATGCAAGAACACAGTTTTCAAGATGGCTACctcattttattattatt attattatttattttacttatcatttattttatttattatttattttatt cattGGTGAGCTTGAACTTTTTTGCTTCACCTTTCTCGTTTAATTTGATT AAAATTGAATCATATTGTTTGACCCAACGTTTCTGTTGGTCCATGAAGCC AATATTGCTGGCGACCTTGAAGGTATGATCCAAAGATGAGGAAGTATTaa ttaatttcagaaaaatgttttgagaATAACCTTTGGTATTTGTTGTAGAA TATGACCAGAATGTCTATTAATGTATCAACACTTCGGGCAGTGCACAAGA TGGTATCCTGTGTTAAAGGATATGCATTATCAAAAAGGATTTTCCTTCTC ATgtactttgtcaagaaaacatTCTTACAAAAATCTGTGAATGGCATTGA AGGAGCTCCCAGATTCAACCATTCTAAGTATGACATCATATAATTCTGTA GTAAATCCAATTCCATCAAAATGAAAGGTATCGTCTCAAATGGTAATTGG TGTAATATTCCAGCGTGAAAAGACACAATTTTGTGAGATTTATCCGTACA TTTGTAGATTTTCCCAACTACACGGCAAATCCATCCCACACTCCATATTG TTCTAGGATTCAAAATATGTAGAATTTAAACTGGAGAAAGTTCAATCATC TGTGTGCTGTAGTAAAACTGTCTTAGCAGTATCTGTTCAGTGTTGACAAA AAAGTTCAGTTGATGTATTAATTAATGGATCCCAAAAGATAACATCTGGC AGGAACGCAGAATCCAAACTTTTTCCTCTGTCAGAAGTCCTTTCATTTAA ATTAGTGTATATAAGTTCTGGAACTTTGATAACATGTTTTTCAGTTACTA TCTTCATCCTAAAATTCAAATAAACATTTGTATTAATTAGACCTAACAAT GAAAATTCTGAACTATTTGGCAAAGTAGCTAACTATAAAAACCTTAAGTT TTGATGAATCGCATTGCAAAGGAAGAGGTTGGATGTACACTAAGgattaa caagcaacatgctgaatggacctacctgtcgatcaaaatcagaaaaaaat aggacaaatagcaagggaataagaaagtgtagtgagcagcttgaatagat taccTTGAGTATCAGAGctcaaattagtcaaaaaagtctaaaaaaaaaca aacattaggcacttttctacccaaattaccaatatacaaaaaataagaaa aaaataccaagccaatctcgagaaatgctcattttccctaaatatgacaa aagggaatttccctaaataagaaaatccgattNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTACTTCAGTCacg ttttagagaaccttgcccttcatctttgtccaaaaaatcagaaaaaacta atgaagcaatttcacacaaagtccaaaaatcccatttttaggtacttttt ggcccaaatttgcccaaataaataattttttgaaaatcaggcttcaTCAC agtttaaatattaccattttacatcaaagtgcaaaaattcagaaaaaaat atgaatcCAATCGCAagaaatgctctttttccctaaaaatgataaaGAGG GAATTTTCCCGAATAAGAAAttccgatttttacggccaaaaaaaattttc cgagaaaaattacttcagccacattttagggtgccttgaactctatcttt ctgccaaaaatcaggaaaaactaatgaagcagttttgcacaaagtccaaa aaacctcatttttaggtagtttttggcccaaaattgcccccaaaaatttt tttccaaaaatcgggctccgtcactttttaggcattgctattttgtatca ttgtgcaaaaaataaaaaaaaactaaagagccaatcccgagaaaagctgc taacaggaaaatggtaaaagggaatttccccaaaaaacNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN Naagtccaaaaaaccttatttttaggtagtttttggcctaaatttgcgaa aatccgtatttgacgacgaaaaaaaattttccgagaaaaattacttcagt cACATTTTAGGGTCTCTTGGACTCTATCTTTCtaccaaaaatcagcaaaa actaatgaagcaattttgcacaaagtccaaaaaaccttatttttaggtag tttttggcccaaatttgccccccaaaattttttttcaaaaatcgggctcN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNgtgcaaaaaataaaaaaaaactaatgagccaatcccgag aaaagcttgtaacagacgaacggacaacggtcaaattaaaggacctcccg gtaggtccaaaaatcaataaggaATTTAAGAAGTTCATGAAGGACTCCAT AGTGGgcaacacccctccaacccccacctaaaaaaagtcacccccacctg cataggcttacccccacctgaaaattgaagactactcaacccccacctga ttttaaaaaatcttccaacccccacctgaaaaatccaatttcatctgttt ctcaaattttaaaagtttcattaATAGATTTGATTGAAACACCCTCACCA GTGTTATATTAAATTTGTATACATTATACTACAAATTgggatgtttttct tttaggtTTGGACTCTTTTTTGTTTGCCTGATCATTTAGCCATTTCATGA TCCTATTAGTAAGTGTGAGGAAGCTGTGCTAAAAAAAGTgagcttttttc ttttataattaGCAAGCCTGtattatatagttttttcaaagtttttcttt ttttgttcaactGAAAGATCACTCAAAACTAcacaacccccacctgaaaa tttcCACCCCCACCTGTATAGGGTTTTACCCCCACctgattcaaaaaatt tgaaaatcgtcGATTCTGCGGGGGTGCCCACTATGAAGGACTTTCAAATT TACTATCTGAAATAAGGTTCGAAAGAAAGTAAGTTTTTATTACTAATAtt aatatcataataatataaaACTAATTATATCCCCCCTTTAAGTTTAAGGC CAGAGGGATAAGTCTATAAGTAGTTCTTTAAGGTGAACATAAACCAGGGG ATGttaatcaaatttttcgatCTCAAACTTTCAATCAATCGAACACCAAT CGAAGTAATATTTTATTCCACACTTGATTAGATTCAATTGGTATTTGATT ggattcgattgatgttcgattactTTGATTACACTTTGATTGCAGTTCGA TTGAGCTGCGATTTTACGTAGATTGGCTAAAGAAGCTGATTTTTGCAAAC CTTTTCAAAGGCCTAGCAGGAAACAAGAATCCATTACTTTTACTAAATAA TGATCGAAATCAATCGAACAACGATCAAAGTCAATCGAACAAAGATCAAA GTCAATCGAACAACGATCGTAGTCAatcaaatttacatttttttacttta aatcaCAATTCGATTGGCGTTCCCATCAATTTGGCCAATCGAATAACATT ACCTCGATTGTCTTCGACGAATTCGATTGGCAATTGaagttcgatttggt ttgattgaCTTCCCCTGGCATAAAGTAAAAATGAGATATAGCAAACAAAA AAGGAACTTGTTCTCCACCCACTCTAAAGgtccaatgtttttttttgcca aaataggcttttattttattaatgcAAATTATTTGTCTTGTGTTTTTTGA TGCTATTCTTAATATTGTCTTGTGTTTTTTCTATGTGTATTTTTCTTAAC CTTTctagcgcgcaacatttttctATCTTCAGCCTGTCTGCGCGCaacgt tttttgatgaaaatgcaattttcacgatATAAACcgttataactttttga aaaattaacttcagaaaaaaacccttatatttttggaaagcactACCTTT CCCCTTTCTAAATATGTTTAACTAAGTATTCCAAACAATTTCGGACAGAA ATTATGAAGCCAGACAAAAGGTATATGAAAAAACAATGTGGCGAATAAGT CATTTCTAgtgcaaaacttcaaaaaattatagagaacttaaaaattaata aaaacatttacttttttctttagaaggtTCCTTTATAGTTAGGTAATACA ATTCCATACTTTCGAAAAGCCaaataaaactctaaaacactttTATAAAC CCATACTTTCATAGCTAAACTTCTACCTCCTCAGTTTCACAAAATCACGC AACATAGCTTGGTCTaccatttctatttttgaaaaatgttgcgtCATACC AAAACAAACCCTGATTGTTTCTTATCAGAAATTACACGCTGAGTCTGATT TTTTAAACCAAATATAAAAAAGGTCATCTTCAAAACGTATCAGATACACG TCTTTCGGGGCCGAAAGGTTAAAATGGGAGCTTTTTTGTCCAGACATAAA TCTTGTAATTATATGCTTAATGgattgtttattaatttttatttgTAGAA TAAGAATATCTAAGAGCATCTGCAAAGGAGgtctttggaaaaaaataaat ttgcactgtaaattacacaatgcCATTATCAGATTATGCATAATgaatta tgttttatgcattatgCGCGTTATGCGTTTTAGACTTGCTATCTCACATT TCACCTTTTTTTAACCTTGCTTAGCCTGGCAAAAACACAACAAATACAGC ATAAAAGAGACAAATGCCACCAATTTTTGTCTTTACCTTTCTTTTGAAAC TGAAAATCACAAATGAATTTAATATATAAGTTTACAGATGACTTCTTGAC TTGGATGCAAACCATAAATTGAAGATACCAACAGAGACATTTCGTGGTGG ACGAGCTGATGCACGTGGTCCAACACCGTGCCTACTTAAGAAATAGACGC TCCTCGCGTATTCATTTTTGTCTTGATGTGTAAAACACTGACCTAAAAAT AAGAAGTTAAACATACAAATATTTTGTCTAGatctgaaaaaatcaaaaaa tatagaATAGATATAAAAATATGAATATTTCCTTTAATTCTCAAATGAAT ACTTCTTGCcaattgttttactttttggtcactttaaactttaacTGGGC TAAAATTGCAGACCAAAGACCAGTAAATAAATTATGGCATTATGGGTAAT TGCAACTGTTAAcactagaacactagaacgATACAACGTTTGAACgtgtc aaaataaaaagaaaaaaagaacgagtctgctaaattgcgtgggatgcgtg ggtgcgtgggtcatattttttggcgtgggtcatattttttgcgtcaTATT Ttttgggtcctgaaaaaaaattcgtgggtcctgaaaaaaaattcgtgggt ccacaaaaaaaattcgtgggtccaaaaaaaaattcgtgggctcacaaaaa aattcgtgggtctaTGAAAAAgattcgtgggtccagaaaaaaattcgtgg ctcttgaaaaaaattcgtgggttttggtaaataaaaattttatgtattgc atttaagcatttttttcgcgtaaaatttcaacatcaagatcaagaacaaa aaagaatttgaagaaaagataaaatgatttctcgtgtttttgtacacaaa atatttaggtaagtgaattttttttcgttcattACGATGGCCCCGAGGTT TCTCCACTTCTAGAAAAAGACAAttcaagaagagaagtaaaaaatgaaga agggaagtaaaaattttaagaagagaagtattttttttgtattacttcac tgaaaattttacttttcttcttgatttttttacttctctttcaagctttg aaaaatgaagaagagaagtaaaaaatgacaaaaataccaCGTGGTTATGA TTACAACCCCTGACGTATAGAAAGTTTATTGTTATTACAGAGAGACCCCT TACCAGACTCCAGAGGATGTTTGTAATGGCAATTATGTTGATTAGTGTGA TTAAACGTTTAAAGCTATCCCTTANNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNtaaaatttttacttcccttCTCGAAATATTTACTTcccttcttt aaatttttacttctcttcttgaaactttcagaactttttttaGAAGTGGA GAAACCTCAGGGCCATCGTAGTTCATTTCTTTGACTTTAAGAAAAATCtt attcatataaaaaaatgttgtgCACTTTGTATTTTAAACTGTATATATAA AGAAACTATCGAAGTAAAGGAAGTATTTTTAGAATTAGATAAACACGAGG TTGAAGGAATTTACTttattttagttaaaaattaacaaaagaagaaattt tacgGAAATGACATACACGAAAAGACACGAGCCATAAGGTGTCAAAATAT TAatctttttataaaaataatacaaTTTACGCTTTAAATTTAATACAATA GAACAGAAACTTGGGCTCTATTCAAAAGATTTATTACGAAATCCTAGCTA TAAAATAAagagagaaatattttttttttcaaaaataatgcaaTTTTTAC TATTAAACTTATTCAatgcaattgaaaaaaaaagatttcttcccATTCCT TTCACCAACTTAGGGCTCAAATTACGGGTTTatttttttacgaatttttt tcatggacccacgaatttttttcaggacccacgaattttttttctggacc cacgaattcTTTTTaaggacccacgaattttttttctggacccacgaatt tttttacgcgacccacgaattttttttctggacccacgaaatTATTTACG CGACCCACGGATTTTTTCACGCACTAGTGGAATGTTATAGCAGGAATCGG AATCTTATTTGATCCTACGGTAAGTTTCTCAAAATCAGAACTGATGAAGC CTAGGTTTGAAAGGACTATTTTGCAagtataagctttaaaacgacGCTTT TACAAAGAGGACGAGAGGATGTCAATGAGACTAATACAGAAGAGTCGAGA GTATTGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNT AATACAGAAGAGTCGAGAGTATTGTTCTGTTCTACAGCTGTTCTAAGCCT ACAGCGGAATGTCTCAACGATATgggaagaaacaaaacataacAGTTGAA ATGAAAAATCTGAATCAAAGTCTGGAAACAATGTTGTTAGTACCACTATT CAGCTGAACATTTATTCTAAATAGTTCAATAGAGGTATCTTTGAAATTAG CCTCGATCTCTTTAAGAGGGCGCAATGGCGGGCGTGTGGTGCGAGACAAC AGCCTGTGTTGACCGTGcgataagtatttgcaaaaagctgtttgcccctc gcagtggtctgctcaccgccgcgtcaaaacgatttgcaaaagaactctac atgcaaaaacggcaaaaacagaccctgtcagacacacaTCATGAAATTGC GCCCCTGTCAGANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN TCATGAAATTGCGCCCCTGTCAGAtcaggattttgcaattttagataccc tgtcagtaattctgcaacactgaaaaaggtaccctgaccagcggcacgtc cctgtacctatttttgcctaagtgccccccctcCCGGGAAAAATGCCTTC CCTTGAAATTCGAACTggtcacatccaaaatgttggatgtgttttacata acacttttggtttattttgtttattgtgCTGTACAGTTCCGTACTGAATA TGGTGAATTTGTTCCAATGAACGAGGTCGGAAAGAATGTCTCCAACAGGG GAGAGTTATTTTATAAGTGGAATTTTCCCTTTTGGGAGATTTCGTTCAAA ATTAATACTGTAGTTACCTTgagaatggccaaaaaaatttaCACAATCAA GCGGccttatattttttaattccgCTGACTGAACATGTCAGCTTTTATAG CTTCTTATAGCACGCTTTAATCTTTTGGGTTTCCTTTGAGTGTTATGTTA AGAACAAAGCAAATGgcgacaaaatctgaaaatttttctacaaaagttaT ATTCATTAGGCGACCGATTACCAAACAATTTAATCGTTGTCAATTATTTC ATCCACCCCACTggtaatttctttgatttaagtacattaaaggtcaatta aaaaaattggacgaaataaagacgctgtactttttttcaaagcaagAGAA AAAGGGAGGAAAGAATTCAATAGAAAAGAAAGAAGCAATGGACGCTCATA Tctcatttttttgcttaaagttatagtgtttatttccatgacactggaat cctgaaatataacacgctaaaattcaaaagtgttATCCTGAAGTGTGTCT TCAAAAATTAGACGGGTGTGTGTTGATTCTGTATATAATATTATAGTAAA TATTTGCTACCGTAATATTATAGTAAATATGtgctaccgtgaaaagcaca gatcgaaatcatatatcgacgctgtgccgacgaatcgagattctNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTGAT AGAGAATCacaacataaagtctgtctattatttcgattcaattaaagtga catttccataattaatagtttagtaattactgttatacatttggggatgc atgtaaaagatttctttcgaaagaaacttaCTTCAATTACACacgaggtt tctggggaattcgtaaatagtaaactgcatattGATAAAGTCTGCTAAAA AATAataacccacgcaaaaaatttgacccacgcaaaaaaattgacccatg cAAAATCTTTGACCCAcggacccacgcaaaaaaaatgacccacgcaaaaa tattgacccacgcacccacgcaacccacgcaatttagcagactcgaaaGT ATATAATCCAATTTACCAACGATTCgagatccaacgatccaacgatctAG CGATCAAAACATCCAACGATCCAAGGACTCGgcgatccaatgatccaacg atccaatgacATAAtaatccaacgatccaatgatccaaccaATGATCCAA CaatccaatgatccaacgatccaatgtgATCTAATGATCCAACAATCCAG CGATCCAAACACCCAACGATCCAATGATTCAGCGATCCAACAATTCaaga tccaacgatccaaccagcatgaaccagtgaaccatgaaccagagaaccat gaaccagtgaaccacgaaccagtgaaccaaagaaccacgaaccaaagaac cagagaaccatgaaccagtgaaccaaagaaccagtgaaccaaagaaccag agaaccagtgaaccagagaaccatgaaccatgaaccagagaaccagagaa ccagtgaaccagtgaaccagagaaccagagaaccagagaaccatgaacca gagaaccatgaaccagtgaaccacgaaccagagaaccagtgaacaagaga accatgaaccagagaaccagagaaccagtgaaccatgaaccagtgaacca gagaaccaaagaaccacgaaccatgaaccagagaaccagagaaccaaaga accagtgaaccatgaaccagtgaaccagagaaccatgaaccacgaaccaa agaaccagtgaaccaaagaaccacgaaccaaagaaccagtgaaccatgaa ccagagaaccataaaccagtgaaccagtgaaccatgaaccagcgaaccat gaaccagagaaccaaagaaccacgaaccagtgaaccatgaaccagagaac cagtgaaccagagaaccagtgaaccatgaaccagagaaccagtgaaccat gaaccagtgaaccagagaaccaaagaaccacgaaccatgaaccagagaac cagagaaccaaaaaaccagtgaaccagagaaccatgaaccagtgaaccaa agaaccagagaaccagagaaccagagaaccagtgaaccatgaaccagtga accagagaaccatgaaccagtgaaccaaagaaccagtgaaccagagaacc agtgaaccatgaaccagtgaaccagagaaccatgaaccatgaaccagtga accagagaaccatgaaccagtgaaccaaagaaccagtgaaccagagaacc agtgaaccatgaaccagtgaaccagagaaccatgaaccatgaaccagtga accagagaaccatgaaccagtgaaccaaagaaccagtgaaccagagaacc agtgaaccatgaaccagtgaaccagagaaccatgaaccatgaaccagtga accagagaaccatgaaccagtgaaccaaagaaccagtgaaccagagaacc agtgaaccatgaaccagagaaccatgaaccacgaaccagtgaaccatgaa ccagtgaaccaaagaaccagtgaaccagagaaccagtgaaccatgaacca cgaaccagtgaaccaaagaaccagtgaaccagagaaccagtgaaccatga accagtgaaccagagaaccaaaGAACCAATGAACTAAGAAACCAGAGGAc tatagaactatagaactatggaACTATGGAACTATGGAACTATGGAACTA ACAAACTATAGAACTATGGAACTATGGAACTAACAAACTACAGAACTATG GAACTATGGAACTATGGAACTAACAAACTacagaactatagaactatgga actatggaactaacaaactatagaactatagaactatggCAGTAACAaac tatagaactatagaactatggaACTATGGAACTACGGAACTAACAaacta tagaactatagaaTCTGCCTAGGATACGTCTTGTTTTTCCGACAAAAAAA TCCGACGATTTCAGTATTTCATATATTGCAATAttaccacttttagtatt cTAAGCTAGAGTAATTTTCTcagccacgtgctcagtggttcatttgaaag ccacaccaggactcgatttggatgttctctacggtggagaaagcagataa actcgataacccaaatttatctggtcgccggtcgtggtcgctggtcgtgg tcgccatttctggtcgatgtttagaaactccctagaaatctctctttctc ctctctttctttttgtttatcgaaattaattgaattagcaaacaaaactc tcaagataacaaaagactacaaactgtcaatcaaagttctctatcattca actctctttttggttagcagattttttgctaagttcggaacggttttgtg agcctgattcgcatcccctatatcaaaacttatcagaggggatgtgtgca gcctactAAANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN aaaaaagagggagagcttaaaatacaattttgtgaacacgcacataaaac tttctactcatagttgtgtttcgactcgatactttaattagggacaccct gtacaaagGAATTAACAATGCTCTCTGATATAAATGTGACATGCATATAA ACTTTAATGCATCTCACTGACAAACAAACCACTgaacatcaaaaatattt tgtttacaaaaaacaCAGCTACACGAAAAAAAACTAATTCTTGCACAAAT CATCATTTATATGTTCGAACAGCTCCTCGCCAGTCCCGAAAGTCTTAGCG TTCACATGATGGAAGCATTCCTCACTCCAGTTCgataaaaaatatcgata ataaAAATCTTGTCTTTCAATAAATCCTTGACAACGATACTTATTACCGG TGAAAATACGGATGTAAACATGATTTTTGTTCTTTTCCTTGCGTGGCCGA TAAAGGGGATGGTTCTCCCATTTAAATTTAGTTAAAGTCAAATTCCCGTC AGACGATGGCATTATGCCTCTATCTGGCGTAGAAAAATGAATTTCTAGTG GGTCTTGCTTTACTTTCGAACGTTGGGCGTTTACTTTTCTTAAGATAGCC GACGCCATTGGAGTGTAAGTAAATTTCATTTGACCAACAGTGACGATTAT ATTTCGAATGTCCTTCATGCAATCATCagtgaaaagatttttcttagACA TGACCAAACGGTACGACATATCGTAAACGTCGTAGTCCGGATTTTTTATG ACATCGAACAGTGTCTTAAAGACAGGGTGTTGCAAAGAAAAACTATTCCC AAACGCAACCTTtgtttgaatatttcgattcaATGGAAGCCAATCTATTG GTGAATAAGAAGAATCAATCCTGAAAACAATAATTGTCCATTGTCTCTCG TTCTGTAATAACTCAAGATTTTTGAGAATATCAACGGCATTAATGATATT GTTTATGATAAGGACAAGAGTTTGTTTAATGTTTACATCATTCCCCATGA TCTTCTCGTCGTAAAGCTGCTTCATTAGTTCGGCGATTCTCGGCCTTTCG TCCAAATATCGAGAGGGATTAtcgtaaaaatgaaaattttttgttccaaa ttgaaattgattaatATTGTAGTTCTTTCTCAATCTCACTATGTCAAAAC CGTTGAAGTAGTTCACCATAAAACATGCTTCGTTATCAAGCAAATCGTTT AATCCTTGCATGAAGAAATGGTGATCAAAAGTATTATCGTAAACACCCAT TTTCTGGTTATTGTTAATGAAGGTGATGTTCCTGAATTGGGAGCAACTTA ACATTGAAAAGTCCTGGAAATTCTGCACAACACCATTTGAAGCAGTAAAA TAAACAAATGCTGATAGAACGAATAACTGGATTGCAAGAAACATGCTTGT CTTCTTATTTTGTCTTTCAAACCTCTTCAGTGTCGATGATTTATTACTGC AATGAATCTGATTTAAGGAtgattgtttatttgtcttcttataaaaatgc aTATTAAAAAGAATACCACATTCTTATCCCAAGTATGAAACTTAAGACAA CCACTGTTAATTGAATAAGAATTGCTAAAGATTAAATAATTGCTGTTTGC TTAATCACTTTTTAATTAACGTGGTAGGTTGCTACCATGGCGATTAAACC CCCTCAATTAAAAGCTCGTATTTTACACCGTTgaaattctcaacttcagt tgagctacaatctgacaaagTCTGTctgttctgcgccatcttaagttggg tgaaatagaaactcacttatcctagttaaggcccgggctcccactggcgt acgctgtgattgcacttctcaagcaaaatcttctatgttgttggtcaaaa gaaaagtaaaggaatgccattgtggttcattcagacgtacagtcgagaaa agttaaaatgcgcctaaatttcttttcaagtgcaaagtcctttttcatga tgcaattttttctccaagctgatcgcagcgcagacaatgaagagacgtgc cttcaggaagctagactttttgagtttatagctagcgatatactttccct ttatgGTGTTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNtaact tagaaagccagaatttggagctatttcaccaaaccactggagcgtaagtt atttaggctatcacaactgcatgaaaaagtttaacgtgcgcATGTCAGGC AAAATTCTAGAAAGGCAGGGTAGCGTACATTATATTCAAAAAAGAGCact ttttctgctgatttttcataaaaaggaCTATTTCTACCATTATTTTTCTT AATTCTTGAAGGGCAGCGCCCGATATCCGGACGCTAAAAAGGCATGAAAA ATGGTCTgagaagtgaacttctgactaaattacagtagttagtattcagt ttcaaagacaagaaacaaaatttgacatacaaaacactttttctagtcaa tgaatcagctcatcatcatcataaccagtctgccattttgtttgttttga tttgcacaagtaatattgtaattcgtgctATATCATACACcgttttgatt tgcatttataaaactcgcttcagcttttcaaagctaaatgtgtatggaaa gtgagaggtagcCCTCGGGCTAAGCTCTACTttaagaaaatatgtaaaaa gaccgttattgatgaactgtaaatttgaattagattatttcatagaggtc aatagacctgcgaaatatactcctataacaaaaaaaataaaaaaaataaa tcaaaactaaaattgtaatatgtaataatgataataccatataacgtaat atgaaaatatgtatactaccgtcccggaaaaaacccgaacatttacggaa gagactaactacggatatgcttacgcgacaacaacaacaaaacaattcgc aaaattttgagattccagtccaatatctatgcgtgaaactatgagtgcct cctcgtcgctacgctcctgcgggggcaataaaaaaataaaatataacaaT ATTTTAAAGAATAAATGACAAAAGGAATGCACAAAATACGAAGTTTCATT TCTAGCATtttttgccccgcaggggcttttgttgcttcacgcaGCGGATT TGCTCGCCAGAAGAATATTCATGTTCAgattcatgttgtttcttccgatt ctgagcgggccgccAGGGTTTAAAAATGTTTGCGCGCGATATCTCTTTTG TTGCTACTtggtactttataagaatcaaatcaataactcttgattgaagg ccatatacctttcggtaattagtttttagaaagaaaacaaaggatggcga aaaaattgagcatatttatttttattataagcatctactttataagaatc aaatcaatgacTCTTGATTGAAGGGNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNcatatacctttcggtaataag tttttacaaagtaaacaagggatggcgaaaaagatgagcatatttatttt tattataagcattttctttataagaatcaaatcaataactctgaTTGAAG GCAACAtatcttttggtaattagtttttagaaagtaaacaaaggatggcg aaaaagatgagcatatttatttctaTCATAAGCATCTAcattataagaat caaatcaataactcttgattgaaggcaatatgcctttgggtaattagttc ttacaaagtaataaaaaagatggcgaaaaagatgagcatatttatttttg ttataagcattttctttataagaatcaaatcaataactcttgattgaagg caatatgcctttgggtaattagttcttacaaagtaataaaaaagatggcg aaaaagatgagcatatttatttttgttataagcattttctttataagaat caaatcaataactctagattgaaggcaatatatctttccgtaattagtta ttagaaagtaaacaaaggatggcgaaaaatatgagcatatttattttaat tataagcatctaatttataagaatcaaatcaataactcttgattgaaggt aATATGCCTTtctgtaattagttcttacaaagtaaacaatggatggcgaa aaagatgagcatatttatttctattataagtgtctactttataagaatca aatcaatttcagaatttttggcgttcgcactgtgataacatgtgagcgat aacttctctttttgagatgtgagcgaaCGTCTACcgcatgtcatctcaaa agtaaggttgaaaccaagctttcttcctccaacTATAATTTTATCGAtat aaaacgaatttaaaatctacacatgcgttattttgcttacttagggatat ttcgaaaggaagctctgcggggcattTTTAgtgacagctacttgctagtt ttataaattatttGTCTACCTATTTCGATAAATTAGTCGTGAAGAAGGAT ATGATGAAAATTGATTGATCACGTCTTTTAcacttgaaaaatttaatttt aaacttttctCAATTAATCgacattttttattcaaatattgaaaatcatt ttttgatgaGTCGGCAGTTTTATCGACTTTAAAATTGAATGATCTCCTGA TTTAGACACCAAAATTTAACGAACCATATTATTCTTGGATACTTCTAAGT CAGGGCTATCAAGCTGTGAGGTTGATTTTTTCTGGAAACTTTCTCAGAAA AATCGACCTTATCTACTACTTAAATGAACTCTATCGATTAACTTAAAATC GATTCGTATGAAAACTGCAGGAAATTCGAGAGacattcttttaaattttg cacCCTATAATTAGGAGCAAGATATTAAAAATATGCCCAGATCTGAGTGG TGACCTACGAAAACTTGTTTTAAGGTCTTTTCTGAATCTTGGACGTTGGT CCGTGGTCTTTTTCGAACGAcgtttttcgttttctttacAGGCAGGTTGA TTCAGTATCCACTTATAATAgtttattttcagaaaatattAAATTGCCAA GGAATCAAGACACAATTTCAGACTCTTACACAATGTATTGAGCTTTTTAT GCTTTACAAAAAGTGGTCGCGCAAAAAACTGCTGACAAAGCATTAAATAA TATTCCAAATGTTGTTGAAAGATGCTCTGGGAATAAATGATGTGTTGAAT TATATCCTTCAACTATTTCTTTAAAGGTTTGGGATTCGAATGTGGATAAA GATTCTTCGGATGGCGCCAAACAATCTGTTTCTGTCAAGACAACTGCTAT TGCTCCAATCAAATACCTTGTCAATTTCTATGACAACCAAACGGAGAACT TCTTCCCGCCTGATGAACTTCGTATCATTGGTAAACCCATCAAGGGGGTT GTCCCTGGACTAGGGGCGTGTGTTTACGCCCGCTTTAATGATGGTTTTTA CTATCGGGGCAAAGTTGATGACATCGAGGATTATCGAATCCGAGTGCAAT TGGATGAGATCAGTGGAGAAATCGAACACGACATCGATGATCCGTCAGCC GTTATTTTGAACCTGACGCCTCAATACCGTCAAGTCAAAAAGCATTTCAA AGTCATTGCATCCAAAGGAAGCACAACTAAAGGATATCATCCGGGGAAAG TGACCGCCATCCAAGGTGAAGGAAATAACCGATTGTATTCGATACGCTTC GAAGACGGTACAATTAACCAAGTACCCATCacgaaattgattttgatgcc AAAAGCACCTTTTGATGGTAAGATAAATATTCTCTTCTCTAAAATGCTTG TCAGTTTTTTCATAAGATTAGAAGTGAGTTTGCAAACAGGGAGGAAGTTT TGAATTTGGAGTAGTtactttaataattttcatatttttcattcgCTTAT AAATAGCTTTACCTGAAGTTGGCACATACGTTTATTCCCGAGTGTCACGC GACGCTCCTTTATACGAGAAGGGTATCGTAGCAGAGAAGAACACAATGAT CTGCGTTAAACATTTAAATGGACGGAAATTGGCTCACGAAATACAAAACA TTCATTTTGTTGTCCGAAATATCGTTCCTCTCGTGTCATCAttgaaggtt tgtttttattaacacaCAAAAAGTTAGGGGTCGAAGTTGTTTTATTCTTT AAAGTAGCAACTGAATATATCTACTATTTTGTCCTTATTTTTCTCCACTG TTTTTCCGGGTgttaataattttcattttaacggtacagattttgaaatg aataaaaaatacatCTGACAACCcatttattagaatttttaGGGGCCTGG AATGGAGTTGATAGATGTATAAAAATATTCTCATTTTGTTATGGAAGGTT GGTTTGGACGTCATAGTGCAACCTGACAATGACGATCAGAAAATGTATTT GGCTGTCATTAGGGAAGTCACCAAAAAAGAAGGTCAAAAAGTCGCTCCTA ATATTTTATATTCCGAATTTAACACAGCCCACcttacttcattttatttt gtcaaaagaaaatcattttatcACGTTTGTTTATATGTAGCCTTCTCAGC TTGGGTGCCTTTCCAAAATTTAAATGCAATGGGTGTTCTCAGTGAGTGAC CAATCTTTTCACGTCCACTCTTTTCACGCCCACTCTTTTCACGCCCACTC TTTTTCTGAATACGATATAAGGtattgaaacttttcaaaaaaaaatttat atatttttctcttaCAGGTGACAAAACGAACCGTTATCTAGTGGAGTTTA CGGATGGATCCAAGAAGAGAGTGACGCCCAGCCGGATCCGTATACTTTCT CAATACGGAAGTGCAGAAACGAGTGAAGAAAATGCTGACATTATCACAAC AAGACAGGAGGAACTAGTTCTCGATGTGCAAGGTCTGTTCTTtgttcata acttattttctctTTCAAAAATACCTTTTAAACTATCGCACCTCTATCAC AGTGttcaaaagaatgaaaaagctTTATAACAACTATCACCAATTGGTTT TGCAATAgcagaacttattttggcgggaactaattttggcgaatttggtg aatttagacaaaattcaaattagttcccgccaaaattaaatattttgcgc actcgtcaaaaaagttttcgccaaaattaatttttttggtattttgccta gataacttcttgagttcacaaaagaagcttcaaataaggcaaaatagaac agatttacgctgtcattcgccaaaattagttcccgccaaaattaaaaaaa ttcatcaatcgccataataagttctcgccaaaattaaaaattttcaggac TTTTGCCGCTcatcaaaattagttcccgccaaaataagttcccttaaggt atatcaACTATCACCAATTGGTTTTGCAAGGGCGGAAAATTCCATCATTT AGTGTTTTCGAGGCGCCTTTGTGGAAAACACGCTTTACAGACAAGTTCTA AGCGATCGGGTAGTTTTAGGCTTTGCCATCCAAGAATGTATCGTTTGTAA TTGTACCGATAGAAAGATTGGGAACACTTGAAAATAGTTTTTAGTACAAG GATAACACCTGTAATCACGGAGGGGTCGAACAACGTCTTACATTTGTATT TACGGGTATTTTCCATacatcaaaattttccaaagataCTCTCAGTTTAG CTGGATTCAAAAATAGTAATTACCAAAATGTGACGCAGCCCAATTTacga agaaaaatttttttggctgcTGGATCCGGAATTGTCCCGGAAATAGTGTT GTTTTCCGGGGATTTTCCCATTAGTTTTtgccaggtaggtccataaaagt atcatttGTTTATTATGAACTTATGTTTAGCCAgttaggtccataaaagt atcatttGTTACTTTAGGTATCTCATTACGTGTGGAAGGTTACTTGGGAG GCGTGTTGACACCCATGCTCAAAATGGATTCCAAAATCACAGCTAACTTG AAGGATTGGTCAAGCCAAATGAATGCACACGCTACTGTATCATTAGAAGC CAGTTATTATAACGAAAACGTTGCCGAATGGGAGCCAGTTATTGAACCTT TGATGGAGAAACGGAGGGAAAGACCGTGGCAACTCTCTGTCAATGTAAGC TATCCATATAGGTCTTGCAGTTTTTGAGTATGCTCTCCCTTACACATGAA ACTTGTTAAGCGAATTTTTGGTTTCAACTTTGAAGCTTATAATTATAAGA AGAATGTCACTTTGAAATGAAGCGTTTAACAACACTTAGCTCTTAATCTT TGTTTTAAATTCTAAAGAGAATACTCGGTTTATCAGGTATCAAATTGAAC Tgacaataccttatcggggaaaaattaagatctaaattttttacaccttt attatccgaaattagtgctttaaacgtcgaattacaagatcttttttcga gctagtgaaggaaaccatttcatttggacaatttagttggtgaaagtgac taaattgtaaatttcgtcggggaaaagtgacgaatttgaaattttgatcg ggggaaagtgacgaaaatgcccctaggtgacgaaatttttccccgtcgaa aaaaaaccccgactaaataaaactccgacatttttttccccgataaggta tcacATTTTATTAGATTGTCTGCCACTGAGAATTCTCATATGAAAAACAA GGTTTTTTGtcaatcaattttgtaaatgaagattCTCGAAGAGTGATCTA TGTCTCATCGATGACTGTAGAGTTACATACATtgaactctctctaattcg aacttctataattcgaatcttcctACGATTCGAACCTTATTTTTAGTCCC TGTTAAAAAAGAACATTCCTAAAATgccttctataattcgaatctctctg taatggatttcccgttcgagttcgatTTAGCGAGGGTTCAATCgtcaaaa tttactttcttcaaaaattaaattatagtACAGCCTGttttaccattttc tctaaTAAGTACAATGTTTGTATGATTTTCTATGTCATCATAAGAAATAA ATCTTCATTAAAGATAGGCTGCGTGCATCCCCGAAATTGACCCCGTCCGG TAACCtgcttcaattttctttaaaagtttcAGAAATCCATTTCTCATAAA AACTTACTAATCAATTTTGTACACAAATACGGGNgaacttctataattcg aatcttcctACAATTCGAACCTTATTTTCAGTCCCTGTTAAAAAAGAACA TTCCTAAAATgccttctataattcgaatctctctgtaatggatttcccgt tcgagttcgatTTAGCGAGGGTTCAACTCATCAAAATTtactttcttcaa aaattaaattatagtGCAGCCTGTTTTACCATTTTCTGTAATAAGTACAA TATTTGTATGATTTTCTATGTCATAATAAGAAATAGATCTTCATTAAAGA TAGGCTGCGTGCATCCCCGAAATTGACCCCGTCCGGTAACCtgcttcaat tttctttaaaagtttcagaaatccatttctcataaaaaacttACTAATCA ATTTTGTACACAAATACGGGGGTAACTCACGGACGGGGATGTTATGCACG ATATGCTTCCATTTTACCAAAACAGGGGATGCGCGCAGCCTTCATTAGCT ACAAAGGGTGTCGTATGTTTATATATCAAATGAATCAAAGAAGTTGAAAA tgattgtcaacaacaacaaagtgcTCTACCAGAAGGAGCtttataacaaa acaaaaattcaaaacttcatttttgtgtagtactttaagtttcatgcgta caatcatcagctacatacaaaattatttcaatCTCTATATCAAATGTAGA AATCTTCTCACTCTCTTTCCACGCAGTACACGATGGAAGGTGACGACAAT TCTGCTTCATCCACTTCCAACGAACTCGTTTTACAAAAACCGGAATCCAA CCTGAAAATCAAATCTCAAGATAATCTTGAATTGACAATTTCAAAATCAT GTCTTGCTTTACTCGGTGAATTGGGACAGGTACAGTATACTTTTCTTTGT CGTTTCATTAGATTCTGATGCGTTGTCTGTTTTGATAAAGACTCTACTGT ATATGGATACCTTCTTGAACacccatttttataaaaatacactctaaaaa aatattcatgataaaaTTGAACTGTCAACATCATAAAATTTgcaactgaa cctaaaaatGCCTTTTTAAGAGCCTTGTTTGCCTGTAAATGGCCTGTAAA TCCCCCAATCAATGCTCaagacaaaaaaatatattgttgCTTGATTAATG GCTGTGTTACATGTTAAATTGAGGTTAATTTTAAATCCTAACCTAACAAT ACTATTGTGAATATTTGAAGGTTGATTTTTATCAAGCAGCTAAATATTAT CCATTAGTCaatgaaaaacaccattcttattttaaaaagcgtgtatttga gTCTTCAACAACTATTTTAGacatacaccttttcgaccgtagccgccgcC TATTGCCGTACGggtattttttgtccgctttaccaccctaaaagcgtccc agtctttttttcgcccCTAAAGAcaatataaaaaagtgtaaaaaaaggat tggatcgagttcaTGATGATAAAACGGACAttaaaatgcccgcgcggcaa ttagcggctacggtcgaaaaggtgttttGAAAGATATTCTTTAACTTTAT TTGTTATCTTTCAAAAGCTCTCCGTTTTCCATTCGAATTATGTATGGATT AACACAAATCACTTGCCTTACTGTGCAGTTCTATGTCCGATATACAGTGT GTCCCTAAAAAGGCGGACATAAGCCACGTGTCCACTCCGGAAAGTTTGCA ACAGACTGGTACGGATTGGAAAGCAGAAGAAAAGCGATCTTCCACTTCGG ATTTTTTAAAAGTAGATTCTTTCTGTTTACAACTTTCCATATAAAAGAAA TCGAATTATTTTAATTTCCTtcagttgtttttttatttcaaaacgaAAGA ACCGTTTCCATCCGGCCCGGAtcgcaaaaaaatcttttttcgatcCGTTT TGATCTTAACACGTGAACAATTGAACTGTCCAcgtgaaaaaaaatatgtg ggTCTAAGATAATCCTTAGAACATTAGAAAACGTTCCAATCCGTACCGAT CTGTTGCAAACTTTCCGGAGTGGACACATGGCTTAAAGTAAAAATTGATT TATGCGAAATCTTATGACTTGAATACTTAGGGTACTTAATATTTCAATCC ccaaaacctattcaatcatcttgggaattgaatatctattgattgaacaa AGAATTGTAATGTTAATTAATTATTGTAAGccagtttttggacctacccc gctggaggttctataaattaacctctgttcgttaccaatttttctcgaga ttggctcattagtttttcctgatttttggcacaatgatgcaaaatggtaa tgcccaaaatgtgacggagcccgattttcgaaaaaaaaatatatatgggc aaatttgggccaaaaactgcctaaaaatagggttttttagactttgtgca aaatcctgtcattacttttttctgaatttttgtacaaagatggagNNgaa gtggtttttcctggaaaattcttattcgccttaaaagatggattttcgta ttttggggaaattccctttaaccaaataagaaaatataacttttctcaat gttgactcattatttttttctgattttttgcccagtgatgcaaaatgaca atacctaaaatgtggcgAAGCCctgttttcaaaaaacatttttttccggc cgaaaatgccggaaatatgcccgaaaaactggtttttcgcattttctcaa gattttatcattggttttttctgattttttgctcaaagatgcgtattaac aatgcccaaaacatggccgagttcgatttttgaaaaaaaattttttccgg ttgaaaatgccggaaatcacagtgtttttcattggattttttccttatat tcatttctatgttttttacacaaaaacatcattgataacaatgctcacca tcaagcatgattcaattgtcaataaaactgatttttgcgaccggaacttt ctatttattttttccctacaacccttccctgtCCCCCCATcgacaatcaa tgatgaatttattgcgttatgcattttcgctaaacgctatattttctgac tgattttttttcatttttctcctcgcattgctatctaactttcatcatca ggtaggtccattcagcatctagcttgttttacttgattttttgaaatttt tctcaaaaatttataatttttgaccaatctttcgaaaattcttTCACCAT CAACCAAGATGAAGAAGATTCTTCGCAGTAGCCGAGTCCATCCACCATCA CCATCACCCTCTGCATCTGGCGAGCTCAATACAAGCATAGAAGAAATTCA AACATGCCGACCATCGCATTGCATCACAGATCGTAAAAAGNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNATCGGAGGGAAAAGTGATTGATAGTA TCTATTTTGATTTCGCAAAGGCCTTTGACACTGTACCTCATCGTCGTTTA TGCCAGAAACTATTAGCATACGTCATAGATGGTCCGATAATGTCTTgggt aaaatcatttttaaatggaCGAACCCAATCAGTGAaattaaataaatcat tttcgACAACGGATCACGTGGTTAGTGGTATCCCACAGGGTAGTGTCCTT GGACCGTTATTGTTCGTTCTTTACATCAACGATCTTCCTGAAAGANNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNAAAGAGTGATATCATCATTTATACTcctttttgctgatgacacca AAATCTTCCAAGAGGTCAACACTATCGAAGACTCTATTTCCATCCAACAG GATATAGATGCGCTAGTTAAGTGGTCGAAAGAATGGTTATTAAATTTCCA TCCCGACAAATGTCACGTACTAAGTATTGGCAAATTCTCTGACATCAAAC ATGCCTATCCATATTGTTTGGATGGAAATCAgcttgaacatgtttttgaa gagaaaGATCTTGGGATTGTGATCGANNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCTTA CATTCGAGGAGCATATTGCAAAGCAGGTAAAGAAGGCAAATTCAATACTA GGAGTGATTAACAGGAGCTTTGAACATCTGAATCCATCCATCTTCCTAGT ACTGTATACTTCGTTTGTCCGTCCGCACTTGGAGTATGCTCAGTCGGTAT GGTCACCTAAACTTCGAACATATGTTAATTTGATCGAGGGTGTACAAAGA CGCGCCACAAAACTCGTGCCTATCTGCAAAAATATGTCCTATGAAGAACG TTTGCGCATACTTGACCTCCCCACGCTTGAATTCAGGAGACTCTTTTGTG ATATGGTCCAAGTATACAAACATCTCCACTACTACGATAAAAATACTCTT CCAAGTAAATTATCGACTCGAACACGTCCGAACAGGAGACACAAAGATGA GCTGATACCAAATTTTGGTAAAGATGGATTCCGAGGCGCACAAACCAACT CGTTCTTTTACAGGAGTATACCAAACTGGAATAGATTACCAAGATACGTT GTAGAGGCAAAGACtgtcaaaatctttaaagaaagactcaacgaagcttg gaaaaaacatccgaaaagattcgagacaagacaattgtaatcaagatccg gttctcagaggccctcgtgtgccttgaacttgtatacattattgtattgt attgtatttaTATAAAATTCGTTTTTTGGGACACGTTGTATTTCGCTAAA GAACGGAAATGAGCGATTCGACATATTTTCATTCGTTTTTCATTTGCAGG TGTTTGGAGATGCAGTAGAATCTGTGGACGTTTTACCACAAGTCCTGGTC GAAAAAGAACCTTTCATGATCGAAAACTTGGTATGTATATAATATTACTC CGGGGGGGatggcacttaggcaaaattagcCACTTTTCAGGGTTAAAATG GGAAAATTCTTCGTTTTTTCgttctgaaagggtcccaaatttaccaaaca ttcaaacttttcaaatccaccggcacgtccccgtaccggtcgtcaaggtc agtgccacCCCCAGGGTATTACTCTCTTCAACGGGaaagaaaataatcag atatgAAACTATACAGCTGACACTCTCTGAATGAGTAGTAAACTGTTCAA ATTACAGAACATGTTTTATATAAAAGCTTATCCTTCAATTAGTTTGAAGT TTAGAAAGGTTTGAATGGTAAAAGTTCCCATTGTTTTACCTCTTGGTAAA ATTGAAGATAATATCAATTTATGGACAGTGTTTAGATatttgttatttgt taagtttagCATTGAATCTTGACTAATCCATAAATATAATATGTTACGTT CGCTTCAAGAATGGCTAAAGCTTGAAACTGTGAAATATTTTGTCATATTT GATTTCCTGAACTATTTGATTTTATCTTTTCAGCTCTCCAAGAAGGTGAC AGTAACATTGAATGAACTTCTGCAGGTAtgacactttcactttcactttc acttttctCTGCCTTCTTGAAAGCCAATACAAAAATGTTGTcaatgcaat ggcttctttcaatctttttcaagcaaagattttaactaccagctttgtgc ccactttttgcctactctaacaattagaataggcagagcacaaagtcggc cgtctaaactagagcttaatAATTNTTTTAACTaccaactttgtgcccac tttttgcctactctaacaattagaataggcagagCAGAAAgttggccgtc taaactagagcttaatCGCGCAATTAAACTTTATACGGCACATAATATAA AGCAGCGATGGCCATGTGGTCTAAGACGTCAGCGTTAAGAGGTTCATGGC TGGAATGTTTTATTCAGCTCTTAGATAACCGACCTTGGACCCtgtgaaaa caattgaaaaccTGTCTGAAACGTCCCAGACTTCACTGGGCCATCCACGT AAaaattcgattctttttatacCATCCACATCATCTGAATTTTgacataa cttttttttatctaaagtttccaattttccattttAAGTTTTATATTGGA TTAAATACTTTTATTTCATTCTTCTCTTTAAGGGACCAAATGGAGATTCG ACAATCGAGCTAGCATCTTCTTCGAATCCTGTTGGCATTACTTTTGCTCC CAagaaatttgagaaacgaaAGACCAACGATCTATACACAATCAATTTAt cggtattataaaaaaatcgagaaatttcaaattaactTTATGATTTATTG CATGCTCAGGCTTCTTTGACAGTTGTATTATTACGCATGTCGAGAACTAA TAGGtatgaataacttttgatataaatGTCCCGTAATAATGAAACTTTTG ggagttgatgacgtcatcatacaGATTCGTCTAATACGATATTAAAGGGG TGCAGATTTTTATCGTTCTTATCGTCATTAGCGAGTTGAtatattcgaga taaatcgaaggagacggtataaagcaaagttgacatgtcgccgaaatcgc cgtccactttgctcagAGACGGTGAAAAAAAtgccgtcgtctgtttaggt cagtaaaggcgatatagagccgtacatcaattatcgactttgttttgcat CGACTTCATTTACCGTCGCGCttgatatcctccgatacaacAACTTGATA TTTCTTTTAGGTGGACGGTTTTCATGACATTAAAGACATTGTGGTTCAAA GAAAGCGAAGCGTTATCTATGATCTTGTACCAATAAAAGTACGTAGAAAA CATATTGAAAcagggggtcggtactaaaatcttgAACACCATGATGTTTA GTGACGTGCGTGGTGGTATAcccaaatatcttaaaaatcattttactACC ACAGGGTACtattaaaataccaaaaaggtggtatcgagactaaaatttga gaaatgttTTAGTACTTTggtattattttttgatttttgcaaaaattttc gtgattttccggaattctttagaattttttaaaaagaagttagaattttt ttcattttaagaaaatttcctAAGCTTACTTATTTTTGCATTCAGTTAAA TGTTTGCTCGATTCGTAAAGCAGCATTATTTAAAGGTAtcactttttgca aaaatcagtacttttgagaaaaatggtcCTGAGAAGACTGAAATTCGGTG GTCCCTGTGCCAAAATGTCCCCAAAACTTTTTGATGCatgggtactaaaa taccacttctcTAAAATGGGCTGGTAGtatgcaaaaaattcttgaattaA CCCTTTTcgtactcatatatgtctgagattttagtactgacccccccctg atTCAAAAACCGTCCTATTTTTATGGTTTTAAGTTATTGCTCATCGGCAC TGTATGAAAAGTCGCGATTATCGTCAAATCGTGTCGTTAAGAATTGTGTC ATCAATCCGCGTCTTCTGTCGCCTACACCCGAAACCGCGAATGTTAGTTT CCGTGAAAGTTAGTGAATTTTCGATTACCCTATTCTTGTTCTCGTGTTCA GCTATTATCAGCACAGTCTTCATATTCGATAGTGGTACAAGTGAAGACAA CAGACGGACAACGTATCATCGTACTCCGATCACCATTGCAGGTTTGTTTG TGTTTTGCTTCCTTTAATCTAAGATCCTTCATCCATACTTTGCTTCCCGA TTTGtagtgaatattttttgacaataGTGAGTTTATGTGTCTTAATTTCA ACGATGGGGTCAGTTGAAACATCCCACAGATTGATAATTTCTTCTAGATC TTAGATGCCTGAGGTTCGAATCACGCTCAATTCCAGTTGTCACGGCTGGC TGTCCGTGATCCTCATGAGTATCATCGAAAGACTGTTGTGAAATAAAAAC TCTATCTAATATTGTCTGCTCAAAACTTGTTACGGTTGAACTCTTGGGTG GTACAATATCATGTTTCCAGTATAACCTTTGTAAATTTTATTCTCAATAC TTTTTTTCGCACTTTCAGTTGAAAAATCACTTTCCAATGCCGTTGGATGT CAGCTACATTTCCAAAGAAAACCAACCAGTTAAACTGACAACAGTGGGAT CGGGAGATATCTATTCCTTCCCTTTGTTGTTAACCTACCACAGTGTTTTT CATCTCAAACCTGCTGGTTTCGAGTAAGTCTCCATCGAGTTTAAAGCCGA AAGCTAGAGAGAAGTCTTCAACCTTtcttaagcaagaaaaagtgaagcct taagatttaCGCCGCTTTTGAAATGACGGATTGAACCTAGccctttgttt gttttcaccGGGCACATCCCGGCCAtagattttaatttcaatccGGCGTT CGTCCAAGAGTTTCATTTCTAGTCCCTTCGGGGATTTAGACTCGATATGC TTTAAACTAGTTATGGGTAGTTACTAAACAAACGATTTGATGAGTCGATT GCGTTTCTTTAACAGTACTATACTATAAGCCTGATTTTAGGAGAGCCGCA AATGAAAGCTTTTACCAGCAAAAATGGACTGAAAAAAGATTCTATATTCC ATTTCTCTCGTTTGTTACACTAATGTTTTTCCTTCTCATTGACCCCCTAT AATTGACACCAAAAATGcgaaatttagattttgataGTTTTCATACTTGT TCCATAGCTACGGTGATTGCACAGAAGCTCTCAATTGGAGTGATTTGAAG ACGAGCAACGAAAAACAGTTCTCCTGCCCTTCACCTGACAAAAGTGCTGA CCCTTTCTACATGCAGGTAGTATTCTCCCGCCATCAAAtatatttgataa tttttcttttactaCTGTAGATCCCTGTAATTCTaaacattcattcattc attctttcattcattcattcattcattcattcgtcCGTGTATTTCTTATA TTTGTGCAGGTGGTGATGAAAGAGGAGACGTACTCTTCCGTACACGGCAT GTTGGACTGTGTACCACGTTACACGTTGGAGTGCTTTCCCGTCATCACGC TGCATAATTACCTACCTTGCACTATTAATTATAAGATCAAGGTGATTCTA ATATTATTTCAGAAAGTATTTTCTTTTAATGCATTTTTCTCATACAATGT TTAAAGTTATTCTGtctttgacggattttcgtctcaaTGACGTAAATAAA AAGGCTTTTTGTGTCGAAGTTCACCaaaatttcaccaaaattcaataATG TGCTAATTtactgtgtaaaatccattttccggcTCAGagaaaagattttg ctttgatCATATAATTAGTATCACCCGAAAAGCTGATAGTTGTCTCTATT ACtaaaaaaaaaactggaaaaatcttTCGCTTAGCCAGTAAAGCCCTGTA CTTAAGTTGTACTCGTCTACTCCCTATCTCACAGCCCTTGTGGAGTTTTA GGTGGGAATTCAAATCTTGGCATATTTCTTTTACAGCTTTTTCTTCTTTA GTCTTTCTTCATATTGTGCTAATATAATAAAATGTCTATTTATTTCCTAA GGGTATGGCGAAATCGGAAAGTCTACCAGGCGGACACAATTGGCCTTTGT TTACCGTCAACTTCAGTGATAAACCTTCCATCTATATCGAGGTAAAAGAG CTTCATTAGTTTACACTATAGCTGACtgataaaaaaacatatttgaTCTT TAAGCAATTTAACAGACACTTTACAGACCTCAAATGGCAAGCTACAAACA AGAAATCCTGATTGAAAAACttctttcctttctttttcCTGATCTTTGAA ACAAAAGTCTTCACAAGTTAAAGCTCAGATATTCATAAGACAATTAAGTT TGTGAATGCGTAAAGATATCCTATAAATTGTTTATACCTTTACCCTTTTG TTGGGTACGCGTTATAAATTATCATAACTACGATGTGATTCGGGGTACTA GGGTTTCAAGCTGATAGGTTTTGCCGCCCGACTTTTGACACTTGGACTtt tagcgggactaaaaaggaggaaattttgtgaatttagCGACTCTTAGTGG GACCAATTTGATCAAAGTTGAAATTTCCCATCCTCTACCCTTAGTTGGAC TGAGATTTAAATTTCTGActttccaacccttacagggacAGGTTTCAAGA AAAGCATATACCCATACCCTTCACTTGCTTAGGTAGCCCCCGGGGATCTC TTCAACGTTAGGGAATAtaagtttttttcttgaaagacaattttcttttg atatttggctCCAATTTGATTTACGGAGAACTTTCCCATCACGCGTATTC AGATTATTgatgtttcattttcattgtgTACAGATTGAGTCGTATAACAA CCAAAGATGGGAAGGAGGTTTGACATTACCAACAAAACCGGTAGATTCTT TGAACAAACCATCATTATCTTTCGTCATGATGTCTGGTGAACGCAAAATG GTAGGAAAATTATTTAATCAAGGAAACAATCAACTATGTCATTCTAATCT CTCTATGATTTAGCTTGAACTTGAACAGCTATTTACTGATTTCAATTTCT GTTTTAATTCGGAAAAAAATTACTTATATTCTAATATAGTTTGATCTCAT ATAAAGGTGTACTTGAAGTCTTTCGTCCTACGCCAGAGTTATAGTTATGG AGACTTTACTGTTGTTATATTTACGCAGAGGTGAAAGTGCGTAGGCCTTG TTCTCTAGTGGTTCACGTCGGATTAACGTGCTTAAATCCAAAAGCTGTGT GTCCACATTGGCTGTATAAATCATAACAAATCTCGAGAAAACTCTTAAAA GCACGTCATCACATTCTGGGTTTCCTCTGAAAAGGAGAAGCACGTCACCA TCATCATTTACGatctatttttcatttgataCAGGAATTGGGTGTTTATT ACCAGTTAGACGGTTCATTGAACATCACCTTATATTCGCCTTACTGGCTT CTCAATAAAACTGGAAAACCACTTGTCTATCAGGTAACTTTTGTATGAAA GCTTTTTGAGAGATGAAAATTTGTTTGTAAAGAATTAACTAGTAATGGGT AAGGGTACATGATTTTCAAGAtaagtcaactctctctaattcgaatctct attactcgaatctttctgtaattttaGCTAAGATATTGGTCCTGCTCTCA GCTGTAAAGTGGTTtgaattactctctgtaattcgaatctttctctagtt cgaataagatttttggccccttgaagatcgaatttgAAAGAGTTAACTCT GcttaaattttttccaaaaatgtaatGTTTTAAAGAAGACATTTCTACGT TAAAACTGTGTACAAATTCCTAGGTGTTTCAGGCAAAACTTGGTTAGTTG AAAAAAGAACCCTCtactcaaaaaataaaaatcctttTTGATTGGACAAT GCGGGACAAAGGTAGTGTTCTACGAAagtcaaaaaaacaataaattaatt tggtctctcctaaaaaacaaactattagatatgcaccattgcaatgtctt ctgacattacatcacggacccaatagctgattggttgtaagtgacgtcaa atcagtcaatacgtcactttcaaccaatcagctgtttggtCTCGCCTAAA AAAACAACTATAAACTATATAAATGTAGTGAGTTAGTAGAGCAGTTTTAA AGTTGGAATTATTTTCTCTAAATTGTTTGCAGCCAGCGGGGAGCAGCATC CAGCAAGTTCACCAAGAGAACGATGTAAATGCTCTTATGATGCTCGTCAA AGGGAAACATAAAAAGGTAAGCGGAATGTGCCAACGTTTTTCTTTGTTAT GATTTACTCTTCAAGGAAAAAAGATCTGATTATGTCGAGTGGAAAACGAA TACTATGATTGAACTAtctaaaagattttgtttactaAACAAATACAATT AATCTTTAGTGAGTAAAACCATCTTAATCTGTCTTCATAAATTTCTGATG TCTCGCTGGACGCAACTGAAGATAggatttttagacttttttgagaGAGG CCCGTGAATTAGGCCTTGCGAAAGTTATTAATAACACATTTCCTTAAAGC CAAAATATCAGTTTTCTAGGCTCTAGGAGTTATACAATAATACAATGTTC TTCTTGNTTAAGCCAAAATATCAGTTTTCTAGACTCTAGGAGTTCTAATA ATACAATGTTCTTCTCACaggcgaaagtgaaagtgaaaaataGCGAGTCA TGGTCAAATGAATTTTCATTGGATACTGTTGGCAGTGGTGGTTCCTTGAA ATGCAATGGTCCAAGAGATCGAGTTTATGAGGTATATTTATATTATTCCT CACTGGGTGTGACGCAAAAAGCTCCTCCCTTTCATAATGCAACCTTCTTG GATGTTATGAACTAATTCTTTTATACAGTATCTATTCTGGAAAGAGGAAG GGTAAAAttagacttttttgaaaactttttgtaaCGCACCCGGTAGAAAA ATTGTCAACTTGTTCGTGGTCTTTGCAAATAAATGAAATCTAGACGTTCT CTACACATAGTTCGTTCTTGGTATGAACTTCTAACTGGAGTCTCTCTTAA TAGTTTCCCTCCCCTTTATTTTAGATTGGTTTGAACATCAGTTTGTCATA CTTTGGATTGACGAAGATTGTGACGTTCACGCCACTCCGAATGTTATCTA ACCACACCAAGGTATTAACGCACTTCTCTCATCTATCTCGAAGATCATCT GATATTATCTTGACCCTAATCTAAAACAAAGCCGAAGCGGCATGGAGGTC CAATAGCATAACAATAGTCGATTGTTTGTTCACAATGGGTACACTTCGTG CCAGAAGGTGCCGTTtgttccaaaatgaacttgaattgacagaGCACCTT TTCTTCAAACACGGGCATATAGTGCCACGGACAGCGATAtgctaacccta accctaactaagGCTCGATACTGAGCCAGAAaggtcaaaatttttaaata ttttatagAACCTAGTATTATATGAAAGTCCTTCACAGAGCTTTCAAGTT CGGGTCATTCATTCCCTTAATATGCCTTCAGGATTAATTTCCTCCCTTTT ACTTTTTGAGAGCCCAGTCGAATTGCTCAGAGATGGTGGAAGTTAACACA TTTTGAGAAAAACCTTGATGCTCTCTGTACTTTACACATTATTCATTGAA CGAGTACACCCCTATTGAAATTTATTCTTGCGTGAAGTTGGCCTCATGAT TTTGAACCCTTATTATAACAACAGtgttaaaagcttttcagtATCCAACG TCTAGGGGGAGTATATAAAGATGTTTTTCCGTCTCAAAACTCTGCataat tttctttggaaaacaCGTTTTTCTTCTCAGTCGGAAAGCCTTTCTCTGAC GGTTGTTAAATCAAAGTCTTTTCATTTTCGTATCCAGTACACCATCAGTA TGGCAGAAAGTAATTCTAAATCGTCAGAATGGCACACGGTAAACCCTGAC GAGGTAAGTCAAATGCCTCAAAAAACAACATTATAAATTTCACTCGTATC TTTGCATACAAATTTGCCCTTATTTGGCTATTCCAAAAAACAATTTACCC CCGAATATGTTGGGGAGGTCAATCTTATACGAACCCCCTAAAATTGTCAC AACATCACATACATCAACCCTGGAATTTCAATAGATTTTTTTAGGTATCT CCGTGTATTTTCGTCTAATGTTTGAGACCTCCCCTGAACAGTTACCTGTT TTTAAGGAATTTAGATTTTCAGCAAATTTCACTGACCTTCTTGGATCTCC AAGGTCTTTTGAGTGTAACCATTGGACGGACGATATAAATTTCTCAGCAT GGGGGTAAAAATCTGTATTTGGAATACCCCTTTTGCTTTAATTTGGCATC ATAGAAGAGTTCTAGAAAAATTCGTGTTTTcataatttaagaacattcca tTCTGGCCGACGAAACTTCCTTTGGTCAACCTTTACATTAACATCAATGG GCAAGATTCAGTGAAATTCAACCCTGAAGTTGGAAAAACTTTACTGTTGA AGTTCCAGAATGAGGTACTTTCctttcaaaattgtcatttagaTTTCTTA TCTTTCGCAGATACCCTAGTTGACTTGAAACAAACTCCCTAAAGGGTAAA ACGAGCAGTATTTTCATTGCTGCATTAAAGATTACCTGTTCAACGTTAAA ATTTGACTGGGACATTCCCTTTGGTTTCAAACTTCGCGCCCCTTGGGTAG GCTGATGGCATCCTAACTAACGGGTTCATGTTCTTctactacctgcggtt ttgtaggtctgcgattcagactacggCCTACCTAATGAATACCATCAGCA AACACatcttttcttgtttttctgCAGGTTGGAGGAGTTTGCGTGGATTA CCAAGAAAAGGACTCGTCCTCAGTCCTTTCGTTTAATCCGTACTTCGCAG GTGCAGCTCCTGTGCGGCttgaaaatctttgcaaaaaGATCGGCATGATC GCTTATAAACAAGCGTGAGTAATTTTTTCGTTTATGTGTTCATGCAAAGA AATTTCACCTGAGACTAAACCACATGACACGGCACGAGTTAAATGTAAAC GTAAATGATTAAAGAAAAAGCTCTGGCGAAAATTAGAAGTTAAGAAGATT CGATTTAAGTTAAGTTCTGGTAAAATATTTGAACAAATTGTGCTCACCGT GCGTTTTCGAGTTCTGGATATTCCACTCTAACAAATTTCGAACGGAAACA TTTTGTTCACTTTGTCCTTCTCTTTCTAACAGAGGTTCGGTAATGGGTCA CGTGTTAACACATGACCAATCAGTGTTGTACACGTGGGATGATCCAACCA TGGAACAAGAATTGATTTGTTCCATTGTCAATGATGAAGCCAGTGAAACA AGGATCAAACTCGATGCCGTAAGAATGAACATGTCTAACttacacacaac gttgtttcaacgttcatctaatgttcgtGACATCCACATACACAGtagtt agatgaacgttgaaacaacgttgtgttcaTGATTTGAAAagtattgtttt catttaacttTCGCAAACGTTTCTCATTTTTAAATGAATCTTCAAGCAAG GATTAAAAGGCCACATAAGAGTAGTGTTGCATTATGGATGGTCaattatt ttatgaaattttactCGCATAATTTAGTGCTAGCGAATACCAGTCTAATT TTTAAGATTCCAACACTGTTGTAATTACTACAAAGTAGGTTTTACTGAAC AACATAAGAAAACATCAATCTTCGACAAAACTCTGAAACCGTTGACCGAA ATTGTAATGTCTGAAAAAATTCATtgtaatagatcttatcggagtttttg atttttctaaaaaagtgatgcattgtgggattgtttcgggaatatcacaa tagaattccctcaaggaattcctaagagatttctattataatactcccga aacaatcccacaatgcatcgcttttttagaaaaatcgaaaactccgataa ggtctattagtTAGTTCTTCTCTTTGATTGTTTTACAGAACGATTTCGGA CGAATGAGAGTTGGAGATGGTGCAATTTATTGGGTTTCCTTTCTGGATGG TCTTCAACGTGTTCTATTGTTCACTGATAACTTCAAATCTGCTTACTGCG CATGTCAGGTAATCGCAGGAAATGATTTGGAAGTTTTTATCTTCTCTTCG TAGAGTGCTCGATAAATTGGTAAAGCATTCATATATAAGAGTTGACGAAA TTCTTATTTCAGAGTTAAGTCAACTCTTATAtatcggacggaggatcgag agaaaaataccattagatgctagaaatttcccANNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTTTATCACCTATTCag cctgaaaaccatcccaAACCGTGATCTATAGGTACATAGGAAGCTAAAAA ACCATGGTTCACAAAGTTCCGTTCAAGGTGGGTTTCTGGCCATTTTTTCC TGGACTAATATATGTAGTCTATGAATGAGTTGTACTGTGCATAGCAAAAC ATATGGCAAAACACTTGCGCACACTGGAAAGTTCCTCCAAAGAAAATACG GGGCATCTCAAAAATGATTAGACAAAAACAACGGTACTGTTAATGTATAA AGTCGAATGTGAACAAATGTTTTCCTCTTTTGAAAACTAATTAGGTTCGA CTGACTAAGCGTAAAAAGTGTAATTATCATAGTAaacaatttgttttttt ctttaggaGCAAAATTTACGCCCAACCATGGAAGTTGACTTTGAGATTGA GAGTTTTGGTTTGTCTCTGGTCAATGTTGATAAGAGAATGGAGATTGGCT ACTTAGCTATCCGACAGTAAGTATAAAGTAGAAACATATCAGAAAGAAAA ACAgttaatattaattaaaatcCTTCTTTGTATATTACTCGAATTCAAAT CATTATTGACACCATTAAAACAGCCGTTGGTAATGGCAGTAATCGGGAAA AAGTTGCTCGAAGAGTTTCGGAGAAACAACTGACAAAACTggcaaaatgt cacaaattttcCTTTATTTCTCATCTTAGATATTGATTCGAAGATAGGGT GCTGTCACGGGGCTGTCACTTTTAGTAGGGTGACCTTTAGGATCCGTAGC ATCTTTTTTGGGTGCAACCGCGTATGATTAGTTCGAAAGTTCCAATTTAG TTCAAACCCCTGAACATGCGAATGCTACCTCCCCTGGGTACTTCAAATGA TGTTTGTGACTACTCATTATAGAAGCAAGACTGTATGGGAGCAACGCAAG AAAAAGAACCGCTGGAAAGCTTTACCGCTTGCCATGTGTGAAGCTCTCGA AGAAGGTTATCTCAATTATCAAAACAGAAAAGGTGCAGTCAAAGAGAAAG TTCTGGATAAGGAGGTAGGTTTGTATCTCTAGTCTCACTTGATGGTTTCA TTGATAAAATGTTTAGTGTATGCGGACAAAGATGTTGTATATGTGAGGTT TGCTACAGATAGgatttataaaattatcatgAGACACAGTTGActttcga actcgaacggggggggggtcttaTTTGTTAGATTTGCTGAGAGTTTCGAA TTAGAAACTATTTTAAGAAGAATTTTCCTGACGGGGATTGGaaatttagt tcgaattatagaaagactCGAATATTAGAAAtttgaataagcgagagtct actgtacTTATTAAAAGATCAATAAAGAGGATGAGATGTGCAAACATTGG AAAGCAAGGTGCAAAAAAGATGTCatttctaaattcaaatttcgatCATT ACCTTTATTGTTAGGTGGATTACGAGAAGATGTTTATTACGAAACCTGAG AAGATTAAGATCAGAAGAACGTACCACAGCGGTCTTGGTTTCAAATACAC AATCTCACCCAATGAAATGCGTGTGCATGCTTCTATCAGCTCAATACAGG TCAGTTTACCGAACGAAATGTCTAGCATTGGGTCATTCCATTTTACATCT ATACAGGGGGGTTGGACAAATATTTCCAGGGGATAATGTGAGAAGAATTT CAAAGGGGTCTAAAAGAAGTTTTTGTAATTTCCAGGAACATAATTTAATT TTCCAGGGAGTTAAAATGTTTCTGAAATTTCCAGGGGTAAGAAATTAATT TCAGCTGGTCcacgaaaaagaattttccatttttccatagGGTGGgtata catattttcaagaattatttttagCTTAAAAGGTTCTCCCACCTCTCTGT ATGGCTATTAAGTGGACAACCTAATTTAATTTTCCAGGGAGTTAAAATAA TTATGAAATTTCCAGGGGTAAGAAATTGGTTTCACCTGGTTTCGAAAAGG GTAGTGTACCTACCTCAGATGACGCGGGATTTCATTGTCGCACAGTCTTT TTctatatataaaaacaaattgtTAAAAACAAACTCAATTATGTATAGCC AAAGGCTATAGTCGAAAGTCCTTTTTAGTGTTTGAGGCCGCTTATTTCCT ACATAGGCGTCTCATACTAATAATAGATTGGAAGCAGCATATATGGccag gatttaaaaaaattaaaacatgaaaacaaaTCCGTCTTCTGAAACACTCC TGAAATTTGAAGGACATTTAAGACATAATGTCTTTAAAGTCAAAACTTAC TTTTAAAACCACATAAAACATGAAAATGCTTTTTTGGTCATCCATTATGT AATCAGAAAGATAACTAATTCTGGTTTTACATTTCAGTTGGATAGCCATG TTCCAGGTTCGACCTTTCCAACAGTCTTGCATATGGTTGAACCACCAAAA TCTGTTGCTTCAGAAAACGGTATAATCCTCtttcacagatatcttatatt aGAATACTAGATATAGCTTCTCTCTCCCTGGCTGATACAAAATAAGGTTC CATCTTTCAAAATAGTTCGGTGtcggcaatttgatcaatcaAACATTTCT CTTGCTTTCTGGCTTCCCGCCGTGTCAGTTGTGGATTATGTatgattgaa caaattgccggtaccgaactgtAGTATAATTGGCAATGATGGCGTACTTA AAAAGTGTTTTACATAAGATACCTGTGGCAAAATAACATGTTTTCTACCT TTGCTGGTAAAATGAACAATCATGACAAAGTCTGCTTTCTAAGATTATAT TTCCATATCATATTATTTTTGGGGAGAATCCTTTAGACGCAAGTACTGAA TAATGTTATACACAGTGTCCGGGAAAGAAATATAATATCTTTGATGTGTA TCCGCAAATAGGATTAGAGCGGTTGAATGTCATCATACTTTGATATCTAG TGTTTCGTGTTAACAAAacaccccgggggggggggggcactcgactCAAA AATGACCGTACGTGCTGCCCAAAATGAGagctttgaaatcggacccttac agtacagAGAAAGTTTAGctaaatttgagtaaatttgggtgaaaaatcga cccttgtggtgcgtttttttttttttttgaaaactcttaagggccgcacg tacggtcgGTTGTTTTCTATTGTAACGATTTGCTTTTGTGTTTAGCTCCA AAGCCATTCTttgaattgagtttaatgaCAAGGATCGGTGATAAAAATGT GGTCAATGAAGTcaggtttgtttacaaattttaatCGGAAGAGTGTCCGA AATTGGAGGATCCTCTCGACGAAGTATAcattcatacacgttttttgaag cctttggatgttttaaactttttagttttaaggctaaaaatgttcttaac atgttcttagtTTGAggattttgtgaatatttttgaaagtgtttttgagt ccacaaagccttaaaacttgctcttaacattttggccaacgaagccttgt gttcttatatagttttttcttataaaaaagcgtgtatcgtCTCTTATAGC TCTTGATTTTGATAACATCCGAGTTGATCTTGCTCACTAAACAAGCTTTG ATAGTTTCATACTATTTTTCAGACTATACATAATAAGCTTTTGGGTGCTG TACTTGGCTAAACTTGAAACAATCTCCCCGCGGGAATAATTGCTGTCGAT CGAAACCGTAATAATAGAACCCATTCGTttccgttttttgtttttgggtA AAAGACATTGCGATTTTAAATGTTTCGGCAAAATAACCAGGTCTGATCTT CACATCCGCTGCATTAGAGCAGAGTTGGTAGAAGGATGATTATCCCAACG GTGACCCAACGTGCTTTGTAAACCAGACGCTTGTCCCCTTGTCTTTTCAT TGAGCTTGATCATGCTTCCATTTCTTTTTTAGCTATTGTCACGTGTTGAT TCAAGAGATGGATGTGAGGGTTGATATTGGATTTTTATTGGCTCTGATGG AACTCTTCAGTCATGCAAGAGCTCGAACAACCGAGGTAGATATTGTTTCA caaatgaaagtttttttgtgATGACTATCTTTTCTTCAGTCAGTAAATTC ATatgtaccgggtgtcccagaaaaaaataattctgtAAAAAGATGATGAT TGGATACCCTCGTTTATCgcgtttttttaacttttttgaggaGTATTGTT TTAGCATTATGTCATAACTTCTGATGTAGTTaaccaaatttgataaatga cccctcaaaatttaagttcatccttcctctttccaatgcaaaaagatCGA TTGTTTAACAGTTGTTTGAGAACTCAAGAAAtttcacttcaaagaggggg acttttttcttaatatctgggacacccggtatttCCAATAGCATtgagaa tttattttttccctatgTCGATgattatattttcaattgaCAACCTCGCT TTTTAATGTCTTTAATGTATGTTATAGAAAGAACAATACGCGCTTGATAT TGGCCAAGCAGCAACAAAGTTTGAAGAAAGCGCTGAATTTCAGGTATAAT AGTTCTTTAACCATTTTTTCCACTAATTCAAACATAGTAGAACATTAAGC TAAAATATAATGAAGGGACAAATTGCAGTTTATAAAAGCTGATATTTTTG CATTATCATATAACATCCATATTACTGCATTAAATAGATTATAAGCGACT CCAGTCTACTAAtcgagtaaaattttcaatgttgaaAAGTGTTGATTATT CTACTGattctaaatgttttttattatacAGGCAGCCAAACAAGATCGAT ATTACGTTTTGAACGACTTTCATTTATCACCGCTAAAGgtattgatttca attttttttcaaatacattCGTATTTGATTAACGAGGTGTGGCCGTAGCA TGAatgtagagcatccagctacggtgcgtaACTTTGTGGGCTCAATCCTC AGCCAGGTCATGCCAAAGAATCCCAAAATGGCACTTGTTGCCTTatccta gttaactaagcccgtattcacaaggctaagTAAGACACATGacaagattt tttatatttccgGATTTTGAGTTTGTCTTGGGATACTAGTTATTCAAtta caacttaccatcagattcatcctagtgactgaatcaaactaggtTAGAGC TCTAGGTTGTTGATGTCTCCCTCTCTACTTGATATTCAAGAGATGGATCC AATGGAATACGGTGGCACCCTCCTCTCACCTTCAGGTAGACAGCTATAAA AAATGGAGCCTTTGGATCGCCCCTGCCTGCGGTCACAAGCTTACTTATAA TTCAAATACAGGTTTTCATAAGGGACCATGGGGACCCCTCTTTAAAGCAA CGATTGCTTTTGGGGTAACGTAACTTTCACTGGTGTAGTATACACCTATC CACCCCTAAAAGTGCGGTCGAATTTACAAGCAAATGACGTCAAACTCTTT GTCTTTGAGAATGGAAATGTAGCGGCAAACTCGAATCCATCCTTTGAAGA CATGAAAGGTTGATAGGTTTATTGACTAATGAATTATTCTCCCATGTCGG AAAATGATAGATGGTTGTACTCATTGTTTTGTCGTCATCTTTTTTAGATT CACGTCAGTTTCTCTTTGACGGGTGGTTCCAAAGATGAAAATGCTATTGC TTCATTACATGGTAACGTGTTGAACTTGTTGTTACAAAGTGTCGGACTGG CCTTCACTGAAATACAAGACGTACAATTCAAGTAAGAACTACTTGTTATG ACTCAAAACACAATTCTGTTCAGGTGTTCTAGCCTgtagaatttttttct attcaagATCTGTGCTACAATCAAGATTACGTCACGTCTTTCGTTCTCGT TCTCAGAAACAATTGAATATATGTACACTTTCCTCGCTATTTTTCTtatt taagtaaaaaaaaaacaaggaaaattcAGGTTCATTTCGGGTACTTCCAG CCAGCTAGCCAGCCATGGCTTTAGGAGAAATGGCCTAGCCTTGAATTACC CTCATGTAATAAGATGcagggttggaaaaatcttcAGATTTTAAGAGGAG CGGATGACCAAATTACCGGGGAATAGGAGATACCCCCAAAATGAAGTTAT TATAGACTAACACCAGACTATTTAGAGCAAAGTATTTAGATTCTTCCTCT GACAGCTGAAACATAAGTAAGGTCCTCCTAATAAGGTCTGGAGGGgtgga aaaaaattggaaaaattaacaagcaggtGGGGGTGTTTGAACGTACAATG CAACATTAGAACCCGAACGATGGCAGCTCTTGCTTGGTGGATTTCCTTCC GCCCTGATTCATCACCTTCCACTTATACTTACAGATTAGCATGTTACGAA GTGCATAAGTCCATGCAGAGTAATTCGCAGCTCGGTGATGGAATAACTAA ACATTATCAAACACAGGCTATCAAGCAACTTTATGTGTTGGTACTCGGGC TAGACGTTCTTGGTAATCCGTATGGTTTGATATCTGGTGTTGGAACCGGA GCAAAGAATTTCTTCTACGAACCTTACCAGGTATATAAAGCGAGTGTTTT TCTGTGgtggagacggtaaggttctaatttgactatatcctgaccagctg agcaAATCAGCAcctttaccgtcctcgattttgcgggtcagaagtgtggg ttattccaaatcgcttcagtcactttaccgtcctcaaaagagCTCGCTTA TATTTGATGTCCTTCAGAAGGGTTAATAAATTTAACGAAAACTCATATGT ATGTCATATCTTCAAAACTAGACAAGAAGCCGCGCTCTGATACCGACTTT CTTTTGGTCCAAAATAGAGAGAGGTGTATATGACCGTAGATGCtcaatat ttgattcttctttTCAGGGATTAATTCAAGGACCAGAAGAATTTGCGGAA GGATTGGCGTATGGGGTGAAGAGTCTTGTTGGTGGAACCGTGGGTAAGTG AACAACCTTCATTTGCCAATCCTTGTCACTTGAATTACTcaattcaaaca gaaaaatgcGCGTCGTTTCAGTTGATTCCCGAAAATCCaatgtttcaaat tttcttaggCGATCAGTGCTTTATATATCATATATATTTCAAATTACTTT ACCAGTATTTTTTGTGTccgtaaaaatcaattttgcgaaaattaattcaT CGAAGTAAGTTGCAAATTTTCGTGTATGACCTCAATCACGAAATGTTCTG AACACAGACACCCAGCAGCAAAGTGACTCGATACAATATTTTCAGTGGTC TCACTTTACGCTTTTCCTTCTCATGTAGTAATCGAGGCGAAATCTCAAAC TAAAACATAAAGCAACTTAAATGCTAAATCGTAAACTTTGTATTCTTCCA TCGCTTAGGTGGAGTATCAGGAGCTGTGAGTAAGATTACCGGTACCTTCG GTAAAGGTTTGGCTGCATTGACCTTGGATGAAGAATATCAACAAAAGAGA CGTGAAAACATGAGCCAACGCCCAACTAACCTCGGTGAAGGTCTCGCCAA AGGTGGTAAAGGCCTTGTAAAGGTAAAAATAGCGAAATATATGACTCTGT TTTTCTTCATGGTCTCCTTAGGGGACAACTTATTTTCTTGGAATacattt tcgcggttttaggtATCTACCGAGAAAATCCTGTGCAATACATTTATTAC ACTTACTTATTCAAATAAGTAAATGTATACCCCTAGTCTCTCATTATGCT AAGTCTCTTGTCCTTAAATAAGAGAGTAATTGTTCAGgcaccaaaaactg agcctgcatatgcttttAAGCGTTATGTCTGTGTTATACTAAtagaaaaa gcaaataaatacGAGAATACGAATTTACAAATTCTAAATCCGTATTAATC TCTcggaaaaattaaagaatttctgGAAAATATGGATGTCAACCTGGAAA ATAAGCTTTGCAAAtttgttatcatttttcttactttttctttcaGGGTA TCGTGTCTGGTGTTACAGGGATCGTTACCAAACCCTATGAAGGTACTTGC AggataatttgttttgttttaagataacagaaaattttaagatatgTTTT TTTGATGATATTCAAAGCAGCGCGCATAGTATGCTGATAAAGTTCAATCA AATCCCTCAAAGTTTTAATAGCAATCGAGGCGTTTTCTTGGGATACGTTA TCGATATTTATGCcctgattttttcatttttgtcctTTATATGCTTTTTA TCTATTTACACTGGCGAGCCATAAATGAAAAATGAGCGTAAATATCGATA ACGCCCATAAAAACACCGTTATTGGTGTATTAACAAAAAGAATTGTTCAA ATCTGTCCTTGCACGACATGGGAGGTGGCGAAAGTTGCTCttttgattat aaaaaaattgctgTGTCACTGTCAGCAGATAATAAACTAAAAGTTATTGC ATCATGGATCGGGTTGGCAAGTAACTCAAAATGAGAGGCTCCTTACCAAA TTAATTTAaagtaaaacttttttgtttcccTTCTTTTTACAGGTGCCAAG AATGATGGTGCAGGTGGCTTTTTTAAGGGCGTTGGAAAAGGCCTGATTGG CGTGGTTGCACGCCCTGTTGGTGGAGTGGTAGATATGGCCAGTAACACGT TTGATGGTTTGAAAAGGTATAATATGCGTCCCGAAAACTTAggtcaattt ttcaaactttggctCCGACATACTTGTAACTTCCCAAACCTATAATaata gggggccaagcctggagttccgtgacatctttttgaCGACCTAACCATTT TAGTCTATccaaaagaacagtatattataagatatttttgagagacTTTA TTGATAGACGTTGCGACGCTGTGAGCGCTATAAGAATCATAAAAGACAAC GACCTTGGGGACTAGGGTTGAGTTTGATATACTGATTAATTCTTATCTTT AAATGTTCTTTCTGAATTTTCAGCACGACATCTGGCGTGAAAGCGATCGA GTTGAGCCGTGTTACTCGCGTCTTCCACGCAGATAAGGTATTTAAAAAAC CGATCATGAAATTTCGAGGAGGTTAACTTTCGCGGTTTTCGTGGAATTAA GTCGCCATAGAGATTTAAGCCTTATCCGTAAAATATGATTATGAAATATT GTcacaaaaacatcaaagaagcgctaataatgtgtatttcaacaaccaac ataaaatttgggaaaaggctcaaaattttagatagagtatctccataact cgaaccttcATTACAGGAACGTTTTTTTATCCCGAATTAATTCGTTGGCA AGGtgaaaatttcctaattttaagCTCTTATAAAAATGCCTCTACTACTC AAACATCCAAAATTCGACAAAACTCGAATGTTCCATGTTCGAATCAGTTA GCCGTTGCTCGATATTTCTCCgtcattatttattttttcaatattttgac tgTTGGTGTCTCAACTGGTGTAGTGGTTTAGGGGCTTACAGTAAAAACGA CGAAGgacatcgaaacaaaaaaaccTCTATCTAAAAAGGTTTGGGCATTT CTGAAGATTTCCCTCAATTTTCCCACGCCACCGTTTGTTTGCCCATCAAT GATCTCCATATTTTCTTCAACTCAGGTTTTACGACCTTTCAATCTGTACG AAGCAGATGGAAACAAAATTCTTATGGTAATTTTCTGTTTGTCTGAACAA ACTGttctcttgaaaaaaatagcacaCCTGATAATTTTGACTTAactttc ttatttatttttattcttcaCTTGGATATGAATACTTTTTATACTTAATA CTGACAAAACCCTTGACTACTCTTCTGTTTGGCCTGAAAAATGTTATGCT GAAGTAAACCAACTGATTGTCTTTCCATTCAGCAATGTAACAAAGGAGAA TACGCCAAGAAGAATTTTTATATCACTCATGTAGTGGACAAGAAGAACTA TCTCATCCTCACTCAATCGTAAGTTGAACACCATTCATCACTCCTACTTG TTATACAGCGTTCCTTATCTACCactagcgaggttaagcaagtgtttatt tagaTCGTTCAATGCGAaatcgtaggcctgtacataagatttcacttgca tggcttgctttggcaagttatgtagAGGCCTACGGTATtgcactttacgg tcaaaataaacccgtgcttaacctcgctactAAGCACTCCTGTCCTGCAT TTAGTTGGCCAATCACGGGTCTTCTGCAACCAGGTTGCGCTGTGTCCTTT ATTTTGATGTGCGAATAACTTTTACTGAAAACGCCTGTACAAGAAAACAC TGGCCCGTAAAaaacctttcaattttttttaatcaaagtgCTTTGATACT TTGAATAAATTTGAGGCAGGCTTACATGGtcgaaaatgaataaaattcaa ccaaaatgaaaaaacctgGTGGAAAAGTTCTATATACACTCTGGATGGTT GCATGCCAGGCAAATGTGTAAATAAAGcatgggatacacggggacgaggt tgtgaATTTTGATGTCcatttcttttcttagaaacATTTTGTATGTTGGA AAGAACGAGTTGAAAATGGGTGAATGGGAATCggtttgggttatcgagtt caATGAGCTAAAACGTGAACCAGAAGTGAAAGAGACAAAGATTATTTTCC ATATCCATAATACGGTAAGATGATGTGTGGTGATGTAGCTCCGTCATAAT ACTAATGCTAAAATatgaacttgaattgaaaaACATCGAATTCTAGATTG AATGGGCGGTCGGGGAAAGGGGGCCCACTCAATATGTGACAATCTCATAT GTACTTCTTCGTCGAAATCAGTACCTGGTTTGATCCGAATCTGGGCTGGA AGAACACTTCTTTGAACGTAGCGAGCAAGCATAATGTGAATGTAGTTATT CCagcaaaatcgattttggttgCATGGAGTCCACTTATATTGTGAGAAAA CTCGTAGTTGAAAGGGAATGGGttataatgaatgaatgaatgaatgaatg aatgaatgaatgaatgaatgaatgaatgaatgaatgaatgaatgaatgaa tgaatgaatgaatgaatgaattagatttttttttcgggaaatcACAACAT TACGTCACATTTTTTTCAGGACACGCGACGTTCAATTTTCAAGAAATCGA CGAACACACGTGAAGTGATATTGGAGTCTAGTGCTGTTGCAGACTGGTTT ATCTTAAAGCTTAGAGATGCTAAAATGTTATAGAATGAAAATTGTGCCAG GTTTTATATTCAATTTGTGGGTTGTTACGaaagaattattttaaattaag ttgttggatttttttttgcttcgatGTTATATTTTTTACTAATTGGGAAA ATTgtctatttttttgatttttgagtatttttaaaCGACATTTTTTCGAC TTTTATACAAACTCTTCTTCTTTAGGTTTTCTTATACAGCATCTCTCATA CATCCACACAATTTGATAGAAATACGACAGaaatgcactttttgaaaaaa gatgacAATATTTCGCACGACGCTTCGCGCTTTTAACGGTAGCTGTACGA GCTCTTGGGAAGACTTAGTTCTCGATATCCTCGCATATCCTCGTTTGAAG TATGATCTTAAATATGGGTCACCAAGCCACACGACATGAAAGAGTTAAAG AGTAAGGGATAAATGTGCGATTTATTTTAGGGTTCGACGGGAATTTATTC TGAATTTCGTACCTTTTCAAGTATTCATAATAGTATAAGGAGCAAGATAT CGTTATTTTTGCTGATAAAAGCCTTTTTACTGTAGCTTCATATATTCATT GATCTTCGTTTAATTCAGTTGTAACGGCTTTTTAGGTTCAATTGGAAAAT ATATGCATATTCGTGTCTGATATTGAATATGTATTCAAAAGACATTGACA GACTGTACTTTTTTGAGAATTGCTTTTTTGGGGGGGAGATGTTATTAAAA ATAATACCTCGTTGGAAGGATGATTTTAAGCAGATTGATGTA

Coding sequence (CDS) from alignment at scaffold_82:20022..160963+

>TCONS_00072678 ID=TCONS_00072678|Name=TCONS_00072678|organism=Clytia hemisphaerica|type=CDS|length=893226bp|location=Sequence derived from alignment at scaffold_82:20022..160963+ (Clytia hemisphaerica)
atggtatttgaaTCTTTGGTTGCTGACCTCTTGAACAAGTATCTGGGTCA
ATATGTGAAAAATCTTGATGCTTCTCAATTGAAGATTGGCATTTGGGGAG
GAAATGTTGTCCTGACAGAACTTGAACTGAAAGATACAGCTCTGGATGAT
CTTGACTTACCCATAAAAGTTGTTCGTGGATATTTGGgtAAATTGGTCTT
GTCCATCCCATGGAAAAATCTTTACACTGAATCAACTGTTGTCGATATTC
AAGATCTCCACCTTGTCGCTAAGCCTAATTTTGACATCAAATACAATGAA
GAACgcgaagaaaaatcaaaacatgacAAGAAACAACAACAGATTCACAA
TATCGAAGAAGCGAGGCAAAGAGAAGAAGACAAAAAGAAAGGCGCCAAGA
AAGAAGAGAGTGACGGTTTTGCTGAGAAACTTGCAACAAACGTCATAAAA
AATCTACAGGTTACGATCAAGAACATACATGTTCGATATGAAGACTCAAT
CAGTGATGTGAATGGACCCTTTTCAGTCGGTCTTACAATGGAAAGTTTAA
CAGCACAAACCACAGATGAAGATTTTGTTCCAAAGATTATCAAAGAATCT
GTCTCATTAATTCATAAGatggTGAAATTAGACAATTTGGCTTTATATTG
GAATCCAGGAGACGAACTGATTGATCCTTCACTTGATACCAAGCAATGGT
TGgaagtTTCAACGAAGCAAATTTCAACACACCAATCGAAGCCAGAGAAA
ACGAAATATATTTTGAGTCCCATGGTTGCAACGAAGAAATTGAAGCTGAA
CACCAAACCAGGTTCCAACCTTGACATCCCGAAGatgttTTTGAACTTGG
TTTTGGAAGAACTTGGTATCATCGTGGCAAGAAGTCAATATCATGGCGTG
GTGCAACTGATTGAATCATTTGAACGAATGAATAGGAACCAACCTTTTCG
TAAATACAGACCACATACCTCCGTTCTTGGGAACGAAAGTATTTGGTGGA
AGTACTGCATGTCCAGCATACTGGAGGTGGATGTCAAAAGACGATCTCAA
ATGTGGAGCTGGAAGCATATTCAAAAACATCGAGTTCTTTGCAAAGCTTA
CAAAGTGAAGTAcaaggaaaaattgaaacagaaaaATCCATCCAAACAAA
TTCTCACTGAACTAGAGaGCATGGAGGATGAGTTGAATATTGCAAGCATC
ACCATTTTTCGACAGCTTGCAGCTACAGAGGTTTTAACGGAACAAAAGAA
GAAAGGCACTAAAGGAAGTTTCTTCAGTTTCTTCTCCAGATCAAAAGAAC
CAGAAAAGTCTGCTGCTAATAAAATTGGAGATTTAATGGGTGATGACCAG
GAGAAGGAAATGCAGAAATTGTATGACGCAATCGGTTATACTGAAAATGA
AGTCATCACTCCCTTTCCTAAAGAGTACGTGGCGATGTCAGTGGAATCGA
TTCTCCAGAAATTATTCATCAGCCTCATCGATGACACAGATAAGGCGAAA
GAATTCAAAGTGTTGGATTTTTCACTCAACAACATCATTGTAGAAGTTTT
CCAAAGACCTTCTGCTCAAGCTCTCAAATTATGTGCAAAGATAGGAGAGA
TGAAGTTATTTGGTACAGCTTCTGCTCAATGTACACCTCtcatcatcaaa
aacatgttaCAAGGTCGAGGTATGGAATTTCTGCCGTTGGTGGACTTCAT
CTTTGAGACGAATCCTTTGAAGAAACCGGACATTGACCAATGTATCACTG
CTATTTGTCAACCCTTAGAAATCATCTATGATGCTAACACGATCAACCAT
ATCATTAGTTTCTTCAAACCTCCTGAACATGTTATCTTGCAAGATTTACA
AGACAAAGCGTATTCTACTTTCGAAGATTTTAAAGTTTCAAGTACGGCTG
GTCTTCTACATGCTATGGAACAAAGAACGGTTATGGACATCGACATTGAT
GTTGGAGCATCTCATTTGATCATCCCTGAAAAAGGTTCTTACAATGGTTG
TACAGATATGCTGGTGATCGACTTTGGTAAAATCACGATGAGCAGCGATC
CTAGTCAAATCAGACACCTTGACCCTAAGGACATTGAGGATGTGAATGAA
GTACAAAGCAAAGCTTATGATCGATTCTTGTTGTCGCTTCAAGCTCTTCA
AATATTACTCGTTAGAGAAGGTGAAGATTTAAAGAGTGCTAAAAGCAACG
TCAGTAAAGCTTCATCACACATTTTGCATCCCATCAATTTCGATGGCAAA
CTTGCCAAAGCTATACTTCCACAAGATCCACGTTTAAAACAGATATGTGT
CTCTGGTGAATTATCTTCGCTGTTTGTTTCTGTATCGGATGATAAAGTCA
GTCGTCTCATCAAGCTAGCAGACTCGATACCACTCCCTCAATCACCTTCT
CACGATAACATCGACGGAGAAGAAAAACCTGAAGGACTCTTCACCAAGGC
GTTGTCAATGATAAGCTTGACAGGTGACAATGACACAGGGGTGGACATCG
GAGGATTTTCCATCCCTGTACCGACATCTCCAACATCAGTGACGTCAGAT
GAAGATGAATACGGGACACCACCTGATGGCTCCATATTACAGTTACAACA
AGAAGCTGGTCCGGACTTTTCATCAGGAGTGGCGAACCAAGTCAAAGTGG
ACTTGAACTTTAAAATCCATAAAGTGATGATCGCCATTGGTTTGACTGAC
AAAGCATTGAAACAGGAAAAAGAATGTCTGAAATTCATCGTGGACGACAT
CAATACAGAGgtGATACTACGAAGATGGGATTTGTTCGTCAATGCAGAAG
TTGGTCGTCTGGTGTTGAATGAAATGACATGGGGTGTTGATGGAGAACCT
TTCGCCATCATGAGTACacccaaaaacaccaaaatgttGAAATTCAGCTA
TCGGAGGTGTGAATTCAACGAAAGTTTGAATCTCGGTCCAAGTTACTTTT
ATTCCAAAGAAGCGCAAGTCAGAGCTTTACATTTCAAAGATGAATTTGGC
GCCACGGATCAGATTTTAGATGTACAAGTGGCTACTTTATTTCTGATGCT
TCATCAAGAAGCACTTTTGAGCATCATGTCATTGATCTACCAAGTACTGG
AACCACTCAACAAACATGATAAGGAAGCCACACAGAAGATCAAACGGAGT
TTGAGTACGGCAGGTAGTCGTTTGAGTCTCTCCatcgaagaaaaagaaaa
ggagaGACAGATACAACGAAAATTAGCCAACCCTAAAGCACTGGAAGCTG
CCAACGAACTTAAGCAACAGGTTGGcttagaagaagaaaaaaagatgaGA
GTGACCGCCCACCTGGATGGTGTTGGTATCATGATTTGTTCAGCCAAAGT
TGACCTTGCACAAGCCTTCGTTAAAGGGTTATCTGCTAAAGTACTGATGA
AAGATGACTTATTAGAAGTGAAAGCCAGCATGAAAGATATGCAAGTACAA
GATAATGTTGGCGAAACAAAGTACAAAGACATCATTAGCATGCGATCTGA
TGAAGTGTTCGATTTAGAGTTGGCTATTTACGAGAATGGATCTTCTGGTA
GCAAGCAATACGATATGTCGTGTGTCGACACCAGTGTCAAACTGAACTTC
GGTCAAATGCGCGTTGTTTTCTTGTATAGATTCATACAAGACTTAATGTC
ATTCACCGAAAACTTCGAAGAAGCACAGAAAGCAGTTGTGGAAGCTGGTA
AAGCTGCCAAGGATAAAGCTCTGGAAACAGCGACCGATTTGAATAGACAT
TCTTCTCGTGTCAAACTAAATGTGGTTCTGAAAGCACCGACTATTATCAT
TCCAGTTGGATCAAACAATGAATTGGCTTTACTGGTGGATCTGGGTGAAT
TGCGTATTTACAACACATTCAAACTCCTCAACGATGATCAATACCATAAG
AAATCTATCATCACTGATAACATGACCATTAAGTTATCCAATCTGAAATT
GTTAAAAGCACTTATTCAAGATGGTAAAGATTTCTTGCATCAACGAGCCA
TTATTGAACCTATGATGCTACAAATAACTATTGTTCGTAATTTAACGAAA
GGTAACCATTCCATACCGGATGTTTCAGTTCAAGCAAAGATGCCAGCTAT
TCTGTTATCAATCAGTGAAGAAGATGTGACCGTAGCTCTAAAGATTGTCC
AAGGGAATCTCGCCGAAGGTGAGTCACATGCGCCGAAGAAGCAAGCCAAG
CCTGCCAAACAAACGTTAAACGTGCCACAAGATCGTTTAGCAGACATTTA
CGAGGAGcctgaagatgaagatgagaaTCGACAAGGATATCTTCAAACCA
AACTATCCTTCGATCTGGCTAAAATTGACATCAAGCTTTACTTGAAACCA
TCTGATATGACATTTGAAGATGAATTTTTAGCGAGGACGGATGATTTGTT
GTTAGCTTTGTTCACTATTGGTAACCTGTGTGTTGATGGAGACATCATGT
CCACGCAAGCTATGAAGATGAGCGTTCGATTGGACACTTTGGTGTTGGAT
GATATGAGACCTATCGAGGAGCATGAAGGTGTTAAACGTATGATCAACTA
CAGTCCCGAGCCACTCCTTGAAGAAGTCAAAACCTCTTCTCATAAACGAC
CAATCGACAACTCACGAATGATCGAAATCCAAttcgatcaaacttcatcg
caagataaaaatatcgacATCAAACTTTGTAACATGCTTTGTATATTCAA
CGTTGAGTTTATCATGGTCCTGTTGAAAACGTTGCAAGCTGCCATACCTA
AAGATGATAGTCTGCAACATGGCCATTCAATGAGTAGTCTAGACTCGGCG
GCAGGGTCTGGCGGCAGCGATGACGAGGACTCTTTAGAAGCCAGCGAGAT
TGTCCTCTGCACTGGTGATCAAGAAAGACCTGAGACTAAAGTCTCTATCT
TCGTCCATAACCCGCAAATTGTTTTACTAGCAGATGCAAAGGATGTCAAA
ACAAATGCACTCTTTCTTACAACCGagatcaattttcaatatttcgaaTT
GCGAGATACTCAAAAAATGATTGGCGCTGTTTCTAACACCGCTATTTTGT
CAACTGCTTTCAAGAATGACCATCGGAGTGATATATCAACAGTGTTGTCA
TTAGATTCCATCAATCTCCACTCGTCATCACCCATCAATGGTAAACCTCA
TATGAGTGTCAGCACAACTTTGATCAAACTGAATATCTCACCCAAAACCA
TCCGAACTTTATCAGCGTGTGCTGGTTACATCTCCAATGATCCAACAGAT
GAAGAAATCAAAGAAGCTCGAAAAGCCATGCGTGATTTATGGCAAATTCA
AACGTTCACCAATAAGCGACCGTGGTATTTAAACCACCCACCACAACAAG
TCTTAAGTGCTGGCAGCTTCGTCCTTGCGCGAACGAGAACAGGAGAATAT
AAGCATGGTTTCTTAGCTAAAAAGGATGTCTCGTATCAAGTCTATTTTTC
AGAGGAGCGAGGAACAGCCAGTCACCGAGCCATGGATATCTCATCTGTTG
TTTTGGATATCGTACCGCTGATCGGTGATCTATGTGTTGGATGTAATGTT
TTAGCTGTGGAATCGAAAGAACATGGATATCGTACTGGTCGAATTACTCA
GGTTTGGGATTCGAATGTGGATAAAGATTCTTCGGATGGCGCCAAACAAT
CTGTTTCTGTCAAGACAACTGCTATTGCTCCAATCAAATACCTTGTCAAT
TTCTATGACAACCAAACGGAGAACTTCTTCCCGCCTGATGAACTTCGTAT
CATTGGTAAACCCATCAAGGGGGTTGTCCCTGGACTAGGGGCGTGTGTTT
ACGCCCGCTTTAATGATGGTTTTTACTATCGGGGCAAAGTTGATGACATC
GAGGATTATCGAATCCGAGTGCAATTGGATGAGATCAGTGGAGAAATCGA
ACACGACATCGATGATCCGTCAGCCGTTATTTTGAACCTGACGCCTCAAT
ACCGTCAAGTCAAAAAGCATTTCAAAGTCATTGCATCCAAAGGAAGCACA
ACTAAAGGATATCATCCGGGGAAAGTGACCGCCATCCAAGGTGAAGGAAA
TAACCGATTGTATTCGATACGCTTCGAAGACGGTACAATTAACCAAGTAC
CCATCacgaaattgattttgatgccAAAAGCACCTTTTGATGCTTTACCT
GAAGTTGGCACATACGTTTATTCCCGAGTGTCACGCGACGCTCCTTTATA
CGAGAAGGGTATCGTAGCAGAGAAGAACACAATGATCTGCGTTAAACATT
TAAATGGACGGAAATTGGCTCACGAAATACAAAACATTCATTTTGTTGTC
CGAAATATCGTTCCTCTCGTGTCATCAttgaagGTTGGTTTGGACGTCAT
AGTGCAACCTGACAATGACGATCAGAAAATGTATTTGGCTGTCATTAGGG
AAGTCACCAAAAAAGAAGGTGACAAAACGAACCGTTATCTAGTGGAGTTT
ACGGATGGATCCAAGAAGAGAGTGACGCCCAGCCGGATCCGTATACTTTC
TCAATACGGAAGTGCAGAAACGAGTGAAGAAAATGCTGACATTATCACAA
CAAGACAGGAGGAACTAGTTCTCGATGTGCAAGGTATCTCATTACGTGTG
GAAGGTTACTTGGGAGGCGTGTTGACACCCATGCTCAAAATGGATTCCAA
AATCACAGCTAACTTGAAGGATTGGTCAAGCCAAATGAATGCACACGCTA
CTGTATCATTAGAAGCCAGTTATTATAACGAAAACGTTGCCGAATGGGAG
CCAGTTATTGAACCTTTGATGGAGAAACGGAGGGAAAGACCGTGGCAACT
CTCTGTCAATTACACGATGGAAGGTGACGACAATTCTGCTTCATCCACTT
CCAACGAACTCGTTTTACAAAAACCGGAATCCAACCTGAAAATCAAATCT
CAAGATAATCTTGAATTGACAATTTCAAAATCATGTCTTGCTTTACTCGG
TGAATTGGGACAGGTGTTTGGAGATGCAGTAGAATCTGTGGACGTTTTAC
CACAAGTCCTGGTCGAAAAAGAACCTTTCATGATCGAAAACTTGCTCTCC
AAGAAGGTGACAGTAACATTGAATGAACTTCTGCAGGGACCAAATGGAGA
TTCGACAATCGAGCTAGCATCTTCTTCGAATCCTGTTGGCATTACTTTTG
CTCCCAagaaatttgagaaacgaaAGACCAACGATCTATACACAATCAAT
TTAtcgGTGGACGGTTTTCATGACATTAAAGACATTGTGGTTCAAAGAAA
GCGAAGCGTTATCTATGATCTTGTACCAATAAAACTATTATCAGCACAGT
CTTCATATTCGATAGTGGTACAAGTGAAGACAACAGACGGACAACGTATC
ATCGTACTCCGATCACCATTGCAGTTGAAAAATCACTTTCCAATGCCGTT
GGATGTCAGCTACATTTCCAAAGAAAACCAACCAGTTAAACTGACAACAG
TGGGATCGGGAGATATCTATTCCTTCCCTTTGTTGTTAACCTACCACAGT
GTTTTTCATCTCAAACCTGCTGGTTTCGACTACGGTGATTGCACAGAAGC
TCTCAATTGGAGTGATTTGAAGACGAGCAACGAAAAACAGTTCTCCTGCC
CTTCACCTGACAAAAGTGCTGACCCTTTCTACATGCAGGTGGTGATGAAA
GAGGAGACGTACTCTTCCGTACACGGCATGTTGGACTGTGTACCACGTTA
CACGTTGGAGTGCTTTCCCGTCATCACGCTGCATAATTACCTACCTTGCA
CTATTAATTATAAGATCAAGGGTATGGCGAAATCGGAAAGTCTACCAGGC
GGACACAATTGGCCTTTGTTTACCGTCAACTTCAGTGATAAACCTTCCAT
CTATATCGAGATTGAGTCGTATAACAACCAAAGATGGGAAGGAGGTTTGA
CATTACCAACAAAACCGGTAGATTCTTTGAACAAACCATCATTATCTTTC
GTCATGATGTCTGGTGAACGCAAAATGGAATTGGGTGTTTATTACCAGTT
AGACGGTTCATTGAACATCACCTTATATTCGCCTTACTGGCTTCTCAATA
AAACTGGAAAACCACTTGTCTATCAGCCAGCGGGGAGCAGCATCCAGCAA
GTTCACCAAGAGAACGATGTAAATGCTCTTATGATGCTCGTCAAAGGGAA
ACATAAAAAGgcgaaagtgaaagtgaaaaataGCGAGTCATGGTCAAATG
AATTTTCATTGGATACTGTTGGCAGTGGTGGTTCCTTGAAATGCAATGGT
CCAAGAGATCGAGTTTATGAGATTGGTTTGAACATCAGTTTGTCATACTT
TGGATTGACGAAGATTGTGACGTTCACGCCACTCCGAATGTTATCTAACC
ACACCAAGTACACCATCAGTATGGCAGAAAGTAATTCTAAATCGTCAGAA
TGGCACACGGTAAACCCTGACGAGaacattccatTCTGGCCGACGAAACT
TCCTTTGGTCAACCTTTACATTAACATCAATGGGCAAGATTCAGTGAAAT
TCAACCCTGAAGTTGGAAAAACTTTACTGTTGAAGTTCCAGAATGAGGTT
GGAGGAGTTTGCGTGGATTACCAAGAAAAGGACTCGTCCTCAGTCCTTTC
GTTTAATCCGTACTTCGCAGGTGCAGCTCCTGTGCGGCttgaaaatcttt
gcaaaaaGATCGGCATGATCGCTTATAAACAAGCAGGTTCGGTAATGGGT
CACGTGTTAACACATGACCAATCAGTGTTGTACACGTGGGATGATCCAAC
CATGGAACAAGAATTGATTTGTTCCATTGTCAATGATGAAGCCAGTGAAA
CAAGGATCAAACTCGATGCCAACGATTTCGGACGAATGAGAGTTGGAGAT
GGTGCAATTTATTGGGTTTCCTTTCTGGATGGTCTTCAACGTGTTCTATT
GTTCACTGATAACTTCAAATCTGCTTACTGCGCATGTCAGgaGCAAAATT
TACGCCCAACCATGGAAGTTGACTTTGAGATTGAGAGTTTTGGTTTGTCT
CTGGTCAATGTTGATAAGAGAATGGAGATTGGCTACTTAGCTATCCGACA
AAGCAAGACTGTATGGGAGCAACGCAAGAAAAAGAACCGCTGGAAAGCTT
TACCGCTTGCCATGTGTGAAGCTCTCGAAGAAGGTTATCTCAATTATCAA
AACAGAAAAGGTGCAGTCAAAGAGAAAGTTCTGGATAAGGAGGTGGATTA
CGAGAAGATGTTTATTACGAAACCTGAGAAGATTAAGATCAGAAGAACGT
ACCACAGCGGTCTTGGTTTCAAATACACAATCTCACCCAATGAAATGCGT
GTGCATGCTTCTATCAGCTCAATACAGTTGGATAGCCATGTTCCAGGTTC
GACCTTTCCAACAGTCTTGCATATGGTTGAACCACCAAAATCTGTTGCTT
CAGAAAACGCTCCAAAGCCATTCTttgaattgagtttaatgaCAAGGATC
GGTGATAAAAATGTGGTCAATGAAGTcagCTATTGTCACGTGTTGATTCA
AGAGATGGATGTGAGGGTTGATATTGGATTTTTATTGGCTCTGATGGAAC
TCTTCAGTCATGCAAGAGCTCGAACAACCGAGAAAGAACAATACGCGCTT
GATATTGGCCAAGCAGCAACAAAGTTTGAAGAAAGCGCTGAATTTCAGGC
AGCCAAACAAGATCGATATTACGTTTTGAACGACTTTCATTTATCACCGC
TAAAGATTCACGTCAGTTTCTCTTTGACGGGTGGTTCCAAAGATGAAAAT
GCTATTGCTTCATTACATGGTAACGTGTTGAACTTGTTGTTACAAAGTGT
CGGACTGGCCTTCACTGAAATACAAGACGTACAATTCAAATTAGCATGTT
ACGAAGTGCATAAGTCCATGCAGAGTAATTCGCAGCTCGGTGATGGAATA
ACTAAACATTATCAAACACAGGCTATCAAGCAACTTTATGTGTTGGTACT
CGGGCTAGACGTTCTTGGTAATCCGTATGGTTTGATATCTGGTGTTGGAA
CCGGAGCAAAGAATTTCTTCTACGAACCTTACCAGGGATTAATTCAAGGA
CCAGAAGAATTTGCGGAAGGATTGGCGTATGGGGTGAAGAGTCTTGTTGG
TGGAACCGTGGGTGGAGTATCAGGAGCTGTGAGTAAGATTACCGGTACCT
TCGGTAAAGGTTTGGCTGCATTGACCTTGGATGAAGAATATCAACAAAAG
AGACGTGAAAACATGAGCCAACGCCCAACTAACCTCGGTGAAGGTCTCGC
CAAAGGTGGTAAAGGCCTTGTAAAGGGTATCGTGTCTGGTGTTACAGGGA
TCGTTACCAAACCCTATGAAGGTGCCAAGAATGATGGTGCAGGTGGCTTT
TTTAAGGGCGTTGGAAAAGGCCTGATTGGCGTGGTTGCACGCCCTGTTGG
TGGAGTGGTAGATATGGCCAGTAACACGTTTGATGGTTTGAAAAGCACGA
CATCTGGCGTGAAAGCGATCGAGTTGAGCCGTGTTACTCGCGTCTTCCAC
GCAGATAAGGTTTTACGACCTTTCAATCTGTACGAAGCAGATGGAAACAA
AATTCTTATGCAATGTAACAAAGGAGAATACGCCAAGAAGAATTTTTATA
TCACTCATGTAGTGGACAAGAAGAACTATCTCATCCTCACTCAATCaaac
ATTTTGTATGTTGGAAAGAACGAGTTGAAAATGGGTGAATGGGAATCggt
ttgggttatcgagttcaATGAGCTAAAACGTGAACCAGAAGTGAAAGAGA
CAAAGATTATTTTCCATATCCATAATACGGACACGCGACGTTCAATTTTC
AAGAAATCGACGAACACACGTGAAGTGATATTGGAGTCTAGTGCTGTTGC
AGACTGGTTTATCTTAAAGCTTAGAGATGCTAAAATGTTATAGatggtat
ttgaaTCTTTGGTTGCTGACCTCTTGAACAAGTATCTGGGTCAATATGTG
AAAAATCTTGATGCTTCTCAATTGAAGATTGGCATTTGGGGAGGAAATGT
TGTCCTGACAGAACTTGAACTGAAAGATACAGCTCTGGATGATCTTGACT
TACCCATAAAAGTTGTTCGTGGATATTTGGgtAAATTGGTCTTGTCCATC
CCATGGAAAAATCTTTACACTGAATCAACTGTTGTCGATATTCAAGATCT
CCACCTTGTCGCTAAGCCTAATTTTGACATCAAATACAATGAAGAACgcg
aagaaaaatcaaaacatgacAAGAAACAACAACAGATTCACAATATCGAA
GAAGCGAGGCAAAGAGAAGAAGACAAAAAGAAAGGCGCCAAGAAAGAAGA
GAGTGACGGTTTTGCTGAGAAACTTGCAACAAACGTCATAAAAAATCTAC
AGGTTACGATCAAGAACATACATGTTCGATATGAAGACTCAATCAGTGAT
GTGAATGGACCCTTTTCAGTCGGTCTTACAATGGAAAGTTTAACAGCACA
AACCACAGATGAAGATTTTGTTCCAAAGATTATCAAAGAATCTGTCTCAT
TAATTCATAAGatggTGAAATTAGACAATTTGGCTTTATATTGGAATCCA
GGAGACGAACTGATTGATCCTTCACTTGATACCAAGCAATGGTTGgaagt
TTCAACGAAGCAAATTTCAACACACCAATCGAAGCCAGAGAAAACGAAAT
ATATTTTGAGTCCCATGGTTGCAACGAAGAAATTGAAGCTGAACACCAAA
CCAGGTTCCAACCTTGACATCCCGAAGatgttTTTGAACTTGGTTTTGGA
AGAACTTGGTATCATCGTGGCAAGAAGTCAATATCATGGCGTGGTGCAAC
TGATTGAATCATTTGAACGAATGAATAGGAACCAACCTTTTCGTAAATAC
AGACCACATACCTCCGTTCTTGGGAACGAAAGTATTTGGTGGAAGTACTG
CATGTCCAGCATACTGGAGGTGGATGTCAAAAGACGATCTCAAATGTGGA
GCTGGAAGCATATTCAAAAACATCGAGTTCTTTGCAAAGCTTACAAAGTG
AAGTAcaaggaaaaattgaaacagaaaaATCCATCCAAACAAATTCTCAC
TGAACTAGAGaGCATGGAGGATGAGTTGAATATTGCAAGCATCACCATTT
TTCGACAGCTTGCAGCTACAGAGGTTTTAACGGAACAAAAGAAGAAAGGC
ACTAAAGGAAGTTTCTTCAGTTTCTTCTCCAGATCAAAAGAACCAGAAAA
GTCTGCTGCTAATAAAATTGGAGATTTAATGGGTGATGACCAGGAGAAGG
AAATGCAGAAATTGTATGACGCAATCGGTTATACTGAAAATGAAGTCATC
ACTCCCTTTCCTAAAGAGTACGTGGCGATGTCAGTGGAATCGATTCTCCA
GAAATTATTCATCAGCCTCATCGATGACACAGATAAGGCGAAAGAATTCA
AAGTGTTGGATTTTTCACTCAACAACATCATTGTAGAAGTTTTCCAAAGA
CCTTCTGCTCAAGCTCTCAAATTATGTGCAAAGATAGGAGAGATGAAGTT
ATTTGGTACAGCTTCTGCTCAATGTACACCTCtcatcatcaaaaacatgt
taCAAGGTCGAGGTATGGAATTTCTGCCGTTGGTGGACTTCATCTTTGAG
ACGAATCCTTTGAAGAAACCGGACATTGACCAATGTATCACTGCTATTTG
TCAACCCTTAGAAATCATCTATGATGCTAACACGATCAACCATATCATTA
GTTTCTTCAAACCTCCTGAACATGTTATCTTGCAAGATTTACAAGACAAA
GCGTATTCTACTTTCGAAGATTTTAAAGTTTCAAGTACGGCTGGTCTTCT
ACATGCTATGGAACAAAGAACGGTTATGGACATCGACATTGATGTTGGAG
CATCTCATTTGATCATCCCTGAAAAAGGTTCTTACAATGGTTGTACAGAT
ATGCTGGTGATCGACTTTGGTAAAATCACGATGAGCAGCGATCCTAGTCA
AATCAGACACCTTGACCCTAAGGACATTGAGGATGTGAATGAAGTACAAA
GCAAAGCTTATGATCGATTCTTGTTGTCGCTTCAAGCTCTTCAAATATTA
CTCGTTAGAGAAGGTGAAGATTTAAAGAGTGCTAAAAGCAACGTCAGTAA
AGCTTCATCACACATTTTGCATCCCATCAATTTCGATGGCAAACTTGCCA
AAGCTATACTTCCACAAGATCCACGTTTAAAACAGATATGTGTCTCTGGT
GAATTATCTTCGCTGTTTGTTTCTGTATCGGATGATAAAGTCAGTCGTCT
CATCAAGCTAGCAGACTCGATACCACTCCCTCAATCACCTTCTCACGATA
ACATCGACGGAGAAGAAAAACCTGAAGGACTCTTCACCAAGGCGTTGTCA
ATGATAAGCTTGACAGGTGACAATGACACAGGGGTGGACATCGGAGGATT
TTCCATCCCTGTACCGACATCTCCAACATCAGTGACGTCAGATGAAGATG
AATACGGGACACCACCTGATGGCTCCATATTACAGTTACAACAAGAAGCT
GGTCCGGACTTTTCATCAGGAGTGGCGAACCAAGTCAAAGTGGACTTGAA
CTTTAAAATCCATAAAGTGATGATCGCCATTGGTTTGACTGACAAAGCAT
TGAAACAGGAAAAAGAATGTCTGAAATTCATCGTGGACGACATCAATACA
GAGgtGATACTACGAAGATGGGATTTGTTCGTCAATGCAGAAGTTGGTCG
TCTGGTGTTGAATGAAATGACATGGGGTGTTGATGGAGAACCTTTCGCCA
TCATGAGTACacccaaaaacaccaaaatgttGAAATTCAGCTATCGGAGG
TGTGAATTCAACGAAAGTTTGAATCTCGGTCCAAGTTACTTTTATTCCAA
AGAAGCGCAAGTCAGAGCTTTACATTTCAAAGATGAATTTGGCGCCACGG
ATCAGATTTTAGATGTACAAGTGGCTACTTTATTTCTGATGCTTCATCAA
GAAGCACTTTTGAGCATCATGTCATTGATCTACCAAGTACTGGAACCACT
CAACAAACATGATAAGGAAGCCACACAGAAGATCAAACGGAGTTTGAGTA
CGGCAGGTAGTCGTTTGAGTCTCTCCatcgaagaaaaagaaaaggagaGA
CAGATACAACGAAAATTAGCCAACCCTAAAGCACTGGAAGCTGCCAACGA
ACTTAAGCAACAGGTTGGcttagaagaagaaaaaaagatgaGAGTGACCG
CCCACCTGGATGGTGTTGGTATCATGATTTGTTCAGCCAAAGTTGACCTT
GCACAAGCCTTCGTTAAAGGGTTATCTGCTAAAGTACTGATGAAAGATGA
CTTATTAGAAGTGAAAGCCAGCATGAAAGATATGCAAGTACAAGATAATG
TTGGCGAAACAAAGTACAAAGACATCATTAGCATGCGATCTGATGAAGTG
TTCGATTTAGAGTTGGCTATTTACGAGAATGGATCTTCTGGTAGCAAGCA
ATACGATATGTCGTGTGTCGACACCAGTGTCAAACTGAACTTCGGTCAAA
TGCGCGTTGTTTTCTTGTATAGATTCATACAAGACTTAATGTCATTCACC
GAAAACTTCGAAGAAGCACAGAAAGCAGTTGTGGAAGCTGGTAAAGCTGC
CAAGGATAAAGCTCTGGAAACAGCGACCGATTTGAATAGACATTCTTCTC
GTGTCAAACTAAATGTGGTTCTGAAAGCACCGACTATTATCATTCCAGTT
GGATCAAACAATGAATTGGCTTTACTGGTGGATCTGGGTGAATTGCGTAT
TTACAACACATTCAAACTCCTCAACGATGATCAATACCATAAGAAATCTA
TCATCACTGATAACATGACCATTAAGTTATCCAATCTGAAATTGTTAAAA
GCACTTATTCAAGATGGTAAAGATTTCTTGCATCAACGAGCCATTATTGA
ACCTATGATGCTACAAATAACTATTGTTCGTAATTTAACGAAAGGTAACC
ATTCCATACCGGATGTTTCAGTTCAAGCAAAGATGCCAGCTATTCTGTTA
TCAATCAGTGAAGAAGATGTGACCGTAGCTCTAAAGATTGTCCAAGGGAA
TCTCGCCGAAGGTGAGTCACATGCGCCGAAGAAGCAAGCCAAGCCTGCCA
AACAAACGTTAAACGTGCCACAAGATCGTTTAGCAGACATTTACGAGGAG
cctgaagatgaagatgagaaTCGACAAGGATATCTTCAAACCAAACTATC
CTTCGATCTGGCTAAAATTGACATCAAGCTTTACTTGAAACCATCTGATA
TGACATTTGAAGATGAATTTTTAGCGAGGACGGATGATTTGTTGTTAGCT
TTGTTCACTATTGGTAACCTGTGTGTTGATGGAGACATCATGTCCACGCA
AGCTATGAAGATGAGCGTTCGATTGGACACTTTGGTGTTGGATGATATGA
GACCTATCGAGGAGCATGAAGGTGTTAAACGTATGATCAACTACAGTCCC
GAGCCACTCCTTGAAGAAGTCAAAACCTCTTCTCATAAACGACCAATCGA
CAACTCACGAATGATCGAAATCCAAttcgatcaaacttcatcgcaagata
aaaatatcgacATCAAACTTTGTAACATGCTTTGTATATTCAACGTTGAG
TTTATCATGGTCCTGTTGAAAACGTTGCAAGCTGCCATACCTAAAGATGA
TAGTCTGCAACATGGCCATTCAATGAGTAGTCTAGACTCGGCGGCAGGGT
CTGGCGGCAGCGATGACGAGGACTCTTTAGAAGCCAGCGAGATTGTCCTC
TGCACTGGTGATCAAGAAAGACCTGAGACTAAAGTCTCTATCTTCGTCCA
TAACCCGCAAATTGTTTTACTAGCAGATGCAAAGGATGTCAAAACAAATG
CACTCTTTCTTACAACCGagatcaattttcaatatttcgaaTTGCGAGAT
ACTCAAAAAATGATTGGCGCTGTTTCTAACACCGCTATTTTGTCAACTGC
TTTCAAGAATGACCATCGGAGTGATATATCAACAGTGTTGTCATTAGATT
CCATCAATCTCCACTCGTCATCACCCATCAATGGTAAACCTCATATGAGT
GTCAGCACAACTTTGATCAAACTGAATATCTCACCCAAAACCATCCGAAC
TTTATCAGCGTGTGCTGGTTACATCTCCAATGATCCAACAGATGAAGAAA
TCAAAGAAGCTCGAAAAGCCATGCGTGATTTATGGCAAATTCAAACGTTC
ACCAATAAGCGACCGTGGTATTTAAACCACCCACCACAACAAGTCTTAAG
TGCTGGCAGCTTCGTCCTTGCGCGAACGAGAACAGGAGAATATAAGCATG
GTTTCTTAGCTAAAAAGGATGTCTCGTATCAAGTCTATTTTTCAGAGGAG
CGAGGAACAGCCAGTCACCGAGCCATGGATATCTCATCTGTTGTTTTGGA
TATCGTACCGCTGATCGGTGATCTATGTGTTGGATGTAATGTTTTAGCTG
TGGAATCGAAAGAACATGGATATCGTACTGGTCGAATTACTCAGGTTTGG
GATTCGAATGTGGATAAAGATTCTTCGGATGGCGCCAAACAATCTGTTTC
TGTCAAGACAACTGCTATTGCTCCAATCAAATACCTTGTCAATTTCTATG
ACAACCAAACGGAGAACTTCTTCCCGCCTGATGAACTTCGTATCATTGGT
AAACCCATCAAGGGGGTTGTCCCTGGACTAGGGGCGTGTGTTTACGCCCG
CTTTAATGATGGTTTTTACTATCGGGGCAAAGTTGATGACATCGAGGATT
ATCGAATCCGAGTGCAATTGGATGAGATCAGTGGAGAAATCGAACACGAC
ATCGATGATCCGTCAGCCGTTATTTTGAACCTGACGCCTCAATACCGTCA
AGTCAAAAAGCATTTCAAAGTCATTGCATCCAAAGGAAGCACAACTAAAG
GATATCATCCGGGGAAAGTGACCGCCATCCAAGGTGAAGGAAATAACCGA
TTGTATTCGATACGCTTCGAAGACGGTACAATTAACCAAGTACCCATCac
gaaattgattttgatgccAAAAGCACCTTTTGATGCTTTACCTGAAGTTG
GCACATACGTTTATTCCCGAGTGTCACGCGACGCTCCTTTATACGAGAAG
GGTATCGTAGCAGAGAAGAACACAATGATCTGCGTTAAACATTTAAATGG
ACGGAAATTGGCTCACGAAATACAAAACATTCATTTTGTTGTCCGAAATA
TCGTTCCTCTCGTGTCATCAttgaagGTTGGTTTGGACGTCATAGTGCAA
CCTGACAATGACGATCAGAAAATGTATTTGGCTGTCATTAGGGAAGTCAC
CAAAAAAGAAGGTGACAAAACGAACCGTTATCTAGTGGAGTTTACGGATG
GATCCAAGAAGAGAGTGACGCCCAGCCGGATCCGTATACTTTCTCAATAC
GGAAGTGCAGAAACGAGTGAAGAAAATGCTGACATTATCACAACAAGACA
GGAGGAACTAGTTCTCGATGTGCAAGGTATCTCATTACGTGTGGAAGGTT
ACTTGGGAGGCGTGTTGACACCCATGCTCAAAATGGATTCCAAAATCACA
GCTAACTTGAAGGATTGGTCAAGCCAAATGAATGCACACGCTACTGTATC
ATTAGAAGCCAGTTATTATAACGAAAACGTTGCCGAATGGGAGCCAGTTA
TTGAACCTTTGATGGAGAAACGGAGGGAAAGACCGTGGCAACTCTCTGTC
AATTACACGATGGAAGGTGACGACAATTCTGCTTCATCCACTTCCAACGA
ACTCGTTTTACAAAAACCGGAATCCAACCTGAAAATCAAATCTCAAGATA
ATCTTGAATTGACAATTTCAAAATCATGTCTTGCTTTACTCGGTGAATTG
GGACAGGTGTTTGGAGATGCAGTAGAATCTGTGGACGTTTTACCACAAGT
CCTGGTCGAAAAAGAACCTTTCATGATCGAAAACTTGCTCTCCAAGAAGG
TGACAGTAACATTGAATGAACTTCTGCAGGGACCAAATGGAGATTCGACA
ATCGAGCTAGCATCTTCTTCGAATCCTGTTGGCATTACTTTTGCTCCCAa
gaaatttgagaaacgaaAGACCAACGATCTATACACAATCAATTTAtcgG
TGGACGGTTTTCATGACATTAAAGACATTGTGGTTCAAAGAAAGCGAAGC
GTTATCTATGATCTTGTACCAATAAAACTATTATCAGCACAGTCTTCATA
TTCGATAGTGGTACAAGTGAAGACAACAGACGGACAACGTATCATCGTAC
TCCGATCACCATTGCAGTTGAAAAATCACTTTCCAATGCCGTTGGATGTC
AGCTACATTTCCAAAGAAAACCAACCAGTTAAACTGACAACAGTGGGATC
GGGAGATATCTATTCCTTCCCTTTGTTGTTAACCTACCACAGTGTTTTTC
ATCTCAAACCTGCTGGTTTCGACTACGGTGATTGCACAGAAGCTCTCAAT
TGGAGTGATTTGAAGACGAGCAACGAAAAACAGTTCTCCTGCCCTTCACC
TGACAAAAGTGCTGACCCTTTCTACATGCAGGTGGTGATGAAAGAGGAGA
CGTACTCTTCCGTACACGGCATGTTGGACTGTGTACCACGTTACACGTTG
GAGTGCTTTCCCGTCATCACGCTGCATAATTACCTACCTTGCACTATTAA
TTATAAGATCAAGGGTATGGCGAAATCGGAAAGTCTACCAGGCGGACACA
ATTGGCCTTTGTTTACCGTCAACTTCAGTGATAAACCTTCCATCTATATC
GAGATTGAGTCGTATAACAACCAAAGATGGGAAGGAGGTTTGACATTACC
AACAAAACCGGTAGATTCTTTGAACAAACCATCATTATCTTTCGTCATGA
TGTCTGGTGAACGCAAAATGGAATTGGGTGTTTATTACCAGTTAGACGGT
TCATTGAACATCACCTTATATTCGCCTTACTGGCTTCTCAATAAAACTGG
AAAACCACTTGTCTATCAGCCAGCGGGGAGCAGCATCCAGCAAGTTCACC
AAGAGAACGATGTAAATGCTCTTATGATGCTCGTCAAAGGGAAACATAAA
AAGgcgaaagtgaaagtgaaaaataGCGAGTCATGGTCAAATGAATTTTC
ATTGGATACTGTTGGCAGTGGTGGTTCCTTGAAATGCAATGGTCCAAGAG
ATCGAGTTTATGAGATTGGTTTGAACATCAGTTTGTCATACTTTGGATTG
ACGAAGATTGTGACGTTCACGCCACTCCGAATGTTATCTAACCACACCAA
GTACACCATCAGTATGGCAGAAAGTAATTCTAAATCGTCAGAATGGCACA
CGGTAAACCCTGACGAGaacattccatTCTGGCCGACGAAACTTCCTTTG
GTCAACCTTTACATTAACATCAATGGGCAAGATTCAGTGAAATTCAACCC
TGAAGTTGGAAAAACTTTACTGTTGAAGTTCCAGAATGAGGTTGGAGGAG
TTTGCGTGGATTACCAAGAAAAGGACTCGTCCTCAGTCCTTTCGTTTAAT
CCGTACTTCGCAGGTGCAGCTCCTGTGCGGCttgaaaatctttgcaaaaa
GATCGGCATGATCGCTTATAAACAAGCAGGTTCGGTAATGGGTCACGTGT
TAACACATGACCAATCAGTGTTGTACACGTGGGATGATCCAACCATGGAA
CAAGAATTGATTTGTTCCATTGTCAATGATGAAGCCAGTGAAACAAGGAT
CAAACTCGATGCCAACGATTTCGGACGAATGAGAGTTGGAGATGGTGCAA
TTTATTGGGTTTCCTTTCTGGATGGTCTTCAACGTGTTCTATTGTTCACT
GATAACTTCAAATCTGCTTACTGCGCATGTCAGgaGCAAAATTTACGCCC
AACCATGGAAGTTGACTTTGAGATTGAGAGTTTTGGTTTGTCTCTGGTCA
ATGTTGATAAGAGAATGGAGATTGGCTACTTAGCTATCCGACAAAGCAAG
ACTGTATGGGAGCAACGCAAGAAAAAGAACCGCTGGAAAGCTTTACCGCT
TGCCATGTGTGAAGCTCTCGAAGAAGGTTATCTCAATTATCAAAACAGAA
AAGGTGCAGTCAAAGAGAAAGTTCTGGATAAGGAGGTGGATTACGAGAAG
ATGTTTATTACGAAACCTGAGAAGATTAAGATCAGAAGAACGTACCACAG
CGGTCTTGGTTTCAAATACACAATCTCACCCAATGAAATGCGTGTGCATG
CTTCTATCAGCTCAATACAGTTGGATAGCCATGTTCCAGGTTCGACCTTT
CCAACAGTCTTGCATATGGTTGAACCACCAAAATCTGTTGCTTCAGAAAA
CGCTCCAAAGCCATTCTttgaattgagtttaatgaCAAGGATCGGTGATA
AAAATGTGGTCAATGAAGTcagCTATTGTCACGTGTTGATTCAAGAGATG
GATGTGAGGGTTGATATTGGATTTTTATTGGCTCTGATGGAACTCTTCAG
TCATGCAAGAGCTCGAACAACCGAGAAAGAACAATACGCGCTTGATATTG
GCCAAGCAGCAACAAAGTTTGAAGAAAGCGCTGAATTTCAGGCAGCCAAA
CAAGATCGATATTACGTTTTGAACGACTTTCATTTATCACCGCTAAAGAT
TCACGTCAGTTTCTCTTTGACGGGTGGTTCCAAAGATGAAAATGCTATTG
CTTCATTACATGGTAACGTGTTGAACTTGTTGTTACAAAGTGTCGGACTG
GCCTTCACTGAAATACAAGACGTACAATTCAAATTAGCATGTTACGAAGT
GCATAAGTCCATGCAGAGTAATTCGCAGCTCGGTGATGGAATAACTAAAC
ATTATCAAACACAGGCTATCAAGCAACTTTATGTGTTGGTACTCGGGCTA
GACGTTCTTGGTAATCCGTATGGTTTGATATCTGGTGTTGGAACCGGAGC
AAAGAATTTCTTCTACGAACCTTACCAGGGATTAATTCAAGGACCAGAAG
AATTTGCGGAAGGATTGGCGTATGGGGTGAAGAGTCTTGTTGGTGGAACC
GTGGGTGGAGTATCAGGAGCTGTGAGTAAGATTACCGGTACCTTCGGTAA
AGGTTTGGCTGCATTGACCTTGGATGAAGAATATCAACAAAAGAGACGTG
AAAACATGAGCCAACGCCCAACTAACCTCGGTGAAGGTCTCGCCAAAGGT
GGTAAAGGCCTTGTAAAGGGTATCGTGTCTGGTGTTACAGGGATCGTTAC
CAAACCCTATGAAGGTGCCAAGAATGATGGTGCAGGTGGCTTTTTTAAGG
GCGTTGGAAAAGGCCTGATTGGCGTGGTTGCACGCCCTGTTGGTGGAGTG
GTAGATATGGCCAGTAACACGTTTGATGGTTTGAAAAGCACGACATCTGG
CGTGAAAGCGATCGAGTTGAGCCGTGTTACTCGCGTCTTCCACGCAGATA
AGGTTTTACGACCTTTCAATCTGTACGAAGCAGATGGAAACAAAATTCTT
ATGCAATGTAACAAAGGAGAATACGCCAAGAAGAATTTTTATATCACTCA
TGTAGTGGACAAGAAGAACTATCTCATCCTCACTCAATCaaacATTTTGT
ATGTTGGAAAGAACGAGTTGAAAATGGGTGAATGGGAATCggtttgggtt
atcgagttcaATGAGCTAAAACGTGAACCAGAAGTGAAAGAGACAAAGAT
TATTTTCCATATCCATAATACGGACACGCGACGTTCAATTTTCAAGAAAT
CGACGAACACACGTGAAGTGATATTGGAGTCTAGTGCTGTTGCAGACTGG
TTTATCTTAAAGCTTAGAGATGCTAAAATGTTATAGatggtatttgaaTC
TTTGGTTGCTGACCTCTTGAACAAGTATCTGGGTCAATATGTGAAAAATC
TTGATGCTTCTCAATTGAAGATTGGCATTTGGGGAGGAAATGTTGTCCTG
ACAGAACTTGAACTGAAAGATACAGCTCTGGATGATCTTGACTTACCCAT
AAAAGTTGTTCGTGGATATTTGGgtAAATTGGTCTTGTCCATCCCATGGA
AAAATCTTTACACTGAATCAACTGTTGTCGATATTCAAGATCTCCACCTT
GTCGCTAAGCCTAATTTTGACATCAAATACAATGAAGAACgcgaagaaaa
atcaaaacatgacAAGAAACAACAACAGATTCACAATATCGAAGAAGCGA
GGCAAAGAGAAGAAGACAAAAAGAAAGGCGCCAAGAAAGAAGAGAGTGAC
GGTTTTGCTGAGAAACTTGCAACAAACGTCATAAAAAATCTACAGGTTAC
GATCAAGAACATACATGTTCGATATGAAGACTCAATCAGTGATGTGAATG
GACCCTTTTCAGTCGGTCTTACAATGGAAAGTTTAACAGCACAAACCACA
GATGAAGATTTTGTTCCAAAGATTATCAAAGAATCTGTCTCATTAATTCA
TAAGatggTGAAATTAGACAATTTGGCTTTATATTGGAATCCAGGAGACG
AACTGATTGATCCTTCACTTGATACCAAGCAATGGTTGgaagtTTCAACG
AAGCAAATTTCAACACACCAATCGAAGCCAGAGAAAACGAAATATATTTT
GAGTCCCATGGTTGCAACGAAGAAATTGAAGCTGAACACCAAACCAGGTT
CCAACCTTGACATCCCGAAGatgttTTTGAACTTGGTTTTGGAAGAACTT
GGTATCATCGTGGCAAGAAGTCAATATCATGGCGTGGTGCAACTGATTGA
ATCATTTGAACGAATGAATAGGAACCAACCTTTTCGTAAATACAGACCAC
ATACCTCCGTTCTTGGGAACGAAAGTATTTGGTGGAAGTACTGCATGTCC
AGCATACTGGAGGTGGATGTCAAAAGACGATCTCAAATGTGGAGCTGGAA
GCATATTCAAAAACATCGAGTTCTTTGCAAAGCTTACAAAGTGAAGTAca
aggaaaaattgaaacagaaaaATCCATCCAAACAAATTCTCACTGAACTA
GAGaGCATGGAGGATGAGTTGAATATTGCAAGCATCACCATTTTTCGACA
GCTTGCAGCTACAGAGGTTTTAACGGAACAAAAGAAGAAAGGCACTAAAG
GAAGTTTCTTCAGTTTCTTCTCCAGATCAAAAGAACCAGAAAAGTCTGCT
GCTAATAAAATTGGAGATTTAATGGGTGATGACCAGGAGAAGGAAATGCA
GAAATTGTATGACGCAATCGGTTATACTGAAAATGAAGTCATCACTCCCT
TTCCTAAAGAGTACGTGGCGATGTCAGTGGAATCGATTCTCCAGAAATTA
TTCATCAGCCTCATCGATGACACAGATAAGGCGAAAGAATTCAAAGTGTT
GGATTTTTCACTCAACAACATCATTGTAGAAGTTTTCCAAAGACCTTCTG
CTCAAGCTCTCAAATTATGTGCAAAGATAGGAGAGATGAAGTTATTTGGT
ACAGCTTCTGCTCAATGTACACCTCtcatcatcaaaaacatgttaCAAGG
TCGAGGTATGGAATTTCTGCCGTTGGTGGACTTCATCTTTGAGACGAATC
CTTTGAAGAAACCGGACATTGACCAATGTATCACTGCTATTTGTCAACCC
TTAGAAATCATCTATGATGCTAACACGATCAACCATATCATTAGTTTCTT
CAAACCTCCTGAACATGTTATCTTGCAAGATTTACAAGACAAAGCGTATT
CTACTTTCGAAGATTTTAAAGTTTCAAGTACGGCTGGTCTTCTACATGCT
ATGGAACAAAGAACGGTTATGGACATCGACATTGATGTTGGAGCATCTCA
TTTGATCATCCCTGAAAAAGGTTCTTACAATGGTTGTACAGATATGCTGG
TGATCGACTTTGGTAAAATCACGATGAGCAGCGATCCTAGTCAAATCAGA
CACCTTGACCCTAAGGACATTGAGGATGTGAATGAAGTACAAAGCAAAGC
TTATGATCGATTCTTGTTGTCGCTTCAAGCTCTTCAAATATTACTCGTTA
GAGAAGGTGAAGATTTAAAGAGTGCTAAAAGCAACGTCAGTAAAGCTTCA
TCACACATTTTGCATCCCATCAATTTCGATGGCAAACTTGCCAAAGCTAT
ACTTCCACAAGATCCACGTTTAAAACAGATATGTGTCTCTGGTGAATTAT
CTTCGCTGTTTGTTTCTGTATCGGATGATAAAGTCAGTCGTCTCATCAAG
CTAGCAGACTCGATACCACTCCCTCAATCACCTTCTCACGATAACATCGA
CGGAGAAGAAAAACCTGAAGGACTCTTCACCAAGGCGTTGTCAATGATAA
GCTTGACAGGTGACAATGACACAGGGGTGGACATCGGAGGATTTTCCATC
CCTGTACCGACATCTCCAACATCAGTGACGTCAGATGAAGATGAATACGG
GACACCACCTGATGGCTCCATATTACAGTTACAACAAGAAGCTGGTCCGG
ACTTTTCATCAGGAGTGGCGAACCAAGTCAAAGTGGACTTGAACTTTAAA
ATCCATAAAGTGATGATCGCCATTGGTTTGACTGACAAAGCATTGAAACA
GGAAAAAGAATGTCTGAAATTCATCGTGGACGACATCAATACAGAGgtGA
TACTACGAAGATGGGATTTGTTCGTCAATGCAGAAGTTGGTCGTCTGGTG
TTGAATGAAATGACATGGGGTGTTGATGGAGAACCTTTCGCCATCATGAG
TACacccaaaaacaccaaaatgttGAAATTCAGCTATCGGAGGTGTGAAT
TCAACGAAAGTTTGAATCTCGGTCCAAGTTACTTTTATTCCAAAGAAGCG
CAAGTCAGAGCTTTACATTTCAAAGATGAATTTGGCGCCACGGATCAGAT
TTTAGATGTACAAGTGGCTACTTTATTTCTGATGCTTCATCAAGAAGCAC
TTTTGAGCATCATGTCATTGATCTACCAAGTACTGGAACCACTCAACAAA
CATGATAAGGAAGCCACACAGAAGATCAAACGGAGTTTGAGTACGGCAGG
TAGTCGTTTGAGTCTCTCCatcgaagaaaaagaaaaggagaGACAGATAC
AACGAAAATTAGCCAACCCTAAAGCACTGGAAGCTGCCAACGAACTTAAG
CAACAGGTTGGcttagaagaagaaaaaaagatgaGAGTGACCGCCCACCT
GGATGGTGTTGGTATCATGATTTGTTCAGCCAAAGTTGACCTTGCACAAG
CCTTCGTTAAAGGGTTATCTGCTAAAGTACTGATGAAAGATGACTTATTA
GAAGTGAAAGCCAGCATGAAAGATATGCAAGTACAAGATAATGTTGGCGA
AACAAAGTACAAAGACATCATTAGCATGCGATCTGATGAAGTGTTCGATT
TAGAGTTGGCTATTTACGAGAATGGATCTTCTGGTAGCAAGCAATACGAT
ATGTCGTGTGTCGACACCAGTGTCAAACTGAACTTCGGTCAAATGCGCGT
TGTTTTCTTGTATAGATTCATACAAGACTTAATGTCATTCACCGAAAACT
TCGAAGAAGCACAGAAAGCAGTTGTGGAAGCTGGTAAAGCTGCCAAGGAT
AAAGCTCTGGAAACAGCGACCGATTTGAATAGACATTCTTCTCGTGTCAA
ACTAAATGTGGTTCTGAAAGCACCGACTATTATCATTCCAGTTGGATCAA
ACAATGAATTGGCTTTACTGGTGGATCTGGGTGAATTGCGTATTTACAAC
ACATTCAAACTCCTCAACGATGATCAATACCATAAGAAATCTATCATCAC
TGATAACATGACCATTAAGTTATCCAATCTGAAATTGTTAAAAGCACTTA
TTCAAGATGGTAAAGATTTCTTGCATCAACGAGCCATTATTGAACCTATG
ATGCTACAAATAACTATTGTTCGTAATTTAACGAAAGGTAACCATTCCAT
ACCGGATGTTTCAGTTCAAGCAAAGATGCCAGCTATTCTGTTATCAATCA
GTGAAGAAGATGTGACCGTAGCTCTAAAGATTGTCCAAGGGAATCTCGCC
GAAGGTGAGTCACATGCGCCGAAGAAGCAAGCCAAGCCTGCCAAACAAAC
GTTAAACGTGCCACAAGATCGTTTAGCAGACATTTACGAGGAGcctgaag
atgaagatgagaaTCGACAAGGATATCTTCAAACCAAACTATCCTTCGAT
CTGGCTAAAATTGACATCAAGCTTTACTTGAAACCATCTGATATGACATT
TGAAGATGAATTTTTAGCGAGGACGGATGATTTGTTGTTAGCTTTGTTCA
CTATTGGTAACCTGTGTGTTGATGGAGACATCATGTCCACGCAAGCTATG
AAGATGAGCGTTCGATTGGACACTTTGGTGTTGGATGATATGAGACCTAT
CGAGGAGCATGAAGGTGTTAAACGTATGATCAACTACAGTCCCGAGCCAC
TCCTTGAAGAAGTCAAAACCTCTTCTCATAAACGACCAATCGACAACTCA
CGAATGATCGAAATCCAAttcgatcaaacttcatcgcaagataaaaatat
cgacATCAAACTTTGTAACATGCTTTGTATATTCAACGTTGAGTTTATCA
TGGTCCTGTTGAAAACGTTGCAAGCTGCCATACCTAAAGATGATAGTCTG
CAACATGGCCATTCAATGAGTAGTCTAGACTCGGCGGCAGGGTCTGGCGG
CAGCGATGACGAGGACTCTTTAGAAGCCAGCGAGATTGTCCTCTGCACTG
GTGATCAAGAAAGACCTGAGACTAAAGTCTCTATCTTCGTCCATAACCCG
CAAATTGTTTTACTAGCAGATGCAAAGGATGTCAAAACAAATGCACTCTT
TCTTACAACCGagatcaattttcaatatttcgaaTTGCGAGATACTCAAA
AAATGATTGGCGCTGTTTCTAACACCGCTATTTTGTCAACTGCTTTCAAG
AATGACCATCGGAGTGATATATCAACAGTGTTGTCATTAGATTCCATCAA
TCTCCACTCGTCATCACCCATCAATGGTAAACCTCATATGAGTGTCAGCA
CAACTTTGATCAAACTGAATATCTCACCCAAAACCATCCGAACTTTATCA
GCGTGTGCTGGTTACATCTCCAATGATCCAACAGATGAAGAAATCAAAGA
AGCTCGAAAAGCCATGCGTGATTTATGGCAAATTCAAACGTTCACCAATA
AGCGACCGTGGTATTTAAACCACCCACCACAACAAGTCTTAAGTGCTGGC
AGCTTCGTCCTTGCGCGAACGAGAACAGGAGAATATAAGCATGGTTTCTT
AGCTAAAAAGGATGTCTCGTATCAAGTCTATTTTTCAGAGGAGCGAGGAA
CAGCCAGTCACCGAGCCATGGATATCTCATCTGTTGTTTTGGATATCGTA
CCGCTGATCGGTGATCTATGTGTTGGATGTAATGTTTTAGCTGTGGAATC
GAAAGAACATGGATATCGTACTGGTCGAATTACTCAGGTTTGGGATTCGA
ATGTGGATAAAGATTCTTCGGATGGCGCCAAACAATCTGTTTCTGTCAAG
ACAACTGCTATTGCTCCAATCAAATACCTTGTCAATTTCTATGACAACCA
AACGGAGAACTTCTTCCCGCCTGATGAACTTCGTATCATTGGTAAACCCA
TCAAGGGGGTTGTCCCTGGACTAGGGGCGTGTGTTTACGCCCGCTTTAAT
GATGGTTTTTACTATCGGGGCAAAGTTGATGACATCGAGGATTATCGAAT
CCGAGTGCAATTGGATGAGATCAGTGGAGAAATCGAACACGACATCGATG
ATCCGTCAGCCGTTATTTTGAACCTGACGCCTCAATACCGTCAAGTCAAA
AAGCATTTCAAAGTCATTGCATCCAAAGGAAGCACAACTAAAGGATATCA
TCCGGGGAAAGTGACCGCCATCCAAGGTGAAGGAAATAACCGATTGTATT
CGATACGCTTCGAAGACGGTACAATTAACCAAGTACCCATCacgaaattg
attttgatgccAAAAGCACCTTTTGATGCTTTACCTGAAGTTGGCACATA
CGTTTATTCCCGAGTGTCACGCGACGCTCCTTTATACGAGAAGGGTATCG
TAGCAGAGAAGAACACAATGATCTGCGTTAAACATTTAAATGGACGGAAA
TTGGCTCACGAAATACAAAACATTCATTTTGTTGTCCGAAATATCGTTCC
TCTCGTGTCATCAttgaagGTTGGTTTGGACGTCATAGTGCAACCTGACA
ATGACGATCAGAAAATGTATTTGGCTGTCATTAGGGAAGTCACCAAAAAA
GAAGGTGACAAAACGAACCGTTATCTAGTGGAGTTTACGGATGGATCCAA
GAAGAGAGTGACGCCCAGCCGGATCCGTATACTTTCTCAATACGGAAGTG
CAGAAACGAGTGAAGAAAATGCTGACATTATCACAACAAGACAGGAGGAA
CTAGTTCTCGATGTGCAAGGTATCTCATTACGTGTGGAAGGTTACTTGGG
AGGCGTGTTGACACCCATGCTCAAAATGGATTCCAAAATCACAGCTAACT
TGAAGGATTGGTCAAGCCAAATGAATGCACACGCTACTGTATCATTAGAA
GCCAGTTATTATAACGAAAACGTTGCCGAATGGGAGCCAGTTATTGAACC
TTTGATGGAGAAACGGAGGGAAAGACCGTGGCAACTCTCTGTCAATTACA
CGATGGAAGGTGACGACAATTCTGCTTCATCCACTTCCAACGAACTCGTT
TTACAAAAACCGGAATCCAACCTGAAAATCAAATCTCAAGATAATCTTGA
ATTGACAATTTCAAAATCATGTCTTGCTTTACTCGGTGAATTGGGACAGG
TGTTTGGAGATGCAGTAGAATCTGTGGACGTTTTACCACAAGTCCTGGTC
GAAAAAGAACCTTTCATGATCGAAAACTTGCTCTCCAAGAAGGTGACAGT
AACATTGAATGAACTTCTGCAGGGACCAAATGGAGATTCGACAATCGAGC
TAGCATCTTCTTCGAATCCTGTTGGCATTACTTTTGCTCCCAagaaattt
gagaaacgaaAGACCAACGATCTATACACAATCAATTTAtcgGTGGACGG
TTTTCATGACATTAAAGACATTGTGGTTCAAAGAAAGCGAAGCGTTATCT
ATGATCTTGTACCAATAAAACTATTATCAGCACAGTCTTCATATTCGATA
GTGGTACAAGTGAAGACAACAGACGGACAACGTATCATCGTACTCCGATC
ACCATTGCAGTTGAAAAATCACTTTCCAATGCCGTTGGATGTCAGCTACA
TTTCCAAAGAAAACCAACCAGTTAAACTGACAACAGTGGGATCGGGAGAT
ATCTATTCCTTCCCTTTGTTGTTAACCTACCACAGTGTTTTTCATCTCAA
ACCTGCTGGTTTCGACTACGGTGATTGCACAGAAGCTCTCAATTGGAGTG
ATTTGAAGACGAGCAACGAAAAACAGTTCTCCTGCCCTTCACCTGACAAA
AGTGCTGACCCTTTCTACATGCAGGTGGTGATGAAAGAGGAGACGTACTC
TTCCGTACACGGCATGTTGGACTGTGTACCACGTTACACGTTGGAGTGCT
TTCCCGTCATCACGCTGCATAATTACCTACCTTGCACTATTAATTATAAG
ATCAAGGGTATGGCGAAATCGGAAAGTCTACCAGGCGGACACAATTGGCC
TTTGTTTACCGTCAACTTCAGTGATAAACCTTCCATCTATATCGAGATTG
AGTCGTATAACAACCAAAGATGGGAAGGAGGTTTGACATTACCAACAAAA
CCGGTAGATTCTTTGAACAAACCATCATTATCTTTCGTCATGATGTCTGG
TGAACGCAAAATGGAATTGGGTGTTTATTACCAGTTAGACGGTTCATTGA
ACATCACCTTATATTCGCCTTACTGGCTTCTCAATAAAACTGGAAAACCA
CTTGTCTATCAGCCAGCGGGGAGCAGCATCCAGCAAGTTCACCAAGAGAA
CGATGTAAATGCTCTTATGATGCTCGTCAAAGGGAAACATAAAAAGgcga
aagtgaaagtgaaaaataGCGAGTCATGGTCAAATGAATTTTCATTGGAT
ACTGTTGGCAGTGGTGGTTCCTTGAAATGCAATGGTCCAAGAGATCGAGT
TTATGAGATTGGTTTGAACATCAGTTTGTCATACTTTGGATTGACGAAGA
TTGTGACGTTCACGCCACTCCGAATGTTATCTAACCACACCAAGTACACC
ATCAGTATGGCAGAAAGTAATTCTAAATCGTCAGAATGGCACACGGTAAA
CCCTGACGAGaacattccatTCTGGCCGACGAAACTTCCTTTGGTCAACC
TTTACATTAACATCAATGGGCAAGATTCAGTGAAATTCAACCCTGAAGTT
GGAAAAACTTTACTGTTGAAGTTCCAGAATGAGGTTGGAGGAGTTTGCGT
GGATTACCAAGAAAAGGACTCGTCCTCAGTCCTTTCGTTTAATCCGTACT
TCGCAGGTGCAGCTCCTGTGCGGCttgaaaatctttgcaaaaaGATCGGC
ATGATCGCTTATAAACAAGCAGGTTCGGTAATGGGTCACGTGTTAACACA
TGACCAATCAGTGTTGTACACGTGGGATGATCCAACCATGGAACAAGAAT
TGATTTGTTCCATTGTCAATGATGAAGCCAGTGAAACAAGGATCAAACTC
GATGCCAACGATTTCGGACGAATGAGAGTTGGAGATGGTGCAATTTATTG
GGTTTCCTTTCTGGATGGTCTTCAACGTGTTCTATTGTTCACTGATAACT
TCAAATCTGCTTACTGCGCATGTCAGgaGCAAAATTTACGCCCAACCATG
GAAGTTGACTTTGAGATTGAGAGTTTTGGTTTGTCTCTGGTCAATGTTGA
TAAGAGAATGGAGATTGGCTACTTAGCTATCCGACAAAGCAAGACTGTAT
GGGAGCAACGCAAGAAAAAGAACCGCTGGAAAGCTTTACCGCTTGCCATG
TGTGAAGCTCTCGAAGAAGGTTATCTCAATTATCAAAACAGAAAAGGTGC
AGTCAAAGAGAAAGTTCTGGATAAGGAGGTGGATTACGAGAAGATGTTTA
TTACGAAACCTGAGAAGATTAAGATCAGAAGAACGTACCACAGCGGTCTT
GGTTTCAAATACACAATCTCACCCAATGAAATGCGTGTGCATGCTTCTAT
CAGCTCAATACAGTTGGATAGCCATGTTCCAGGTTCGACCTTTCCAACAG
TCTTGCATATGGTTGAACCACCAAAATCTGTTGCTTCAGAAAACGCTCCA
AAGCCATTCTttgaattgagtttaatgaCAAGGATCGGTGATAAAAATGT
GGTCAATGAAGTcagCTATTGTCACGTGTTGATTCAAGAGATGGATGTGA
GGGTTGATATTGGATTTTTATTGGCTCTGATGGAACTCTTCAGTCATGCA
AGAGCTCGAACAACCGAGAAAGAACAATACGCGCTTGATATTGGCCAAGC
AGCAACAAAGTTTGAAGAAAGCGCTGAATTTCAGGCAGCCAAACAAGATC
GATATTACGTTTTGAACGACTTTCATTTATCACCGCTAAAGATTCACGTC
AGTTTCTCTTTGACGGGTGGTTCCAAAGATGAAAATGCTATTGCTTCATT
ACATGGTAACGTGTTGAACTTGTTGTTACAAAGTGTCGGACTGGCCTTCA
CTGAAATACAAGACGTACAATTCAAATTAGCATGTTACGAAGTGCATAAG
TCCATGCAGAGTAATTCGCAGCTCGGTGATGGAATAACTAAACATTATCA
AACACAGGCTATCAAGCAACTTTATGTGTTGGTACTCGGGCTAGACGTTC
TTGGTAATCCGTATGGTTTGATATCTGGTGTTGGAACCGGAGCAAAGAAT
TTCTTCTACGAACCTTACCAGGGATTAATTCAAGGACCAGAAGAATTTGC
GGAAGGATTGGCGTATGGGGTGAAGAGTCTTGTTGGTGGAACCGTGGGTG
GAGTATCAGGAGCTGTGAGTAAGATTACCGGTACCTTCGGTAAAGGTTTG
GCTGCATTGACCTTGGATGAAGAATATCAACAAAAGAGACGTGAAAACAT
GAGCCAACGCCCAACTAACCTCGGTGAAGGTCTCGCCAAAGGTGGTAAAG
GCCTTGTAAAGGGTATCGTGTCTGGTGTTACAGGGATCGTTACCAAACCC
TATGAAGGTGCCAAGAATGATGGTGCAGGTGGCTTTTTTAAGGGCGTTGG
AAAAGGCCTGATTGGCGTGGTTGCACGCCCTGTTGGTGGAGTGGTAGATA
TGGCCAGTAACACGTTTGATGGTTTGAAAAGCACGACATCTGGCGTGAAA
GCGATCGAGTTGAGCCGTGTTACTCGCGTCTTCCACGCAGATAAGGTTTT
ACGACCTTTCAATCTGTACGAAGCAGATGGAAACAAAATTCTTATGCAAT
GTAACAAAGGAGAATACGCCAAGAAGAATTTTTATATCACTCATGTAGTG
GACAAGAAGAACTATCTCATCCTCACTCAATCaaacATTTTGTATGTTGG
AAAGAACGAGTTGAAAATGGGTGAATGGGAATCggtttgggttatcgagt
tcaATGAGCTAAAACGTGAACCAGAAGTGAAAGAGACAAAGATTATTTTC
CATATCCATAATACGGACACGCGACGTTCAATTTTCAAGAAATCGACGAA
CACACGTGAAGTGATATTGGAGTCTAGTGCTGTTGCAGACTGGTTTATCT
TAAAGCTTAGAGATGCTAAAATGTTATAGatggtatttgaaTCTTTGGTT
GCTGACCTCTTGAACAAGTATCTGGGTCAATATGTGAAAAATCTTGATGC
TTCTCAATTGAAGATTGGCATTTGGGGAGGAAATGTTGTCCTGACAGAAC
TTGAACTGAAAGATACAGCTCTGGATGATCTTGACTTACCCATAAAAGTT
GTTCGTGGATATTTGGgtAAATTGGTCTTGTCCATCCCATGGAAAAATCT
TTACACTGAATCAACTGTTGTCGATATTCAAGATCTCCACCTTGTCGCTA
AGCCTAATTTTGACATCAAATACAATGAAGAACgcgaagaaaaatcaaaa
catgacAAGAAACAACAACAGATTCACAATATCGAAGAAGCGAGGCAAAG
AGAAGAAGACAAAAAGAAAGGCGCCAAGAAAGAAGAGAGTGACGGTTTTG
CTGAGAAACTTGCAACAAACGTCATAAAAAATCTACAGGTTACGATCAAG
AACATACATGTTCGATATGAAGACTCAATCAGTGATGTGAATGGACCCTT
TTCAGTCGGTCTTACAATGGAAAGTTTAACAGCACAAACCACAGATGAAG
ATTTTGTTCCAAAGATTATCAAAGAATCTGTCTCATTAATTCATAAGatg
gTGAAATTAGACAATTTGGCTTTATATTGGAATCCAGGAGACGAACTGAT
TGATCCTTCACTTGATACCAAGCAATGGTTGgaagtTTCAACGAAGCAAA
TTTCAACACACCAATCGAAGCCAGAGAAAACGAAATATATTTTGAGTCCC
ATGGTTGCAACGAAGAAATTGAAGCTGAACACCAAACCAGGTTCCAACCT
TGACATCCCGAAGatgttTTTGAACTTGGTTTTGGAAGAACTTGGTATCA
TCGTGGCAAGAAGTCAATATCATGGCGTGGTGCAACTGATTGAATCATTT
GAACGAATGAATAGGAACCAACCTTTTCGTAAATACAGACCACATACCTC
CGTTCTTGGGAACGAAAGTATTTGGTGGAAGTACTGCATGTCCAGCATAC
TGGAGGTGGATGTCAAAAGACGATCTCAAATGTGGAGCTGGAAGCATATT
CAAAAACATCGAGTTCTTTGCAAAGCTTACAAAGTGAAGTAcaaggaaaa
attgaaacagaaaaATCCATCCAAACAAATTCTCACTGAACTAGAGaGCA
TGGAGGATGAGTTGAATATTGCAAGCATCACCATTTTTCGACAGCTTGCA
GCTACAGAGGTTTTAACGGAACAAAAGAAGAAAGGCACTAAAGGAAGTTT
CTTCAGTTTCTTCTCCAGATCAAAAGAACCAGAAAAGTCTGCTGCTAATA
AAATTGGAGATTTAATGGGTGATGACCAGGAGAAGGAAATGCAGAAATTG
TATGACGCAATCGGTTATACTGAAAATGAAGTCATCACTCCCTTTCCTAA
AGAGTACGTGGCGATGTCAGTGGAATCGATTCTCCAGAAATTATTCATCA
GCCTCATCGATGACACAGATAAGGCGAAAGAATTCAAAGTGTTGGATTTT
TCACTCAACAACATCATTGTAGAAGTTTTCCAAAGACCTTCTGCTCAAGC
TCTCAAATTATGTGCAAAGATAGGAGAGATGAAGTTATTTGGTACAGCTT
CTGCTCAATGTACACCTCtcatcatcaaaaacatgttaCAAGGTCGAGGT
ATGGAATTTCTGCCGTTGGTGGACTTCATCTTTGAGACGAATCCTTTGAA
GAAACCGGACATTGACCAATGTATCACTGCTATTTGTCAACCCTTAGAAA
TCATCTATGATGCTAACACGATCAACCATATCATTAGTTTCTTCAAACCT
CCTGAACATGTTATCTTGCAAGATTTACAAGACAAAGCGTATTCTACTTT
CGAAGATTTTAAAGTTTCAAGTACGGCTGGTCTTCTACATGCTATGGAAC
AAAGAACGGTTATGGACATCGACATTGATGTTGGAGCATCTCATTTGATC
ATCCCTGAAAAAGGTTCTTACAATGGTTGTACAGATATGCTGGTGATCGA
CTTTGGTAAAATCACGATGAGCAGCGATCCTAGTCAAATCAGACACCTTG
ACCCTAAGGACATTGAGGATGTGAATGAAGTACAAAGCAAAGCTTATGAT
CGATTCTTGTTGTCGCTTCAAGCTCTTCAAATATTACTCGTTAGAGAAGG
TGAAGATTTAAAGAGTGCTAAAAGCAACGTCAGTAAAGCTTCATCACACA
TTTTGCATCCCATCAATTTCGATGGCAAACTTGCCAAAGCTATACTTCCA
CAAGATCCACGTTTAAAACAGATATGTGTCTCTGGTGAATTATCTTCGCT
GTTTGTTTCTGTATCGGATGATAAAGTCAGTCGTCTCATCAAGCTAGCAG
ACTCGATACCACTCCCTCAATCACCTTCTCACGATAACATCGACGGAGAA
GAAAAACCTGAAGGACTCTTCACCAAGGCGTTGTCAATGATAAGCTTGAC
AGGTGACAATGACACAGGGGTGGACATCGGAGGATTTTCCATCCCTGTAC
CGACATCTCCAACATCAGTGACGTCAGATGAAGATGAATACGGGACACCA
CCTGATGGCTCCATATTACAGTTACAACAAGAAGCTGGTCCGGACTTTTC
ATCAGGAGTGGCGAACCAAGTCAAAGTGGACTTGAACTTTAAAATCCATA
AAGTGATGATCGCCATTGGTTTGACTGACAAAGCATTGAAACAGGAAAAA
GAATGTCTGAAATTCATCGTGGACGACATCAATACAGAGgtGATACTACG
AAGATGGGATTTGTTCGTCAATGCAGAAGTTGGTCGTCTGGTGTTGAATG
AAATGACATGGGGTGTTGATGGAGAACCTTTCGCCATCATGAGTACaccc
aaaaacaccaaaatgttGAAATTCAGCTATCGGAGGTGTGAATTCAACGA
AAGTTTGAATCTCGGTCCAAGTTACTTTTATTCCAAAGAAGCGCAAGTCA
GAGCTTTACATTTCAAAGATGAATTTGGCGCCACGGATCAGATTTTAGAT
GTACAAGTGGCTACTTTATTTCTGATGCTTCATCAAGAAGCACTTTTGAG
CATCATGTCATTGATCTACCAAGTACTGGAACCACTCAACAAACATGATA
AGGAAGCCACACAGAAGATCAAACGGAGTTTGAGTACGGCAGGTAGTCGT
TTGAGTCTCTCCatcgaagaaaaagaaaaggagaGACAGATACAACGAAA
ATTAGCCAACCCTAAAGCACTGGAAGCTGCCAACGAACTTAAGCAACAGG
TTGGcttagaagaagaaaaaaagatgaGAGTGACCGCCCACCTGGATGGT
GTTGGTATCATGATTTGTTCAGCCAAAGTTGACCTTGCACAAGCCTTCGT
TAAAGGGTTATCTGCTAAAGTACTGATGAAAGATGACTTATTAGAAGTGA
AAGCCAGCATGAAAGATATGCAAGTACAAGATAATGTTGGCGAAACAAAG
TACAAAGACATCATTAGCATGCGATCTGATGAAGTGTTCGATTTAGAGTT
GGCTATTTACGAGAATGGATCTTCTGGTAGCAAGCAATACGATATGTCGT
GTGTCGACACCAGTGTCAAACTGAACTTCGGTCAAATGCGCGTTGTTTTC
TTGTATAGATTCATACAAGACTTAATGTCATTCACCGAAAACTTCGAAGA
AGCACAGAAAGCAGTTGTGGAAGCTGGTAAAGCTGCCAAGGATAAAGCTC
TGGAAACAGCGACCGATTTGAATAGACATTCTTCTCGTGTCAAACTAAAT
GTGGTTCTGAAAGCACCGACTATTATCATTCCAGTTGGATCAAACAATGA
ATTGGCTTTACTGGTGGATCTGGGTGAATTGCGTATTTACAACACATTCA
AACTCCTCAACGATGATCAATACCATAAGAAATCTATCATCACTGATAAC
ATGACCATTAAGTTATCCAATCTGAAATTGTTAAAAGCACTTATTCAAGA
TGGTAAAGATTTCTTGCATCAACGAGCCATTATTGAACCTATGATGCTAC
AAATAACTATTGTTCGTAATTTAACGAAAGGTAACCATTCCATACCGGAT
GTTTCAGTTCAAGCAAAGATGCCAGCTATTCTGTTATCAATCAGTGAAGA
AGATGTGACCGTAGCTCTAAAGATTGTCCAAGGGAATCTCGCCGAAGGTG
AGTCACATGCGCCGAAGAAGCAAGCCAAGCCTGCCAAACAAACGTTAAAC
GTGCCACAAGATCGTTTAGCAGACATTTACGAGGAGcctgaagatgaaga
tgagaaTCGACAAGGATATCTTCAAACCAAACTATCCTTCGATCTGGCTA
AAATTGACATCAAGCTTTACTTGAAACCATCTGATATGACATTTGAAGAT
GAATTTTTAGCGAGGACGGATGATTTGTTGTTAGCTTTGTTCACTATTGG
TAACCTGTGTGTTGATGGAGACATCATGTCCACGCAAGCTATGAAGATGA
GCGTTCGATTGGACACTTTGGTGTTGGATGATATGAGACCTATCGAGGAG
CATGAAGGTGTTAAACGTATGATCAACTACAGTCCCGAGCCACTCCTTGA
AGAAGTCAAAACCTCTTCTCATAAACGACCAATCGACAACTCACGAATGA
TCGAAATCCAAttcgatcaaacttcatcgcaagataaaaatatcgacATC
AAACTTTGTAACATGCTTTGTATATTCAACGTTGAGTTTATCATGGTCCT
GTTGAAAACGTTGCAAGCTGCCATACCTAAAGATGATAGTCTGCAACATG
GCCATTCAATGAGTAGTCTAGACTCGGCGGCAGGGTCTGGCGGCAGCGAT
GACGAGGACTCTTTAGAAGCCAGCGAGATTGTCCTCTGCACTGGTGATCA
AGAAAGACCTGAGACTAAAGTCTCTATCTTCGTCCATAACCCGCAAATTG
TTTTACTAGCAGATGCAAAGGATGTCAAAACAAATGCACTCTTTCTTACA
ACCGagatcaattttcaatatttcgaaTTGCGAGATACTCAAAAAATGAT
TGGCGCTGTTTCTAACACCGCTATTTTGTCAACTGCTTTCAAGAATGACC
ATCGGAGTGATATATCAACAGTGTTGTCATTAGATTCCATCAATCTCCAC
TCGTCATCACCCATCAATGGTAAACCTCATATGAGTGTCAGCACAACTTT
GATCAAACTGAATATCTCACCCAAAACCATCCGAACTTTATCAGCGTGTG
CTGGTTACATCTCCAATGATCCAACAGATGAAGAAATCAAAGAAGCTCGA
AAAGCCATGCGTGATTTATGGCAAATTCAAACGTTCACCAATAAGCGACC
GTGGTATTTAAACCACCCACCACAACAAGTCTTAAGTGCTGGCAGCTTCG
TCCTTGCGCGAACGAGAACAGGAGAATATAAGCATGGTTTCTTAGCTAAA
AAGGATGTCTCGTATCAAGTCTATTTTTCAGAGGAGCGAGGAACAGCCAG
TCACCGAGCCATGGATATCTCATCTGTTGTTTTGGATATCGTACCGCTGA
TCGGTGATCTATGTGTTGGATGTAATGTTTTAGCTGTGGAATCGAAAGAA
CATGGATATCGTACTGGTCGAATTACTCAGGTTTGGGATTCGAATGTGGA
TAAAGATTCTTCGGATGGCGCCAAACAATCTGTTTCTGTCAAGACAACTG
CTATTGCTCCAATCAAATACCTTGTCAATTTCTATGACAACCAAACGGAG
AACTTCTTCCCGCCTGATGAACTTCGTATCATTGGTAAACCCATCAAGGG
GGTTGTCCCTGGACTAGGGGCGTGTGTTTACGCCCGCTTTAATGATGGTT
TTTACTATCGGGGCAAAGTTGATGACATCGAGGATTATCGAATCCGAGTG
CAATTGGATGAGATCAGTGGAGAAATCGAACACGACATCGATGATCCGTC
AGCCGTTATTTTGAACCTGACGCCTCAATACCGTCAAGTCAAAAAGCATT
TCAAAGTCATTGCATCCAAAGGAAGCACAACTAAAGGATATCATCCGGGG
AAAGTGACCGCCATCCAAGGTGAAGGAAATAACCGATTGTATTCGATACG
CTTCGAAGACGGTACAATTAACCAAGTACCCATCacgaaattgattttga
tgccAAAAGCACCTTTTGATGCTTTACCTGAAGTTGGCACATACGTTTAT
TCCCGAGTGTCACGCGACGCTCCTTTATACGAGAAGGGTATCGTAGCAGA
GAAGAACACAATGATCTGCGTTAAACATTTAAATGGACGGAAATTGGCTC
ACGAAATACAAAACATTCATTTTGTTGTCCGAAATATCGTTCCTCTCGTG
TCATCAttgaagGTTGGTTTGGACGTCATAGTGCAACCTGACAATGACGA
TCAGAAAATGTATTTGGCTGTCATTAGGGAAGTCACCAAAAAAGAAGGTG
ACAAAACGAACCGTTATCTAGTGGAGTTTACGGATGGATCCAAGAAGAGA
GTGACGCCCAGCCGGATCCGTATACTTTCTCAATACGGAAGTGCAGAAAC
GAGTGAAGAAAATGCTGACATTATCACAACAAGACAGGAGGAACTAGTTC
TCGATGTGCAAGGTATCTCATTACGTGTGGAAGGTTACTTGGGAGGCGTG
TTGACACCCATGCTCAAAATGGATTCCAAAATCACAGCTAACTTGAAGGA
TTGGTCAAGCCAAATGAATGCACACGCTACTGTATCATTAGAAGCCAGTT
ATTATAACGAAAACGTTGCCGAATGGGAGCCAGTTATTGAACCTTTGATG
GAGAAACGGAGGGAAAGACCGTGGCAACTCTCTGTCAATTACACGATGGA
AGGTGACGACAATTCTGCTTCATCCACTTCCAACGAACTCGTTTTACAAA
AACCGGAATCCAACCTGAAAATCAAATCTCAAGATAATCTTGAATTGACA
ATTTCAAAATCATGTCTTGCTTTACTCGGTGAATTGGGACAGGTGTTTGG
AGATGCAGTAGAATCTGTGGACGTTTTACCACAAGTCCTGGTCGAAAAAG
AACCTTTCATGATCGAAAACTTGCTCTCCAAGAAGGTGACAGTAACATTG
AATGAACTTCTGCAGGGACCAAATGGAGATTCGACAATCGAGCTAGCATC
TTCTTCGAATCCTGTTGGCATTACTTTTGCTCCCAagaaatttgagaaac
gaaAGACCAACGATCTATACACAATCAATTTAtcgGTGGACGGTTTTCAT
GACATTAAAGACATTGTGGTTCAAAGAAAGCGAAGCGTTATCTATGATCT
TGTACCAATAAAACTATTATCAGCACAGTCTTCATATTCGATAGTGGTAC
AAGTGAAGACAACAGACGGACAACGTATCATCGTACTCCGATCACCATTG
CAGTTGAAAAATCACTTTCCAATGCCGTTGGATGTCAGCTACATTTCCAA
AGAAAACCAACCAGTTAAACTGACAACAGTGGGATCGGGAGATATCTATT
CCTTCCCTTTGTTGTTAACCTACCACAGTGTTTTTCATCTCAAACCTGCT
GGTTTCGACTACGGTGATTGCACAGAAGCTCTCAATTGGAGTGATTTGAA
GACGAGCAACGAAAAACAGTTCTCCTGCCCTTCACCTGACAAAAGTGCTG
ACCCTTTCTACATGCAGGTGGTGATGAAAGAGGAGACGTACTCTTCCGTA
CACGGCATGTTGGACTGTGTACCACGTTACACGTTGGAGTGCTTTCCCGT
CATCACGCTGCATAATTACCTACCTTGCACTATTAATTATAAGATCAAGG
GTATGGCGAAATCGGAAAGTCTACCAGGCGGACACAATTGGCCTTTGTTT
ACCGTCAACTTCAGTGATAAACCTTCCATCTATATCGAGATTGAGTCGTA
TAACAACCAAAGATGGGAAGGAGGTTTGACATTACCAACAAAACCGGTAG
ATTCTTTGAACAAACCATCATTATCTTTCGTCATGATGTCTGGTGAACGC
AAAATGGAATTGGGTGTTTATTACCAGTTAGACGGTTCATTGAACATCAC
CTTATATTCGCCTTACTGGCTTCTCAATAAAACTGGAAAACCACTTGTCT
ATCAGCCAGCGGGGAGCAGCATCCAGCAAGTTCACCAAGAGAACGATGTA
AATGCTCTTATGATGCTCGTCAAAGGGAAACATAAAAAGgcgaaagtgaa
agtgaaaaataGCGAGTCATGGTCAAATGAATTTTCATTGGATACTGTTG
GCAGTGGTGGTTCCTTGAAATGCAATGGTCCAAGAGATCGAGTTTATGAG
ATTGGTTTGAACATCAGTTTGTCATACTTTGGATTGACGAAGATTGTGAC
GTTCACGCCACTCCGAATGTTATCTAACCACACCAAGTACACCATCAGTA
TGGCAGAAAGTAATTCTAAATCGTCAGAATGGCACACGGTAAACCCTGAC
GAGaacattccatTCTGGCCGACGAAACTTCCTTTGGTCAACCTTTACAT
TAACATCAATGGGCAAGATTCAGTGAAATTCAACCCTGAAGTTGGAAAAA
CTTTACTGTTGAAGTTCCAGAATGAGGTTGGAGGAGTTTGCGTGGATTAC
CAAGAAAAGGACTCGTCCTCAGTCCTTTCGTTTAATCCGTACTTCGCAGG
TGCAGCTCCTGTGCGGCttgaaaatctttgcaaaaaGATCGGCATGATCG
CTTATAAACAAGCAGGTTCGGTAATGGGTCACGTGTTAACACATGACCAA
TCAGTGTTGTACACGTGGGATGATCCAACCATGGAACAAGAATTGATTTG
TTCCATTGTCAATGATGAAGCCAGTGAAACAAGGATCAAACTCGATGCCA
ACGATTTCGGACGAATGAGAGTTGGAGATGGTGCAATTTATTGGGTTTCC
TTTCTGGATGGTCTTCAACGTGTTCTATTGTTCACTGATAACTTCAAATC
TGCTTACTGCGCATGTCAGgaGCAAAATTTACGCCCAACCATGGAAGTTG
ACTTTGAGATTGAGAGTTTTGGTTTGTCTCTGGTCAATGTTGATAAGAGA
ATGGAGATTGGCTACTTAGCTATCCGACAAAGCAAGACTGTATGGGAGCA
ACGCAAGAAAAAGAACCGCTGGAAAGCTTTACCGCTTGCCATGTGTGAAG
CTCTCGAAGAAGGTTATCTCAATTATCAAAACAGAAAAGGTGCAGTCAAA
GAGAAAGTTCTGGATAAGGAGGTGGATTACGAGAAGATGTTTATTACGAA
ACCTGAGAAGATTAAGATCAGAAGAACGTACCACAGCGGTCTTGGTTTCA
AATACACAATCTCACCCAATGAAATGCGTGTGCATGCTTCTATCAGCTCA
ATACAGTTGGATAGCCATGTTCCAGGTTCGACCTTTCCAACAGTCTTGCA
TATGGTTGAACCACCAAAATCTGTTGCTTCAGAAAACGCTCCAAAGCCAT
TCTttgaattgagtttaatgaCAAGGATCGGTGATAAAAATGTGGTCAAT
GAAGTcagCTATTGTCACGTGTTGATTCAAGAGATGGATGTGAGGGTTGA
TATTGGATTTTTATTGGCTCTGATGGAACTCTTCAGTCATGCAAGAGCTC
GAACAACCGAGAAAGAACAATACGCGCTTGATATTGGCCAAGCAGCAACA
AAGTTTGAAGAAAGCGCTGAATTTCAGGCAGCCAAACAAGATCGATATTA
CGTTTTGAACGACTTTCATTTATCACCGCTAAAGATTCACGTCAGTTTCT
CTTTGACGGGTGGTTCCAAAGATGAAAATGCTATTGCTTCATTACATGGT
AACGTGTTGAACTTGTTGTTACAAAGTGTCGGACTGGCCTTCACTGAAAT
ACAAGACGTACAATTCAAATTAGCATGTTACGAAGTGCATAAGTCCATGC
AGAGTAATTCGCAGCTCGGTGATGGAATAACTAAACATTATCAAACACAG
GCTATCAAGCAACTTTATGTGTTGGTACTCGGGCTAGACGTTCTTGGTAA
TCCGTATGGTTTGATATCTGGTGTTGGAACCGGAGCAAAGAATTTCTTCT
ACGAACCTTACCAGGGATTAATTCAAGGACCAGAAGAATTTGCGGAAGGA
TTGGCGTATGGGGTGAAGAGTCTTGTTGGTGGAACCGTGGGTGGAGTATC
AGGAGCTGTGAGTAAGATTACCGGTACCTTCGGTAAAGGTTTGGCTGCAT
TGACCTTGGATGAAGAATATCAACAAAAGAGACGTGAAAACATGAGCCAA
CGCCCAACTAACCTCGGTGAAGGTCTCGCCAAAGGTGGTAAAGGCCTTGT
AAAGGGTATCGTGTCTGGTGTTACAGGGATCGTTACCAAACCCTATGAAG
GTGCCAAGAATGATGGTGCAGGTGGCTTTTTTAAGGGCGTTGGAAAAGGC
CTGATTGGCGTGGTTGCACGCCCTGTTGGTGGAGTGGTAGATATGGCCAG
TAACACGTTTGATGGTTTGAAAAGCACGACATCTGGCGTGAAAGCGATCG
AGTTGAGCCGTGTTACTCGCGTCTTCCACGCAGATAAGGTTTTACGACCT
TTCAATCTGTACGAAGCAGATGGAAACAAAATTCTTATGCAATGTAACAA
AGGAGAATACGCCAAGAAGAATTTTTATATCACTCATGTAGTGGACAAGA
AGAACTATCTCATCCTCACTCAATCaaacATTTTGTATGTTGGAAAGAAC
GAGTTGAAAATGGGTGAATGGGAATCggtttgggttatcgagttcaATGA
GCTAAAACGTGAACCAGAAGTGAAAGAGACAAAGATTATTTTCCATATCC
ATAATACGGACACGCGACGTTCAATTTTCAAGAAATCGACGAACACACGT
GAAGTGATATTGGAGTCTAGTGCTGTTGCAGACTGGTTTATCTTAAAGCT
TAGAGATGCTAAAATGTTATAGatggtatttgaaTCTTTGGTTGCTGACC
TCTTGAACAAGTATCTGGGTCAATATGTGAAAAATCTTGATGCTTCTCAA
TTGAAGATTGGCATTTGGGGAGGAAATGTTGTCCTGACAGAACTTGAACT
GAAAGATACAGCTCTGGATGATCTTGACTTACCCATAAAAGTTGTTCGTG
GATATTTGGgtAAATTGGTCTTGTCCATCCCATGGAAAAATCTTTACACT
GAATCAACTGTTGTCGATATTCAAGATCTCCACCTTGTCGCTAAGCCTAA
TTTTGACATCAAATACAATGAAGAACgcgaagaaaaatcaaaacatgacA
AGAAACAACAACAGATTCACAATATCGAAGAAGCGAGGCAAAGAGAAGAA
GACAAAAAGAAAGGCGCCAAGAAAGAAGAGAGTGACGGTTTTGCTGAGAA
ACTTGCAACAAACGTCATAAAAAATCTACAGGTTACGATCAAGAACATAC
ATGTTCGATATGAAGACTCAATCAGTGATGTGAATGGACCCTTTTCAGTC
GGTCTTACAATGGAAAGTTTAACAGCACAAACCACAGATGAAGATTTTGT
TCCAAAGATTATCAAAGAATCTGTCTCATTAATTCATAAGatggTGAAAT
TAGACAATTTGGCTTTATATTGGAATCCAGGAGACGAACTGATTGATCCT
TCACTTGATACCAAGCAATGGTTGgaagtTTCAACGAAGCAAATTTCAAC
ACACCAATCGAAGCCAGAGAAAACGAAATATATTTTGAGTCCCATGGTTG
CAACGAAGAAATTGAAGCTGAACACCAAACCAGGTTCCAACCTTGACATC
CCGAAGatgttTTTGAACTTGGTTTTGGAAGAACTTGGTATCATCGTGGC
AAGAAGTCAATATCATGGCGTGGTGCAACTGATTGAATCATTTGAACGAA
TGAATAGGAACCAACCTTTTCGTAAATACAGACCACATACCTCCGTTCTT
GGGAACGAAAGTATTTGGTGGAAGTACTGCATGTCCAGCATACTGGAGGT
GGATGTCAAAAGACGATCTCAAATGTGGAGCTGGAAGCATATTCAAAAAC
ATCGAGTTCTTTGCAAAGCTTACAAAGTGAAGTAcaaggaaaaattgaaa
cagaaaaATCCATCCAAACAAATTCTCACTGAACTAGAGaGCATGGAGGA
TGAGTTGAATATTGCAAGCATCACCATTTTTCGACAGCTTGCAGCTACAG
AGGTTTTAACGGAACAAAAGAAGAAAGGCACTAAAGGAAGTTTCTTCAGT
TTCTTCTCCAGATCAAAAGAACCAGAAAAGTCTGCTGCTAATAAAATTGG
AGATTTAATGGGTGATGACCAGGAGAAGGAAATGCAGAAATTGTATGACG
CAATCGGTTATACTGAAAATGAAGTCATCACTCCCTTTCCTAAAGAGTAC
GTGGCGATGTCAGTGGAATCGATTCTCCAGAAATTATTCATCAGCCTCAT
CGATGACACAGATAAGGCGAAAGAATTCAAAGTGTTGGATTTTTCACTCA
ACAACATCATTGTAGAAGTTTTCCAAAGACCTTCTGCTCAAGCTCTCAAA
TTATGTGCAAAGATAGGAGAGATGAAGTTATTTGGTACAGCTTCTGCTCA
ATGTACACCTCtcatcatcaaaaacatgttaCAAGGTCGAGGTATGGAAT
TTCTGCCGTTGGTGGACTTCATCTTTGAGACGAATCCTTTGAAGAAACCG
GACATTGACCAATGTATCACTGCTATTTGTCAACCCTTAGAAATCATCTA
TGATGCTAACACGATCAACCATATCATTAGTTTCTTCAAACCTCCTGAAC
ATGTTATCTTGCAAGATTTACAAGACAAAGCGTATTCTACTTTCGAAGAT
TTTAAAGTTTCAAGTACGGCTGGTCTTCTACATGCTATGGAACAAAGAAC
GGTTATGGACATCGACATTGATGTTGGAGCATCTCATTTGATCATCCCTG
AAAAAGGTTCTTACAATGGTTGTACAGATATGCTGGTGATCGACTTTGGT
AAAATCACGATGAGCAGCGATCCTAGTCAAATCAGACACCTTGACCCTAA
GGACATTGAGGATGTGAATGAAGTACAAAGCAAAGCTTATGATCGATTCT
TGTTGTCGCTTCAAGCTCTTCAAATATTACTCGTTAGAGAAGGTGAAGAT
TTAAAGAGTGCTAAAAGCAACGTCAGTAAAGCTTCATCACACATTTTGCA
TCCCATCAATTTCGATGGCAAACTTGCCAAAGCTATACTTCCACAAGATC
CACGTTTAAAACAGATATGTGTCTCTGGTGAATTATCTTCGCTGTTTGTT
TCTGTATCGGATGATAAAGTCAGTCGTCTCATCAAGCTAGCAGACTCGAT
ACCACTCCCTCAATCACCTTCTCACGATAACATCGACGGAGAAGAAAAAC
CTGAAGGACTCTTCACCAAGGCGTTGTCAATGATAAGCTTGACAGGTGAC
AATGACACAGGGGTGGACATCGGAGGATTTTCCATCCCTGTACCGACATC
TCCAACATCAGTGACGTCAGATGAAGATGAATACGGGACACCACCTGATG
GCTCCATATTACAGTTACAACAAGAAGCTGGTCCGGACTTTTCATCAGGA
GTGGCGAACCAAGTCAAAGTGGACTTGAACTTTAAAATCCATAAAGTGAT
GATCGCCATTGGTTTGACTGACAAAGCATTGAAACAGGAAAAAGAATGTC
TGAAATTCATCGTGGACGACATCAATACAGAGgtGATACTACGAAGATGG
GATTTGTTCGTCAATGCAGAAGTTGGTCGTCTGGTGTTGAATGAAATGAC
ATGGGGTGTTGATGGAGAACCTTTCGCCATCATGAGTACacccaaaaaca
ccaaaatgttGAAATTCAGCTATCGGAGGTGTGAATTCAACGAAAGTTTG
AATCTCGGTCCAAGTTACTTTTATTCCAAAGAAGCGCAAGTCAGAGCTTT
ACATTTCAAAGATGAATTTGGCGCCACGGATCAGATTTTAGATGTACAAG
TGGCTACTTTATTTCTGATGCTTCATCAAGAAGCACTTTTGAGCATCATG
TCATTGATCTACCAAGTACTGGAACCACTCAACAAACATGATAAGGAAGC
CACACAGAAGATCAAACGGAGTTTGAGTACGGCAGGTAGTCGTTTGAGTC
TCTCCatcgaagaaaaagaaaaggagaGACAGATACAACGAAAATTAGCC
AACCCTAAAGCACTGGAAGCTGCCAACGAACTTAAGCAACAGGTTGGctt
agaagaagaaaaaaagatgaGAGTGACCGCCCACCTGGATGGTGTTGGTA
TCATGATTTGTTCAGCCAAAGTTGACCTTGCACAAGCCTTCGTTAAAGGG
TTATCTGCTAAAGTACTGATGAAAGATGACTTATTAGAAGTGAAAGCCAG
CATGAAAGATATGCAAGTACAAGATAATGTTGGCGAAACAAAGTACAAAG
ACATCATTAGCATGCGATCTGATGAAGTGTTCGATTTAGAGTTGGCTATT
TACGAGAATGGATCTTCTGGTAGCAAGCAATACGATATGTCGTGTGTCGA
CACCAGTGTCAAACTGAACTTCGGTCAAATGCGCGTTGTTTTCTTGTATA
GATTCATACAAGACTTAATGTCATTCACCGAAAACTTCGAAGAAGCACAG
AAAGCAGTTGTGGAAGCTGGTAAAGCTGCCAAGGATAAAGCTCTGGAAAC
AGCGACCGATTTGAATAGACATTCTTCTCGTGTCAAACTAAATGTGGTTC
TGAAAGCACCGACTATTATCATTCCAGTTGGATCAAACAATGAATTGGCT
TTACTGGTGGATCTGGGTGAATTGCGTATTTACAACACATTCAAACTCCT
CAACGATGATCAATACCATAAGAAATCTATCATCACTGATAACATGACCA
TTAAGTTATCCAATCTGAAATTGTTAAAAGCACTTATTCAAGATGGTAAA
GATTTCTTGCATCAACGAGCCATTATTGAACCTATGATGCTACAAATAAC
TATTGTTCGTAATTTAACGAAAGGTAACCATTCCATACCGGATGTTTCAG
TTCAAGCAAAGATGCCAGCTATTCTGTTATCAATCAGTGAAGAAGATGTG
ACCGTAGCTCTAAAGATTGTCCAAGGGAATCTCGCCGAAGGTGAGTCACA
TGCGCCGAAGAAGCAAGCCAAGCCTGCCAAACAAACGTTAAACGTGCCAC
AAGATCGTTTAGCAGACATTTACGAGGAGcctgaagatgaagatgagaaT
CGACAAGGATATCTTCAAACCAAACTATCCTTCGATCTGGCTAAAATTGA
CATCAAGCTTTACTTGAAACCATCTGATATGACATTTGAAGATGAATTTT
TAGCGAGGACGGATGATTTGTTGTTAGCTTTGTTCACTATTGGTAACCTG
TGTGTTGATGGAGACATCATGTCCACGCAAGCTATGAAGATGAGCGTTCG
ATTGGACACTTTGGTGTTGGATGATATGAGACCTATCGAGGAGCATGAAG
GTGTTAAACGTATGATCAACTACAGTCCCGAGCCACTCCTTGAAGAAGTC
AAAACCTCTTCTCATAAACGACCAATCGACAACTCACGAATGATCGAAAT
CCAAttcgatcaaacttcatcgcaagataaaaatatcgacATCAAACTTT
GTAACATGCTTTGTATATTCAACGTTGAGTTTATCATGGTCCTGTTGAAA
ACGTTGCAAGCTGCCATACCTAAAGATGATAGTCTGCAACATGGCCATTC
AATGAGTAGTCTAGACTCGGCGGCAGGGTCTGGCGGCAGCGATGACGAGG
ACTCTTTAGAAGCCAGCGAGATTGTCCTCTGCACTGGTGATCAAGAAAGA
CCTGAGACTAAAGTCTCTATCTTCGTCCATAACCCGCAAATTGTTTTACT
AGCAGATGCAAAGGATGTCAAAACAAATGCACTCTTTCTTACAACCGaga
tcaattttcaatatttcgaaTTGCGAGATACTCAAAAAATGATTGGCGCT
GTTTCTAACACCGCTATTTTGTCAACTGCTTTCAAGAATGACCATCGGAG
TGATATATCAACAGTGTTGTCATTAGATTCCATCAATCTCCACTCGTCAT
CACCCATCAATGGTAAACCTCATATGAGTGTCAGCACAACTTTGATCAAA
CTGAATATCTCACCCAAAACCATCCGAACTTTATCAGCGTGTGCTGGTTA
CATCTCCAATGATCCAACAGATGAAGAAATCAAAGAAGCTCGAAAAGCCA
TGCGTGATTTATGGCAAATTCAAACGTTCACCAATAAGCGACCGTGGTAT
TTAAACCACCCACCACAACAAGTCTTAAGTGCTGGCAGCTTCGTCCTTGC
GCGAACGAGAACAGGAGAATATAAGCATGGTTTCTTAGCTAAAAAGGATG
TCTCGTATCAAGTCTATTTTTCAGAGGAGCGAGGAACAGCCAGTCACCGA
GCCATGGATATCTCATCTGTTGTTTTGGATATCGTACCGCTGATCGGTGA
TCTATGTGTTGGATGTAATGTTTTAGCTGTGGAATCGAAAGAACATGGAT
ATCGTACTGGTCGAATTACTCAGGTTTGGGATTCGAATGTGGATAAAGAT
TCTTCGGATGGCGCCAAACAATCTGTTTCTGTCAAGACAACTGCTATTGC
TCCAATCAAATACCTTGTCAATTTCTATGACAACCAAACGGAGAACTTCT
TCCCGCCTGATGAACTTCGTATCATTGGTAAACCCATCAAGGGGGTTGTC
CCTGGACTAGGGGCGTGTGTTTACGCCCGCTTTAATGATGGTTTTTACTA
TCGGGGCAAAGTTGATGACATCGAGGATTATCGAATCCGAGTGCAATTGG
ATGAGATCAGTGGAGAAATCGAACACGACATCGATGATCCGTCAGCCGTT
ATTTTGAACCTGACGCCTCAATACCGTCAAGTCAAAAAGCATTTCAAAGT
CATTGCATCCAAAGGAAGCACAACTAAAGGATATCATCCGGGGAAAGTGA
CCGCCATCCAAGGTGAAGGAAATAACCGATTGTATTCGATACGCTTCGAA
GACGGTACAATTAACCAAGTACCCATCacgaaattgattttgatgccAAA
AGCACCTTTTGATGCTTTACCTGAAGTTGGCACATACGTTTATTCCCGAG
TGTCACGCGACGCTCCTTTATACGAGAAGGGTATCGTAGCAGAGAAGAAC
ACAATGATCTGCGTTAAACATTTAAATGGACGGAAATTGGCTCACGAAAT
ACAAAACATTCATTTTGTTGTCCGAAATATCGTTCCTCTCGTGTCATCAt
tgaagGTTGGTTTGGACGTCATAGTGCAACCTGACAATGACGATCAGAAA
ATGTATTTGGCTGTCATTAGGGAAGTCACCAAAAAAGAAGGTGACAAAAC
GAACCGTTATCTAGTGGAGTTTACGGATGGATCCAAGAAGAGAGTGACGC
CCAGCCGGATCCGTATACTTTCTCAATACGGAAGTGCAGAAACGAGTGAA
GAAAATGCTGACATTATCACAACAAGACAGGAGGAACTAGTTCTCGATGT
GCAAGGTATCTCATTACGTGTGGAAGGTTACTTGGGAGGCGTGTTGACAC
CCATGCTCAAAATGGATTCCAAAATCACAGCTAACTTGAAGGATTGGTCA
AGCCAAATGAATGCACACGCTACTGTATCATTAGAAGCCAGTTATTATAA
CGAAAACGTTGCCGAATGGGAGCCAGTTATTGAACCTTTGATGGAGAAAC
GGAGGGAAAGACCGTGGCAACTCTCTGTCAATTACACGATGGAAGGTGAC
GACAATTCTGCTTCATCCACTTCCAACGAACTCGTTTTACAAAAACCGGA
ATCCAACCTGAAAATCAAATCTCAAGATAATCTTGAATTGACAATTTCAA
AATCATGTCTTGCTTTACTCGGTGAATTGGGACAGGTGTTTGGAGATGCA
GTAGAATCTGTGGACGTTTTACCACAAGTCCTGGTCGAAAAAGAACCTTT
CATGATCGAAAACTTGCTCTCCAAGAAGGTGACAGTAACATTGAATGAAC
TTCTGCAGGGACCAAATGGAGATTCGACAATCGAGCTAGCATCTTCTTCG
AATCCTGTTGGCATTACTTTTGCTCCCAagaaatttgagaaacgaaAGAC
CAACGATCTATACACAATCAATTTAtcgGTGGACGGTTTTCATGACATTA
AAGACATTGTGGTTCAAAGAAAGCGAAGCGTTATCTATGATCTTGTACCA
ATAAAACTATTATCAGCACAGTCTTCATATTCGATAGTGGTACAAGTGAA
GACAACAGACGGACAACGTATCATCGTACTCCGATCACCATTGCAGTTGA
AAAATCACTTTCCAATGCCGTTGGATGTCAGCTACATTTCCAAAGAAAAC
CAACCAGTTAAACTGACAACAGTGGGATCGGGAGATATCTATTCCTTCCC
TTTGTTGTTAACCTACCACAGTGTTTTTCATCTCAAACCTGCTGGTTTCG
ACTACGGTGATTGCACAGAAGCTCTCAATTGGAGTGATTTGAAGACGAGC
AACGAAAAACAGTTCTCCTGCCCTTCACCTGACAAAAGTGCTGACCCTTT
CTACATGCAGGTGGTGATGAAAGAGGAGACGTACTCTTCCGTACACGGCA
TGTTGGACTGTGTACCACGTTACACGTTGGAGTGCTTTCCCGTCATCACG
CTGCATAATTACCTACCTTGCACTATTAATTATAAGATCAAGGGTATGGC
GAAATCGGAAAGTCTACCAGGCGGACACAATTGGCCTTTGTTTACCGTCA
ACTTCAGTGATAAACCTTCCATCTATATCGAGATTGAGTCGTATAACAAC
CAAAGATGGGAAGGAGGTTTGACATTACCAACAAAACCGGTAGATTCTTT
GAACAAACCATCATTATCTTTCGTCATGATGTCTGGTGAACGCAAAATGG
AATTGGGTGTTTATTACCAGTTAGACGGTTCATTGAACATCACCTTATAT
TCGCCTTACTGGCTTCTCAATAAAACTGGAAAACCACTTGTCTATCAGCC
AGCGGGGAGCAGCATCCAGCAAGTTCACCAAGAGAACGATGTAAATGCTC
TTATGATGCTCGTCAAAGGGAAACATAAAAAGgcgaaagtgaaagtgaaa
aataGCGAGTCATGGTCAAATGAATTTTCATTGGATACTGTTGGCAGTGG
TGGTTCCTTGAAATGCAATGGTCCAAGAGATCGAGTTTATGAGATTGGTT
TGAACATCAGTTTGTCATACTTTGGATTGACGAAGATTGTGACGTTCACG
CCACTCCGAATGTTATCTAACCACACCAAGTACACCATCAGTATGGCAGA
AAGTAATTCTAAATCGTCAGAATGGCACACGGTAAACCCTGACGAGaaca
ttccatTCTGGCCGACGAAACTTCCTTTGGTCAACCTTTACATTAACATC
AATGGGCAAGATTCAGTGAAATTCAACCCTGAAGTTGGAAAAACTTTACT
GTTGAAGTTCCAGAATGAGGTTGGAGGAGTTTGCGTGGATTACCAAGAAA
AGGACTCGTCCTCAGTCCTTTCGTTTAATCCGTACTTCGCAGGTGCAGCT
CCTGTGCGGCttgaaaatctttgcaaaaaGATCGGCATGATCGCTTATAA
ACAAGCAGGTTCGGTAATGGGTCACGTGTTAACACATGACCAATCAGTGT
TGTACACGTGGGATGATCCAACCATGGAACAAGAATTGATTTGTTCCATT
GTCAATGATGAAGCCAGTGAAACAAGGATCAAACTCGATGCCAACGATTT
CGGACGAATGAGAGTTGGAGATGGTGCAATTTATTGGGTTTCCTTTCTGG
ATGGTCTTCAACGTGTTCTATTGTTCACTGATAACTTCAAATCTGCTTAC
TGCGCATGTCAGgaGCAAAATTTACGCCCAACCATGGAAGTTGACTTTGA
GATTGAGAGTTTTGGTTTGTCTCTGGTCAATGTTGATAAGAGAATGGAGA
TTGGCTACTTAGCTATCCGACAAAGCAAGACTGTATGGGAGCAACGCAAG
AAAAAGAACCGCTGGAAAGCTTTACCGCTTGCCATGTGTGAAGCTCTCGA
AGAAGGTTATCTCAATTATCAAAACAGAAAAGGTGCAGTCAAAGAGAAAG
TTCTGGATAAGGAGGTGGATTACGAGAAGATGTTTATTACGAAACCTGAG
AAGATTAAGATCAGAAGAACGTACCACAGCGGTCTTGGTTTCAAATACAC
AATCTCACCCAATGAAATGCGTGTGCATGCTTCTATCAGCTCAATACAGT
TGGATAGCCATGTTCCAGGTTCGACCTTTCCAACAGTCTTGCATATGGTT
GAACCACCAAAATCTGTTGCTTCAGAAAACGCTCCAAAGCCATTCTttga
attgagtttaatgaCAAGGATCGGTGATAAAAATGTGGTCAATGAAGTca
gCTATTGTCACGTGTTGATTCAAGAGATGGATGTGAGGGTTGATATTGGA
TTTTTATTGGCTCTGATGGAACTCTTCAGTCATGCAAGAGCTCGAACAAC
CGAGAAAGAACAATACGCGCTTGATATTGGCCAAGCAGCAACAAAGTTTG
AAGAAAGCGCTGAATTTCAGGCAGCCAAACAAGATCGATATTACGTTTTG
AACGACTTTCATTTATCACCGCTAAAGATTCACGTCAGTTTCTCTTTGAC
GGGTGGTTCCAAAGATGAAAATGCTATTGCTTCATTACATGGTAACGTGT
TGAACTTGTTGTTACAAAGTGTCGGACTGGCCTTCACTGAAATACAAGAC
GTACAATTCAAATTAGCATGTTACGAAGTGCATAAGTCCATGCAGAGTAA
TTCGCAGCTCGGTGATGGAATAACTAAACATTATCAAACACAGGCTATCA
AGCAACTTTATGTGTTGGTACTCGGGCTAGACGTTCTTGGTAATCCGTAT
GGTTTGATATCTGGTGTTGGAACCGGAGCAAAGAATTTCTTCTACGAACC
TTACCAGGGATTAATTCAAGGACCAGAAGAATTTGCGGAAGGATTGGCGT
ATGGGGTGAAGAGTCTTGTTGGTGGAACCGTGGGTGGAGTATCAGGAGCT
GTGAGTAAGATTACCGGTACCTTCGGTAAAGGTTTGGCTGCATTGACCTT
GGATGAAGAATATCAACAAAAGAGACGTGAAAACATGAGCCAACGCCCAA
CTAACCTCGGTGAAGGTCTCGCCAAAGGTGGTAAAGGCCTTGTAAAGGGT
ATCGTGTCTGGTGTTACAGGGATCGTTACCAAACCCTATGAAGGTGCCAA
GAATGATGGTGCAGGTGGCTTTTTTAAGGGCGTTGGAAAAGGCCTGATTG
GCGTGGTTGCACGCCCTGTTGGTGGAGTGGTAGATATGGCCAGTAACACG
TTTGATGGTTTGAAAAGCACGACATCTGGCGTGAAAGCGATCGAGTTGAG
CCGTGTTACTCGCGTCTTCCACGCAGATAAGGTTTTACGACCTTTCAATC
TGTACGAAGCAGATGGAAACAAAATTCTTATGCAATGTAACAAAGGAGAA
TACGCCAAGAAGAATTTTTATATCACTCATGTAGTGGACAAGAAGAACTA
TCTCATCCTCACTCAATCaaacATTTTGTATGTTGGAAAGAACGAGTTGA
AAATGGGTGAATGGGAATCggtttgggttatcgagttcaATGAGCTAAAA
CGTGAACCAGAAGTGAAAGAGACAAAGATTATTTTCCATATCCATAATAC
GGACACGCGACGTTCAATTTTCAAGAAATCGACGAACACACGTGAAGTGA
TATTGGAGTCTAGTGCTGTTGCAGACTGGTTTATCTTAAAGCTTAGAGAT
GCTAAAATGTTATAGatggtatttgaaTCTTTGGTTGCTGACCTCTTGAA
CAAGTATCTGGGTCAATATGTGAAAAATCTTGATGCTTCTCAATTGAAGA
TTGGCATTTGGGGAGGAAATGTTGTCCTGACAGAACTTGAACTGAAAGAT
ACAGCTCTGGATGATCTTGACTTACCCATAAAAGTTGTTCGTGGATATTT
GGgtAAATTGGTCTTGTCCATCCCATGGAAAAATCTTTACACTGAATCAA
CTGTTGTCGATATTCAAGATCTCCACCTTGTCGCTAAGCCTAATTTTGAC
ATCAAATACAATGAAGAACgcgaagaaaaatcaaaacatgacAAGAAACA
ACAACAGATTCACAATATCGAAGAAGCGAGGCAAAGAGAAGAAGACAAAA
AGAAAGGCGCCAAGAAAGAAGAGAGTGACGGTTTTGCTGAGAAACTTGCA
ACAAACGTCATAAAAAATCTACAGGTTACGATCAAGAACATACATGTTCG
ATATGAAGACTCAATCAGTGATGTGAATGGACCCTTTTCAGTCGGTCTTA
CAATGGAAAGTTTAACAGCACAAACCACAGATGAAGATTTTGTTCCAAAG
ATTATCAAAGAATCTGTCTCATTAATTCATAAGatggTGAAATTAGACAA
TTTGGCTTTATATTGGAATCCAGGAGACGAACTGATTGATCCTTCACTTG
ATACCAAGCAATGGTTGgaagtTTCAACGAAGCAAATTTCAACACACCAA
TCGAAGCCAGAGAAAACGAAATATATTTTGAGTCCCATGGTTGCAACGAA
GAAATTGAAGCTGAACACCAAACCAGGTTCCAACCTTGACATCCCGAAGa
tgttTTTGAACTTGGTTTTGGAAGAACTTGGTATCATCGTGGCAAGAAGT
CAATATCATGGCGTGGTGCAACTGATTGAATCATTTGAACGAATGAATAG
GAACCAACCTTTTCGTAAATACAGACCACATACCTCCGTTCTTGGGAACG
AAAGTATTTGGTGGAAGTACTGCATGTCCAGCATACTGGAGGTGGATGTC
AAAAGACGATCTCAAATGTGGAGCTGGAAGCATATTCAAAAACATCGAGT
TCTTTGCAAAGCTTACAAAGTGAAGTAcaaggaaaaattgaaacagaaaa
ATCCATCCAAACAAATTCTCACTGAACTAGAGaGCATGGAGGATGAGTTG
AATATTGCAAGCATCACCATTTTTCGACAGCTTGCAGCTACAGAGGTTTT
AACGGAACAAAAGAAGAAAGGCACTAAAGGAAGTTTCTTCAGTTTCTTCT
CCAGATCAAAAGAACCAGAAAAGTCTGCTGCTAATAAAATTGGAGATTTA
ATGGGTGATGACCAGGAGAAGGAAATGCAGAAATTGTATGACGCAATCGG
TTATACTGAAAATGAAGTCATCACTCCCTTTCCTAAAGAGTACGTGGCGA
TGTCAGTGGAATCGATTCTCCAGAAATTATTCATCAGCCTCATCGATGAC
ACAGATAAGGCGAAAGAATTCAAAGTGTTGGATTTTTCACTCAACAACAT
CATTGTAGAAGTTTTCCAAAGACCTTCTGCTCAAGCTCTCAAATTATGTG
CAAAGATAGGAGAGATGAAGTTATTTGGTACAGCTTCTGCTCAATGTACA
CCTCtcatcatcaaaaacatgttaCAAGGTCGAGGTATGGAATTTCTGCC
GTTGGTGGACTTCATCTTTGAGACGAATCCTTTGAAGAAACCGGACATTG
ACCAATGTATCACTGCTATTTGTCAACCCTTAGAAATCATCTATGATGCT
AACACGATCAACCATATCATTAGTTTCTTCAAACCTCCTGAACATGTTAT
CTTGCAAGATTTACAAGACAAAGCGTATTCTACTTTCGAAGATTTTAAAG
TTTCAAGTACGGCTGGTCTTCTACATGCTATGGAACAAAGAACGGTTATG
GACATCGACATTGATGTTGGAGCATCTCATTTGATCATCCCTGAAAAAGG
TTCTTACAATGGTTGTACAGATATGCTGGTGATCGACTTTGGTAAAATCA
CGATGAGCAGCGATCCTAGTCAAATCAGACACCTTGACCCTAAGGACATT
GAGGATGTGAATGAAGTACAAAGCAAAGCTTATGATCGATTCTTGTTGTC
GCTTCAAGCTCTTCAAATATTACTCGTTAGAGAAGGTGAAGATTTAAAGA
GTGCTAAAAGCAACGTCAGTAAAGCTTCATCACACATTTTGCATCCCATC
AATTTCGATGGCAAACTTGCCAAAGCTATACTTCCACAAGATCCACGTTT
AAAACAGATATGTGTCTCTGGTGAATTATCTTCGCTGTTTGTTTCTGTAT
CGGATGATAAAGTCAGTCGTCTCATCAAGCTAGCAGACTCGATACCACTC
CCTCAATCACCTTCTCACGATAACATCGACGGAGAAGAAAAACCTGAAGG
ACTCTTCACCAAGGCGTTGTCAATGATAAGCTTGACAGGTGACAATGACA
CAGGGGTGGACATCGGAGGATTTTCCATCCCTGTACCGACATCTCCAACA
TCAGTGACGTCAGATGAAGATGAATACGGGACACCACCTGATGGCTCCAT
ATTACAGTTACAACAAGAAGCTGGTCCGGACTTTTCATCAGGAGTGGCGA
ACCAAGTCAAAGTGGACTTGAACTTTAAAATCCATAAAGTGATGATCGCC
ATTGGTTTGACTGACAAAGCATTGAAACAGGAAAAAGAATGTCTGAAATT
CATCGTGGACGACATCAATACAGAGgtGATACTACGAAGATGGGATTTGT
TCGTCAATGCAGAAGTTGGTCGTCTGGTGTTGAATGAAATGACATGGGGT
GTTGATGGAGAACCTTTCGCCATCATGAGTACacccaaaaacaccaaaat
gttGAAATTCAGCTATCGGAGGTGTGAATTCAACGAAAGTTTGAATCTCG
GTCCAAGTTACTTTTATTCCAAAGAAGCGCAAGTCAGAGCTTTACATTTC
AAAGATGAATTTGGCGCCACGGATCAGATTTTAGATGTACAAGTGGCTAC
TTTATTTCTGATGCTTCATCAAGAAGCACTTTTGAGCATCATGTCATTGA
TCTACCAAGTACTGGAACCACTCAACAAACATGATAAGGAAGCCACACAG
AAGATCAAACGGAGTTTGAGTACGGCAGGTAGTCGTTTGAGTCTCTCCat
cgaagaaaaagaaaaggagaGACAGATACAACGAAAATTAGCCAACCCTA
AAGCACTGGAAGCTGCCAACGAACTTAAGCAACAGGTTGGcttagaagaa
gaaaaaaagatgaGAGTGACCGCCCACCTGGATGGTGTTGGTATCATGAT
TTGTTCAGCCAAAGTTGACCTTGCACAAGCCTTCGTTAAAGGGTTATCTG
CTAAAGTACTGATGAAAGATGACTTATTAGAAGTGAAAGCCAGCATGAAA
GATATGCAAGTACAAGATAATGTTGGCGAAACAAAGTACAAAGACATCAT
TAGCATGCGATCTGATGAAGTGTTCGATTTAGAGTTGGCTATTTACGAGA
ATGGATCTTCTGGTAGCAAGCAATACGATATGTCGTGTGTCGACACCAGT
GTCAAACTGAACTTCGGTCAAATGCGCGTTGTTTTCTTGTATAGATTCAT
ACAAGACTTAATGTCATTCACCGAAAACTTCGAAGAAGCACAGAAAGCAG
TTGTGGAAGCTGGTAAAGCTGCCAAGGATAAAGCTCTGGAAACAGCGACC
GATTTGAATAGACATTCTTCTCGTGTCAAACTAAATGTGGTTCTGAAAGC
ACCGACTATTATCATTCCAGTTGGATCAAACAATGAATTGGCTTTACTGG
TGGATCTGGGTGAATTGCGTATTTACAACACATTCAAACTCCTCAACGAT
GATCAATACCATAAGAAATCTATCATCACTGATAACATGACCATTAAGTT
ATCCAATCTGAAATTGTTAAAAGCACTTATTCAAGATGGTAAAGATTTCT
TGCATCAACGAGCCATTATTGAACCTATGATGCTACAAATAACTATTGTT
CGTAATTTAACGAAAGGTAACCATTCCATACCGGATGTTTCAGTTCAAGC
AAAGATGCCAGCTATTCTGTTATCAATCAGTGAAGAAGATGTGACCGTAG
CTCTAAAGATTGTCCAAGGGAATCTCGCCGAAGGTGAGTCACATGCGCCG
AAGAAGCAAGCCAAGCCTGCCAAACAAACGTTAAACGTGCCACAAGATCG
TTTAGCAGACATTTACGAGGAGcctgaagatgaagatgagaaTCGACAAG
GATATCTTCAAACCAAACTATCCTTCGATCTGGCTAAAATTGACATCAAG
CTTTACTTGAAACCATCTGATATGACATTTGAAGATGAATTTTTAGCGAG
GACGGATGATTTGTTGTTAGCTTTGTTCACTATTGGTAACCTGTGTGTTG
ATGGAGACATCATGTCCACGCAAGCTATGAAGATGAGCGTTCGATTGGAC
ACTTTGGTGTTGGATGATATGAGACCTATCGAGGAGCATGAAGGTGTTAA
ACGTATGATCAACTACAGTCCCGAGCCACTCCTTGAAGAAGTCAAAACCT
CTTCTCATAAACGACCAATCGACAACTCACGAATGATCGAAATCCAAttc
gatcaaacttcatcgcaagataaaaatatcgacATCAAACTTTGTAACAT
GCTTTGTATATTCAACGTTGAGTTTATCATGGTCCTGTTGAAAACGTTGC
AAGCTGCCATACCTAAAGATGATAGTCTGCAACATGGCCATTCAATGAGT
AGTCTAGACTCGGCGGCAGGGTCTGGCGGCAGCGATGACGAGGACTCTTT
AGAAGCCAGCGAGATTGTCCTCTGCACTGGTGATCAAGAAAGACCTGAGA
CTAAAGTCTCTATCTTCGTCCATAACCCGCAAATTGTTTTACTAGCAGAT
GCAAAGGATGTCAAAACAAATGCACTCTTTCTTACAACCGagatcaattt
tcaatatttcgaaTTGCGAGATACTCAAAAAATGATTGGCGCTGTTTCTA
ACACCGCTATTTTGTCAACTGCTTTCAAGAATGACCATCGGAGTGATATA
TCAACAGTGTTGTCATTAGATTCCATCAATCTCCACTCGTCATCACCCAT
CAATGGTAAACCTCATATGAGTGTCAGCACAACTTTGATCAAACTGAATA
TCTCACCCAAAACCATCCGAACTTTATCAGCGTGTGCTGGTTACATCTCC
AATGATCCAACAGATGAAGAAATCAAAGAAGCTCGAAAAGCCATGCGTGA
TTTATGGCAAATTCAAACGTTCACCAATAAGCGACCGTGGTATTTAAACC
ACCCACCACAACAAGTCTTAAGTGCTGGCAGCTTCGTCCTTGCGCGAACG
AGAACAGGAGAATATAAGCATGGTTTCTTAGCTAAAAAGGATGTCTCGTA
TCAAGTCTATTTTTCAGAGGAGCGAGGAACAGCCAGTCACCGAGCCATGG
ATATCTCATCTGTTGTTTTGGATATCGTACCGCTGATCGGTGATCTATGT
GTTGGATGTAATGTTTTAGCTGTGGAATCGAAAGAACATGGATATCGTAC
TGGTCGAATTACTCAGGTTTGGGATTCGAATGTGGATAAAGATTCTTCGG
ATGGCGCCAAACAATCTGTTTCTGTCAAGACAACTGCTATTGCTCCAATC
AAATACCTTGTCAATTTCTATGACAACCAAACGGAGAACTTCTTCCCGCC
TGATGAACTTCGTATCATTGGTAAACCCATCAAGGGGGTTGTCCCTGGAC
TAGGGGCGTGTGTTTACGCCCGCTTTAATGATGGTTTTTACTATCGGGGC
AAAGTTGATGACATCGAGGATTATCGAATCCGAGTGCAATTGGATGAGAT
CAGTGGAGAAATCGAACACGACATCGATGATCCGTCAGCCGTTATTTTGA
ACCTGACGCCTCAATACCGTCAAGTCAAAAAGCATTTCAAAGTCATTGCA
TCCAAAGGAAGCACAACTAAAGGATATCATCCGGGGAAAGTGACCGCCAT
CCAAGGTGAAGGAAATAACCGATTGTATTCGATACGCTTCGAAGACGGTA
CAATTAACCAAGTACCCATCacgaaattgattttgatgccAAAAGCACCT
TTTGATGCTTTACCTGAAGTTGGCACATACGTTTATTCCCGAGTGTCACG
CGACGCTCCTTTATACGAGAAGGGTATCGTAGCAGAGAAGAACACAATGA
TCTGCGTTAAACATTTAAATGGACGGAAATTGGCTCACGAAATACAAAAC
ATTCATTTTGTTGTCCGAAATATCGTTCCTCTCGTGTCATCAttgaagGT
TGGTTTGGACGTCATAGTGCAACCTGACAATGACGATCAGAAAATGTATT
TGGCTGTCATTAGGGAAGTCACCAAAAAAGAAGGTGACAAAACGAACCGT
TATCTAGTGGAGTTTACGGATGGATCCAAGAAGAGAGTGACGCCCAGCCG
GATCCGTATACTTTCTCAATACGGAAGTGCAGAAACGAGTGAAGAAAATG
CTGACATTATCACAACAAGACAGGAGGAACTAGTTCTCGATGTGCAAGGT
ATCTCATTACGTGTGGAAGGTTACTTGGGAGGCGTGTTGACACCCATGCT
CAAAATGGATTCCAAAATCACAGCTAACTTGAAGGATTGGTCAAGCCAAA
TGAATGCACACGCTACTGTATCATTAGAAGCCAGTTATTATAACGAAAAC
GTTGCCGAATGGGAGCCAGTTATTGAACCTTTGATGGAGAAACGGAGGGA
AAGACCGTGGCAACTCTCTGTCAATTACACGATGGAAGGTGACGACAATT
CTGCTTCATCCACTTCCAACGAACTCGTTTTACAAAAACCGGAATCCAAC
CTGAAAATCAAATCTCAAGATAATCTTGAATTGACAATTTCAAAATCATG
TCTTGCTTTACTCGGTGAATTGGGACAGGTGTTTGGAGATGCAGTAGAAT
CTGTGGACGTTTTACCACAAGTCCTGGTCGAAAAAGAACCTTTCATGATC
GAAAACTTGCTCTCCAAGAAGGTGACAGTAACATTGAATGAACTTCTGCA
GGGACCAAATGGAGATTCGACAATCGAGCTAGCATCTTCTTCGAATCCTG
TTGGCATTACTTTTGCTCCCAagaaatttgagaaacgaaAGACCAACGAT
CTATACACAATCAATTTAtcgGTGGACGGTTTTCATGACATTAAAGACAT
TGTGGTTCAAAGAAAGCGAAGCGTTATCTATGATCTTGTACCAATAAAAC
TATTATCAGCACAGTCTTCATATTCGATAGTGGTACAAGTGAAGACAACA
GACGGACAACGTATCATCGTACTCCGATCACCATTGCAGTTGAAAAATCA
CTTTCCAATGCCGTTGGATGTCAGCTACATTTCCAAAGAAAACCAACCAG
TTAAACTGACAACAGTGGGATCGGGAGATATCTATTCCTTCCCTTTGTTG
TTAACCTACCACAGTGTTTTTCATCTCAAACCTGCTGGTTTCGACTACGG
TGATTGCACAGAAGCTCTCAATTGGAGTGATTTGAAGACGAGCAACGAAA
AACAGTTCTCCTGCCCTTCACCTGACAAAAGTGCTGACCCTTTCTACATG
CAGGTGGTGATGAAAGAGGAGACGTACTCTTCCGTACACGGCATGTTGGA
CTGTGTACCACGTTACACGTTGGAGTGCTTTCCCGTCATCACGCTGCATA
ATTACCTACCTTGCACTATTAATTATAAGATCAAGGGTATGGCGAAATCG
GAAAGTCTACCAGGCGGACACAATTGGCCTTTGTTTACCGTCAACTTCAG
TGATAAACCTTCCATCTATATCGAGATTGAGTCGTATAACAACCAAAGAT
GGGAAGGAGGTTTGACATTACCAACAAAACCGGTAGATTCTTTGAACAAA
CCATCATTATCTTTCGTCATGATGTCTGGTGAACGCAAAATGGAATTGGG
TGTTTATTACCAGTTAGACGGTTCATTGAACATCACCTTATATTCGCCTT
ACTGGCTTCTCAATAAAACTGGAAAACCACTTGTCTATCAGCCAGCGGGG
AGCAGCATCCAGCAAGTTCACCAAGAGAACGATGTAAATGCTCTTATGAT
GCTCGTCAAAGGGAAACATAAAAAGgcgaaagtgaaagtgaaaaataGCG
AGTCATGGTCAAATGAATTTTCATTGGATACTGTTGGCAGTGGTGGTTCC
TTGAAATGCAATGGTCCAAGAGATCGAGTTTATGAGATTGGTTTGAACAT
CAGTTTGTCATACTTTGGATTGACGAAGATTGTGACGTTCACGCCACTCC
GAATGTTATCTAACCACACCAAGTACACCATCAGTATGGCAGAAAGTAAT
TCTAAATCGTCAGAATGGCACACGGTAAACCCTGACGAGaacattccatT
CTGGCCGACGAAACTTCCTTTGGTCAACCTTTACATTAACATCAATGGGC
AAGATTCAGTGAAATTCAACCCTGAAGTTGGAAAAACTTTACTGTTGAAG
TTCCAGAATGAGGTTGGAGGAGTTTGCGTGGATTACCAAGAAAAGGACTC
GTCCTCAGTCCTTTCGTTTAATCCGTACTTCGCAGGTGCAGCTCCTGTGC
GGCttgaaaatctttgcaaaaaGATCGGCATGATCGCTTATAAACAAGCA
GGTTCGGTAATGGGTCACGTGTTAACACATGACCAATCAGTGTTGTACAC
GTGGGATGATCCAACCATGGAACAAGAATTGATTTGTTCCATTGTCAATG
ATGAAGCCAGTGAAACAAGGATCAAACTCGATGCCAACGATTTCGGACGA
ATGAGAGTTGGAGATGGTGCAATTTATTGGGTTTCCTTTCTGGATGGTCT
TCAACGTGTTCTATTGTTCACTGATAACTTCAAATCTGCTTACTGCGCAT
GTCAGgaGCAAAATTTACGCCCAACCATGGAAGTTGACTTTGAGATTGAG
AGTTTTGGTTTGTCTCTGGTCAATGTTGATAAGAGAATGGAGATTGGCTA
CTTAGCTATCCGACAAAGCAAGACTGTATGGGAGCAACGCAAGAAAAAGA
ACCGCTGGAAAGCTTTACCGCTTGCCATGTGTGAAGCTCTCGAAGAAGGT
TATCTCAATTATCAAAACAGAAAAGGTGCAGTCAAAGAGAAAGTTCTGGA
TAAGGAGGTGGATTACGAGAAGATGTTTATTACGAAACCTGAGAAGATTA
AGATCAGAAGAACGTACCACAGCGGTCTTGGTTTCAAATACACAATCTCA
CCCAATGAAATGCGTGTGCATGCTTCTATCAGCTCAATACAGTTGGATAG
CCATGTTCCAGGTTCGACCTTTCCAACAGTCTTGCATATGGTTGAACCAC
CAAAATCTGTTGCTTCAGAAAACGCTCCAAAGCCATTCTttgaattgagt
ttaatgaCAAGGATCGGTGATAAAAATGTGGTCAATGAAGTcagCTATTG
TCACGTGTTGATTCAAGAGATGGATGTGAGGGTTGATATTGGATTTTTAT
TGGCTCTGATGGAACTCTTCAGTCATGCAAGAGCTCGAACAACCGAGAAA
GAACAATACGCGCTTGATATTGGCCAAGCAGCAACAAAGTTTGAAGAAAG
CGCTGAATTTCAGGCAGCCAAACAAGATCGATATTACGTTTTGAACGACT
TTCATTTATCACCGCTAAAGATTCACGTCAGTTTCTCTTTGACGGGTGGT
TCCAAAGATGAAAATGCTATTGCTTCATTACATGGTAACGTGTTGAACTT
GTTGTTACAAAGTGTCGGACTGGCCTTCACTGAAATACAAGACGTACAAT
TCAAATTAGCATGTTACGAAGTGCATAAGTCCATGCAGAGTAATTCGCAG
CTCGGTGATGGAATAACTAAACATTATCAAACACAGGCTATCAAGCAACT
TTATGTGTTGGTACTCGGGCTAGACGTTCTTGGTAATCCGTATGGTTTGA
TATCTGGTGTTGGAACCGGAGCAAAGAATTTCTTCTACGAACCTTACCAG
GGATTAATTCAAGGACCAGAAGAATTTGCGGAAGGATTGGCGTATGGGGT
GAAGAGTCTTGTTGGTGGAACCGTGGGTGGAGTATCAGGAGCTGTGAGTA
AGATTACCGGTACCTTCGGTAAAGGTTTGGCTGCATTGACCTTGGATGAA
GAATATCAACAAAAGAGACGTGAAAACATGAGCCAACGCCCAACTAACCT
CGGTGAAGGTCTCGCCAAAGGTGGTAAAGGCCTTGTAAAGGGTATCGTGT
CTGGTGTTACAGGGATCGTTACCAAACCCTATGAAGGTGCCAAGAATGAT
GGTGCAGGTGGCTTTTTTAAGGGCGTTGGAAAAGGCCTGATTGGCGTGGT
TGCACGCCCTGTTGGTGGAGTGGTAGATATGGCCAGTAACACGTTTGATG
GTTTGAAAAGCACGACATCTGGCGTGAAAGCGATCGAGTTGAGCCGTGTT
ACTCGCGTCTTCCACGCAGATAAGGTTTTACGACCTTTCAATCTGTACGA
AGCAGATGGAAACAAAATTCTTATGCAATGTAACAAAGGAGAATACGCCA
AGAAGAATTTTTATATCACTCATGTAGTGGACAAGAAGAACTATCTCATC
CTCACTCAATCaaacATTTTGTATGTTGGAAAGAACGAGTTGAAAATGGG
TGAATGGGAATCggtttgggttatcgagttcaATGAGCTAAAACGTGAAC
CAGAAGTGAAAGAGACAAAGATTATTTTCCATATCCATAATACGGACACG
CGACGTTCAATTTTCAAGAAATCGACGAACACACGTGAAGTGATATTGGA
GTCTAGTGCTGTTGCAGACTGGTTTATCTTAAAGCTTAGAGATGCTAAAA
TGTTATAGatggtatttgaaTCTTTGGTTGCTGACCTCTTGAACAAGTAT
CTGGGTCAATATGTGAAAAATCTTGATGCTTCTCAATTGAAGATTGGCAT
TTGGGGAGGAAATGTTGTCCTGACAGAACTTGAACTGAAAGATACAGCTC
TGGATGATCTTGACTTACCCATAAAAGTTGTTCGTGGATATTTGGgtAAA
TTGGTCTTGTCCATCCCATGGAAAAATCTTTACACTGAATCAACTGTTGT
CGATATTCAAGATCTCCACCTTGTCGCTAAGCCTAATTTTGACATCAAAT
ACAATGAAGAACgcgaagaaaaatcaaaacatgacAAGAAACAACAACAG
ATTCACAATATCGAAGAAGCGAGGCAAAGAGAAGAAGACAAAAAGAAAGG
CGCCAAGAAAGAAGAGAGTGACGGTTTTGCTGAGAAACTTGCAACAAACG
TCATAAAAAATCTACAGGTTACGATCAAGAACATACATGTTCGATATGAA
GACTCAATCAGTGATGTGAATGGACCCTTTTCAGTCGGTCTTACAATGGA
AAGTTTAACAGCACAAACCACAGATGAAGATTTTGTTCCAAAGATTATCA
AAGAATCTGTCTCATTAATTCATAAGatggTGAAATTAGACAATTTGGCT
TTATATTGGAATCCAGGAGACGAACTGATTGATCCTTCACTTGATACCAA
GCAATGGTTGgaagtTTCAACGAAGCAAATTTCAACACACCAATCGAAGC
CAGAGAAAACGAAATATATTTTGAGTCCCATGGTTGCAACGAAGAAATTG
AAGCTGAACACCAAACCAGGTTCCAACCTTGACATCCCGAAGatgttTTT
GAACTTGGTTTTGGAAGAACTTGGTATCATCGTGGCAAGAAGTCAATATC
ATGGCGTGGTGCAACTGATTGAATCATTTGAACGAATGAATAGGAACCAA
CCTTTTCGTAAATACAGACCACATACCTCCGTTCTTGGGAACGAAAGTAT
TTGGTGGAAGTACTGCATGTCCAGCATACTGGAGGTGGATGTCAAAAGAC
GATCTCAAATGTGGAGCTGGAAGCATATTCAAAAACATCGAGTTCTTTGC
AAAGCTTACAAAGTGAAGTAcaaggaaaaattgaaacagaaaaATCCATC
CAAACAAATTCTCACTGAACTAGAGaGCATGGAGGATGAGTTGAATATTG
CAAGCATCACCATTTTTCGACAGCTTGCAGCTACAGAGGTTTTAACGGAA
CAAAAGAAGAAAGGCACTAAAGGAAGTTTCTTCAGTTTCTTCTCCAGATC
AAAAGAACCAGAAAAGTCTGCTGCTAATAAAATTGGAGATTTAATGGGTG
ATGACCAGGAGAAGGAAATGCAGAAATTGTATGACGCAATCGGTTATACT
GAAAATGAAGTCATCACTCCCTTTCCTAAAGAGTACGTGGCGATGTCAGT
GGAATCGATTCTCCAGAAATTATTCATCAGCCTCATCGATGACACAGATA
AGGCGAAAGAATTCAAAGTGTTGGATTTTTCACTCAACAACATCATTGTA
GAAGTTTTCCAAAGACCTTCTGCTCAAGCTCTCAAATTATGTGCAAAGAT
AGGAGAGATGAAGTTATTTGGTACAGCTTCTGCTCAATGTACACCTCtca
tcatcaaaaacatgttaCAAGGTCGAGGTATGGAATTTCTGCCGTTGGTG
GACTTCATCTTTGAGACGAATCCTTTGAAGAAACCGGACATTGACCAATG
TATCACTGCTATTTGTCAACCCTTAGAAATCATCTATGATGCTAACACGA
TCAACCATATCATTAGTTTCTTCAAACCTCCTGAACATGTTATCTTGCAA
GATTTACAAGACAAAGCGTATTCTACTTTCGAAGATTTTAAAGTTTCAAG
TACGGCTGGTCTTCTACATGCTATGGAACAAAGAACGGTTATGGACATCG
ACATTGATGTTGGAGCATCTCATTTGATCATCCCTGAAAAAGGTTCTTAC
AATGGTTGTACAGATATGCTGGTGATCGACTTTGGTAAAATCACGATGAG
CAGCGATCCTAGTCAAATCAGACACCTTGACCCTAAGGACATTGAGGATG
TGAATGAAGTACAAAGCAAAGCTTATGATCGATTCTTGTTGTCGCTTCAA
GCTCTTCAAATATTACTCGTTAGAGAAGGTGAAGATTTAAAGAGTGCTAA
AAGCAACGTCAGTAAAGCTTCATCACACATTTTGCATCCCATCAATTTCG
ATGGCAAACTTGCCAAAGCTATACTTCCACAAGATCCACGTTTAAAACAG
ATATGTGTCTCTGGTGAATTATCTTCGCTGTTTGTTTCTGTATCGGATGA
TAAAGTCAGTCGTCTCATCAAGCTAGCAGACTCGATACCACTCCCTCAAT
CACCTTCTCACGATAACATCGACGGAGAAGAAAAACCTGAAGGACTCTTC
ACCAAGGCGTTGTCAATGATAAGCTTGACAGGTGACAATGACACAGGGGT
GGACATCGGAGGATTTTCCATCCCTGTACCGACATCTCCAACATCAGTGA
CGTCAGATGAAGATGAATACGGGACACCACCTGATGGCTCCATATTACAG
TTACAACAAGAAGCTGGTCCGGACTTTTCATCAGGAGTGGCGAACCAAGT
CAAAGTGGACTTGAACTTTAAAATCCATAAAGTGATGATCGCCATTGGTT
TGACTGACAAAGCATTGAAACAGGAAAAAGAATGTCTGAAATTCATCGTG
GACGACATCAATACAGAGgtGATACTACGAAGATGGGATTTGTTCGTCAA
TGCAGAAGTTGGTCGTCTGGTGTTGAATGAAATGACATGGGGTGTTGATG
GAGAACCTTTCGCCATCATGAGTACacccaaaaacaccaaaatgttGAAA
TTCAGCTATCGGAGGTGTGAATTCAACGAAAGTTTGAATCTCGGTCCAAG
TTACTTTTATTCCAAAGAAGCGCAAGTCAGAGCTTTACATTTCAAAGATG
AATTTGGCGCCACGGATCAGATTTTAGATGTACAAGTGGCTACTTTATTT
CTGATGCTTCATCAAGAAGCACTTTTGAGCATCATGTCATTGATCTACCA
AGTACTGGAACCACTCAACAAACATGATAAGGAAGCCACACAGAAGATCA
AACGGAGTTTGAGTACGGCAGGTAGTCGTTTGAGTCTCTCCatcgaagaa
aaagaaaaggagaGACAGATACAACGAAAATTAGCCAACCCTAAAGCACT
GGAAGCTGCCAACGAACTTAAGCAACAGGTTGGcttagaagaagaaaaaa
agatgaGAGTGACCGCCCACCTGGATGGTGTTGGTATCATGATTTGTTCA
GCCAAAGTTGACCTTGCACAAGCCTTCGTTAAAGGGTTATCTGCTAAAGT
ACTGATGAAAGATGACTTATTAGAAGTGAAAGCCAGCATGAAAGATATGC
AAGTACAAGATAATGTTGGCGAAACAAAGTACAAAGACATCATTAGCATG
CGATCTGATGAAGTGTTCGATTTAGAGTTGGCTATTTACGAGAATGGATC
TTCTGGTAGCAAGCAATACGATATGTCGTGTGTCGACACCAGTGTCAAAC
TGAACTTCGGTCAAATGCGCGTTGTTTTCTTGTATAGATTCATACAAGAC
TTAATGTCATTCACCGAAAACTTCGAAGAAGCACAGAAAGCAGTTGTGGA
AGCTGGTAAAGCTGCCAAGGATAAAGCTCTGGAAACAGCGACCGATTTGA
ATAGACATTCTTCTCGTGTCAAACTAAATGTGGTTCTGAAAGCACCGACT
ATTATCATTCCAGTTGGATCAAACAATGAATTGGCTTTACTGGTGGATCT
GGGTGAATTGCGTATTTACAACACATTCAAACTCCTCAACGATGATCAAT
ACCATAAGAAATCTATCATCACTGATAACATGACCATTAAGTTATCCAAT
CTGAAATTGTTAAAAGCACTTATTCAAGATGGTAAAGATTTCTTGCATCA
ACGAGCCATTATTGAACCTATGATGCTACAAATAACTATTGTTCGTAATT
TAACGAAAGGTAACCATTCCATACCGGATGTTTCAGTTCAAGCAAAGATG
CCAGCTATTCTGTTATCAATCAGTGAAGAAGATGTGACCGTAGCTCTAAA
GATTGTCCAAGGGAATCTCGCCGAAGGTGAGTCACATGCGCCGAAGAAGC
AAGCCAAGCCTGCCAAACAAACGTTAAACGTGCCACAAGATCGTTTAGCA
GACATTTACGAGGAGcctgaagatgaagatgagaaTCGACAAGGATATCT
TCAAACCAAACTATCCTTCGATCTGGCTAAAATTGACATCAAGCTTTACT
TGAAACCATCTGATATGACATTTGAAGATGAATTTTTAGCGAGGACGGAT
GATTTGTTGTTAGCTTTGTTCACTATTGGTAACCTGTGTGTTGATGGAGA
CATCATGTCCACGCAAGCTATGAAGATGAGCGTTCGATTGGACACTTTGG
TGTTGGATGATATGAGACCTATCGAGGAGCATGAAGGTGTTAAACGTATG
ATCAACTACAGTCCCGAGCCACTCCTTGAAGAAGTCAAAACCTCTTCTCA
TAAACGACCAATCGACAACTCACGAATGATCGAAATCCAAttcgatcaaa
cttcatcgcaagataaaaatatcgacATCAAACTTTGTAACATGCTTTGT
ATATTCAACGTTGAGTTTATCATGGTCCTGTTGAAAACGTTGCAAGCTGC
CATACCTAAAGATGATAGTCTGCAACATGGCCATTCAATGAGTAGTCTAG
ACTCGGCGGCAGGGTCTGGCGGCAGCGATGACGAGGACTCTTTAGAAGCC
AGCGAGATTGTCCTCTGCACTGGTGATCAAGAAAGACCTGAGACTAAAGT
CTCTATCTTCGTCCATAACCCGCAAATTGTTTTACTAGCAGATGCAAAGG
ATGTCAAAACAAATGCACTCTTTCTTACAACCGagatcaattttcaatat
ttcgaaTTGCGAGATACTCAAAAAATGATTGGCGCTGTTTCTAACACCGC
TATTTTGTCAACTGCTTTCAAGAATGACCATCGGAGTGATATATCAACAG
TGTTGTCATTAGATTCCATCAATCTCCACTCGTCATCACCCATCAATGGT
AAACCTCATATGAGTGTCAGCACAACTTTGATCAAACTGAATATCTCACC
CAAAACCATCCGAACTTTATCAGCGTGTGCTGGTTACATCTCCAATGATC
CAACAGATGAAGAAATCAAAGAAGCTCGAAAAGCCATGCGTGATTTATGG
CAAATTCAAACGTTCACCAATAAGCGACCGTGGTATTTAAACCACCCACC
ACAACAAGTCTTAAGTGCTGGCAGCTTCGTCCTTGCGCGAACGAGAACAG
GAGAATATAAGCATGGTTTCTTAGCTAAAAAGGATGTCTCGTATCAAGTC
TATTTTTCAGAGGAGCGAGGAACAGCCAGTCACCGAGCCATGGATATCTC
ATCTGTTGTTTTGGATATCGTACCGCTGATCGGTGATCTATGTGTTGGAT
GTAATGTTTTAGCTGTGGAATCGAAAGAACATGGATATCGTACTGGTCGA
ATTACTCAGGTTTGGGATTCGAATGTGGATAAAGATTCTTCGGATGGCGC
CAAACAATCTGTTTCTGTCAAGACAACTGCTATTGCTCCAATCAAATACC
TTGTCAATTTCTATGACAACCAAACGGAGAACTTCTTCCCGCCTGATGAA
CTTCGTATCATTGGTAAACCCATCAAGGGGGTTGTCCCTGGACTAGGGGC
GTGTGTTTACGCCCGCTTTAATGATGGTTTTTACTATCGGGGCAAAGTTG
ATGACATCGAGGATTATCGAATCCGAGTGCAATTGGATGAGATCAGTGGA
GAAATCGAACACGACATCGATGATCCGTCAGCCGTTATTTTGAACCTGAC
GCCTCAATACCGTCAAGTCAAAAAGCATTTCAAAGTCATTGCATCCAAAG
GAAGCACAACTAAAGGATATCATCCGGGGAAAGTGACCGCCATCCAAGGT
GAAGGAAATAACCGATTGTATTCGATACGCTTCGAAGACGGTACAATTAA
CCAAGTACCCATCacgaaattgattttgatgccAAAAGCACCTTTTGATG
CTTTACCTGAAGTTGGCACATACGTTTATTCCCGAGTGTCACGCGACGCT
CCTTTATACGAGAAGGGTATCGTAGCAGAGAAGAACACAATGATCTGCGT
TAAACATTTAAATGGACGGAAATTGGCTCACGAAATACAAAACATTCATT
TTGTTGTCCGAAATATCGTTCCTCTCGTGTCATCAttgaagGTTGGTTTG
GACGTCATAGTGCAACCTGACAATGACGATCAGAAAATGTATTTGGCTGT
CATTAGGGAAGTCACCAAAAAAGAAGGTGACAAAACGAACCGTTATCTAG
TGGAGTTTACGGATGGATCCAAGAAGAGAGTGACGCCCAGCCGGATCCGT
ATACTTTCTCAATACGGAAGTGCAGAAACGAGTGAAGAAAATGCTGACAT
TATCACAACAAGACAGGAGGAACTAGTTCTCGATGTGCAAGGTATCTCAT
TACGTGTGGAAGGTTACTTGGGAGGCGTGTTGACACCCATGCTCAAAATG
GATTCCAAAATCACAGCTAACTTGAAGGATTGGTCAAGCCAAATGAATGC
ACACGCTACTGTATCATTAGAAGCCAGTTATTATAACGAAAACGTTGCCG
AATGGGAGCCAGTTATTGAACCTTTGATGGAGAAACGGAGGGAAAGACCG
TGGCAACTCTCTGTCAATTACACGATGGAAGGTGACGACAATTCTGCTTC
ATCCACTTCCAACGAACTCGTTTTACAAAAACCGGAATCCAACCTGAAAA
TCAAATCTCAAGATAATCTTGAATTGACAATTTCAAAATCATGTCTTGCT
TTACTCGGTGAATTGGGACAGGTGTTTGGAGATGCAGTAGAATCTGTGGA
CGTTTTACCACAAGTCCTGGTCGAAAAAGAACCTTTCATGATCGAAAACT
TGCTCTCCAAGAAGGTGACAGTAACATTGAATGAACTTCTGCAGGGACCA
AATGGAGATTCGACAATCGAGCTAGCATCTTCTTCGAATCCTGTTGGCAT
TACTTTTGCTCCCAagaaatttgagaaacgaaAGACCAACGATCTATACA
CAATCAATTTAtcgGTGGACGGTTTTCATGACATTAAAGACATTGTGGTT
CAAAGAAAGCGAAGCGTTATCTATGATCTTGTACCAATAAAACTATTATC
AGCACAGTCTTCATATTCGATAGTGGTACAAGTGAAGACAACAGACGGAC
AACGTATCATCGTACTCCGATCACCATTGCAGTTGAAAAATCACTTTCCA
ATGCCGTTGGATGTCAGCTACATTTCCAAAGAAAACCAACCAGTTAAACT
GACAACAGTGGGATCGGGAGATATCTATTCCTTCCCTTTGTTGTTAACCT
ACCACAGTGTTTTTCATCTCAAACCTGCTGGTTTCGACTACGGTGATTGC
ACAGAAGCTCTCAATTGGAGTGATTTGAAGACGAGCAACGAAAAACAGTT
CTCCTGCCCTTCACCTGACAAAAGTGCTGACCCTTTCTACATGCAGGTGG
TGATGAAAGAGGAGACGTACTCTTCCGTACACGGCATGTTGGACTGTGTA
CCACGTTACACGTTGGAGTGCTTTCCCGTCATCACGCTGCATAATTACCT
ACCTTGCACTATTAATTATAAGATCAAGGGTATGGCGAAATCGGAAAGTC
TACCAGGCGGACACAATTGGCCTTTGTTTACCGTCAACTTCAGTGATAAA
CCTTCCATCTATATCGAGATTGAGTCGTATAACAACCAAAGATGGGAAGG
AGGTTTGACATTACCAACAAAACCGGTAGATTCTTTGAACAAACCATCAT
TATCTTTCGTCATGATGTCTGGTGAACGCAAAATGGAATTGGGTGTTTAT
TACCAGTTAGACGGTTCATTGAACATCACCTTATATTCGCCTTACTGGCT
TCTCAATAAAACTGGAAAACCACTTGTCTATCAGCCAGCGGGGAGCAGCA
TCCAGCAAGTTCACCAAGAGAACGATGTAAATGCTCTTATGATGCTCGTC
AAAGGGAAACATAAAAAGgcgaaagtgaaagtgaaaaataGCGAGTCATG
GTCAAATGAATTTTCATTGGATACTGTTGGCAGTGGTGGTTCCTTGAAAT
GCAATGGTCCAAGAGATCGAGTTTATGAGATTGGTTTGAACATCAGTTTG
TCATACTTTGGATTGACGAAGATTGTGACGTTCACGCCACTCCGAATGTT
ATCTAACCACACCAAGTACACCATCAGTATGGCAGAAAGTAATTCTAAAT
CGTCAGAATGGCACACGGTAAACCCTGACGAGaacattccatTCTGGCCG
ACGAAACTTCCTTTGGTCAACCTTTACATTAACATCAATGGGCAAGATTC
AGTGAAATTCAACCCTGAAGTTGGAAAAACTTTACTGTTGAAGTTCCAGA
ATGAGGTTGGAGGAGTTTGCGTGGATTACCAAGAAAAGGACTCGTCCTCA
GTCCTTTCGTTTAATCCGTACTTCGCAGGTGCAGCTCCTGTGCGGCttga
aaatctttgcaaaaaGATCGGCATGATCGCTTATAAACAAGCAGGTTCGG
TAATGGGTCACGTGTTAACACATGACCAATCAGTGTTGTACACGTGGGAT
GATCCAACCATGGAACAAGAATTGATTTGTTCCATTGTCAATGATGAAGC
CAGTGAAACAAGGATCAAACTCGATGCCAACGATTTCGGACGAATGAGAG
TTGGAGATGGTGCAATTTATTGGGTTTCCTTTCTGGATGGTCTTCAACGT
GTTCTATTGTTCACTGATAACTTCAAATCTGCTTACTGCGCATGTCAGga
GCAAAATTTACGCCCAACCATGGAAGTTGACTTTGAGATTGAGAGTTTTG
GTTTGTCTCTGGTCAATGTTGATAAGAGAATGGAGATTGGCTACTTAGCT
ATCCGACAAAGCAAGACTGTATGGGAGCAACGCAAGAAAAAGAACCGCTG
GAAAGCTTTACCGCTTGCCATGTGTGAAGCTCTCGAAGAAGGTTATCTCA
ATTATCAAAACAGAAAAGGTGCAGTCAAAGAGAAAGTTCTGGATAAGGAG
GTGGATTACGAGAAGATGTTTATTACGAAACCTGAGAAGATTAAGATCAG
AAGAACGTACCACAGCGGTCTTGGTTTCAAATACACAATCTCACCCAATG
AAATGCGTGTGCATGCTTCTATCAGCTCAATACAGTTGGATAGCCATGTT
CCAGGTTCGACCTTTCCAACAGTCTTGCATATGGTTGAACCACCAAAATC
TGTTGCTTCAGAAAACGCTCCAAAGCCATTCTttgaattgagtttaatga
CAAGGATCGGTGATAAAAATGTGGTCAATGAAGTcagCTATTGTCACGTG
TTGATTCAAGAGATGGATGTGAGGGTTGATATTGGATTTTTATTGGCTCT
GATGGAACTCTTCAGTCATGCAAGAGCTCGAACAACCGAGAAAGAACAAT
ACGCGCTTGATATTGGCCAAGCAGCAACAAAGTTTGAAGAAAGCGCTGAA
TTTCAGGCAGCCAAACAAGATCGATATTACGTTTTGAACGACTTTCATTT
ATCACCGCTAAAGATTCACGTCAGTTTCTCTTTGACGGGTGGTTCCAAAG
ATGAAAATGCTATTGCTTCATTACATGGTAACGTGTTGAACTTGTTGTTA
CAAAGTGTCGGACTGGCCTTCACTGAAATACAAGACGTACAATTCAAATT
AGCATGTTACGAAGTGCATAAGTCCATGCAGAGTAATTCGCAGCTCGGTG
ATGGAATAACTAAACATTATCAAACACAGGCTATCAAGCAACTTTATGTG
TTGGTACTCGGGCTAGACGTTCTTGGTAATCCGTATGGTTTGATATCTGG
TGTTGGAACCGGAGCAAAGAATTTCTTCTACGAACCTTACCAGGGATTAA
TTCAAGGACCAGAAGAATTTGCGGAAGGATTGGCGTATGGGGTGAAGAGT
CTTGTTGGTGGAACCGTGGGTGGAGTATCAGGAGCTGTGAGTAAGATTAC
CGGTACCTTCGGTAAAGGTTTGGCTGCATTGACCTTGGATGAAGAATATC
AACAAAAGAGACGTGAAAACATGAGCCAACGCCCAACTAACCTCGGTGAA
GGTCTCGCCAAAGGTGGTAAAGGCCTTGTAAAGGGTATCGTGTCTGGTGT
TACAGGGATCGTTACCAAACCCTATGAAGGTGCCAAGAATGATGGTGCAG
GTGGCTTTTTTAAGGGCGTTGGAAAAGGCCTGATTGGCGTGGTTGCACGC
CCTGTTGGTGGAGTGGTAGATATGGCCAGTAACACGTTTGATGGTTTGAA
AAGCACGACATCTGGCGTGAAAGCGATCGAGTTGAGCCGTGTTACTCGCG
TCTTCCACGCAGATAAGGTTTTACGACCTTTCAATCTGTACGAAGCAGAT
GGAAACAAAATTCTTATGCAATGTAACAAAGGAGAATACGCCAAGAAGAA
TTTTTATATCACTCATGTAGTGGACAAGAAGAACTATCTCATCCTCACTC
AATCaaacATTTTGTATGTTGGAAAGAACGAGTTGAAAATGGGTGAATGG
GAATCggtttgggttatcgagttcaATGAGCTAAAACGTGAACCAGAAGT
GAAAGAGACAAAGATTATTTTCCATATCCATAATACGGACACGCGACGTT
CAATTTTCAAGAAATCGACGAACACACGTGAAGTGATATTGGAGTCTAGT
GCTGTTGCAGACTGGTTTATCTTAAAGCTTAGAGATGCTAAAATGTTATA
GatggtatttgaaTCTTTGGTTGCTGACCTCTTGAACAAGTATCTGGGTC
AATATGTGAAAAATCTTGATGCTTCTCAATTGAAGATTGGCATTTGGGGA
GGAAATGTTGTCCTGACAGAACTTGAACTGAAAGATACAGCTCTGGATGA
TCTTGACTTACCCATAAAAGTTGTTCGTGGATATTTGGgtAAATTGGTCT
TGTCCATCCCATGGAAAAATCTTTACACTGAATCAACTGTTGTCGATATT
CAAGATCTCCACCTTGTCGCTAAGCCTAATTTTGACATCAAATACAATGA
AGAACgcgaagaaaaatcaaaacatgacAAGAAACAACAACAGATTCACA
ATATCGAAGAAGCGAGGCAAAGAGAAGAAGACAAAAAGAAAGGCGCCAAG
AAAGAAGAGAGTGACGGTTTTGCTGAGAAACTTGCAACAAACGTCATAAA
AAATCTACAGGTTACGATCAAGAACATACATGTTCGATATGAAGACTCAA
TCAGTGATGTGAATGGACCCTTTTCAGTCGGTCTTACAATGGAAAGTTTA
ACAGCACAAACCACAGATGAAGATTTTGTTCCAAAGATTATCAAAGAATC
TGTCTCATTAATTCATAAGatggTGAAATTAGACAATTTGGCTTTATATT
GGAATCCAGGAGACGAACTGATTGATCCTTCACTTGATACCAAGCAATGG
TTGgaagtTTCAACGAAGCAAATTTCAACACACCAATCGAAGCCAGAGAA
AACGAAATATATTTTGAGTCCCATGGTTGCAACGAAGAAATTGAAGCTGA
ACACCAAACCAGGTTCCAACCTTGACATCCCGAAGatgttTTTGAACTTG
GTTTTGGAAGAACTTGGTATCATCGTGGCAAGAAGTCAATATCATGGCGT
GGTGCAACTGATTGAATCATTTGAACGAATGAATAGGAACCAACCTTTTC
GTAAATACAGACCACATACCTCCGTTCTTGGGAACGAAAGTATTTGGTGG
AAGTACTGCATGTCCAGCATACTGGAGGTGGATGTCAAAAGACGATCTCA
AATGTGGAGCTGGAAGCATATTCAAAAACATCGAGTTCTTTGCAAAGCTT
ACAAAGTGAAGTAcaaggaaaaattgaaacagaaaaATCCATCCAAACAA
ATTCTCACTGAACTAGAGaGCATGGAGGATGAGTTGAATATTGCAAGCAT
CACCATTTTTCGACAGCTTGCAGCTACAGAGGTTTTAACGGAACAAAAGA
AGAAAGGCACTAAAGGAAGTTTCTTCAGTTTCTTCTCCAGATCAAAAGAA
CCAGAAAAGTCTGCTGCTAATAAAATTGGAGATTTAATGGGTGATGACCA
GGAGAAGGAAATGCAGAAATTGTATGACGCAATCGGTTATACTGAAAATG
AAGTCATCACTCCCTTTCCTAAAGAGTACGTGGCGATGTCAGTGGAATCG
ATTCTCCAGAAATTATTCATCAGCCTCATCGATGACACAGATAAGGCGAA
AGAATTCAAAGTGTTGGATTTTTCACTCAACAACATCATTGTAGAAGTTT
TCCAAAGACCTTCTGCTCAAGCTCTCAAATTATGTGCAAAGATAGGAGAG
ATGAAGTTATTTGGTACAGCTTCTGCTCAATGTACACCTCtcatcatcaa
aaacatgttaCAAGGTCGAGGTATGGAATTTCTGCCGTTGGTGGACTTCA
TCTTTGAGACGAATCCTTTGAAGAAACCGGACATTGACCAATGTATCACT
GCTATTTGTCAACCCTTAGAAATCATCTATGATGCTAACACGATCAACCA
TATCATTAGTTTCTTCAAACCTCCTGAACATGTTATCTTGCAAGATTTAC
AAGACAAAGCGTATTCTACTTTCGAAGATTTTAAAGTTTCAAGTACGGCT
GGTCTTCTACATGCTATGGAACAAAGAACGGTTATGGACATCGACATTGA
TGTTGGAGCATCTCATTTGATCATCCCTGAAAAAGGTTCTTACAATGGTT
GTACAGATATGCTGGTGATCGACTTTGGTAAAATCACGATGAGCAGCGAT
CCTAGTCAAATCAGACACCTTGACCCTAAGGACATTGAGGATGTGAATGA
AGTACAAAGCAAAGCTTATGATCGATTCTTGTTGTCGCTTCAAGCTCTTC
AAATATTACTCGTTAGAGAAGGTGAAGATTTAAAGAGTGCTAAAAGCAAC
GTCAGTAAAGCTTCATCACACATTTTGCATCCCATCAATTTCGATGGCAA
ACTTGCCAAAGCTATACTTCCACAAGATCCACGTTTAAAACAGATATGTG
TCTCTGGTGAATTATCTTCGCTGTTTGTTTCTGTATCGGATGATAAAGTC
AGTCGTCTCATCAAGCTAGCAGACTCGATACCACTCCCTCAATCACCTTC
TCACGATAACATCGACGGAGAAGAAAAACCTGAAGGACTCTTCACCAAGG
CGTTGTCAATGATAAGCTTGACAGGTGACAATGACACAGGGGTGGACATC
GGAGGATTTTCCATCCCTGTACCGACATCTCCAACATCAGTGACGTCAGA
TGAAGATGAATACGGGACACCACCTGATGGCTCCATATTACAGTTACAAC
AAGAAGCTGGTCCGGACTTTTCATCAGGAGTGGCGAACCAAGTCAAAGTG
GACTTGAACTTTAAAATCCATAAAGTGATGATCGCCATTGGTTTGACTGA
CAAAGCATTGAAACAGGAAAAAGAATGTCTGAAATTCATCGTGGACGACA
TCAATACAGAGgtGATACTACGAAGATGGGATTTGTTCGTCAATGCAGAA
GTTGGTCGTCTGGTGTTGAATGAAATGACATGGGGTGTTGATGGAGAACC
TTTCGCCATCATGAGTACacccaaaaacaccaaaatgttGAAATTCAGCT
ATCGGAGGTGTGAATTCAACGAAAGTTTGAATCTCGGTCCAAGTTACTTT
TATTCCAAAGAAGCGCAAGTCAGAGCTTTACATTTCAAAGATGAATTTGG
CGCCACGGATCAGATTTTAGATGTACAAGTGGCTACTTTATTTCTGATGC
TTCATCAAGAAGCACTTTTGAGCATCATGTCATTGATCTACCAAGTACTG
GAACCACTCAACAAACATGATAAGGAAGCCACACAGAAGATCAAACGGAG
TTTGAGTACGGCAGGTAGTCGTTTGAGTCTCTCCatcgaagaaaaagaaa
aggagaGACAGATACAACGAAAATTAGCCAACCCTAAAGCACTGGAAGCT
GCCAACGAACTTAAGCAACAGGTTGGcttagaagaagaaaaaaagatgaG
AGTGACCGCCCACCTGGATGGTGTTGGTATCATGATTTGTTCAGCCAAAG
TTGACCTTGCACAAGCCTTCGTTAAAGGGTTATCTGCTAAAGTACTGATG
AAAGATGACTTATTAGAAGTGAAAGCCAGCATGAAAGATATGCAAGTACA
AGATAATGTTGGCGAAACAAAGTACAAAGACATCATTAGCATGCGATCTG
ATGAAGTGTTCGATTTAGAGTTGGCTATTTACGAGAATGGATCTTCTGGT
AGCAAGCAATACGATATGTCGTGTGTCGACACCAGTGTCAAACTGAACTT
CGGTCAAATGCGCGTTGTTTTCTTGTATAGATTCATACAAGACTTAATGT
CATTCACCGAAAACTTCGAAGAAGCACAGAAAGCAGTTGTGGAAGCTGGT
AAAGCTGCCAAGGATAAAGCTCTGGAAACAGCGACCGATTTGAATAGACA
TTCTTCTCGTGTCAAACTAAATGTGGTTCTGAAAGCACCGACTATTATCA
TTCCAGTTGGATCAAACAATGAATTGGCTTTACTGGTGGATCTGGGTGAA
TTGCGTATTTACAACACATTCAAACTCCTCAACGATGATCAATACCATAA
GAAATCTATCATCACTGATAACATGACCATTAAGTTATCCAATCTGAAAT
TGTTAAAAGCACTTATTCAAGATGGTAAAGATTTCTTGCATCAACGAGCC
ATTATTGAACCTATGATGCTACAAATAACTATTGTTCGTAATTTAACGAA
AGGTAACCATTCCATACCGGATGTTTCAGTTCAAGCAAAGATGCCAGCTA
TTCTGTTATCAATCAGTGAAGAAGATGTGACCGTAGCTCTAAAGATTGTC
CAAGGGAATCTCGCCGAAGGTGAGTCACATGCGCCGAAGAAGCAAGCCAA
GCCTGCCAAACAAACGTTAAACGTGCCACAAGATCGTTTAGCAGACATTT
ACGAGGAGcctgaagatgaagatgagaaTCGACAAGGATATCTTCAAACC
AAACTATCCTTCGATCTGGCTAAAATTGACATCAAGCTTTACTTGAAACC
ATCTGATATGACATTTGAAGATGAATTTTTAGCGAGGACGGATGATTTGT
TGTTAGCTTTGTTCACTATTGGTAACCTGTGTGTTGATGGAGACATCATG
TCCACGCAAGCTATGAAGATGAGCGTTCGATTGGACACTTTGGTGTTGGA
TGATATGAGACCTATCGAGGAGCATGAAGGTGTTAAACGTATGATCAACT
ACAGTCCCGAGCCACTCCTTGAAGAAGTCAAAACCTCTTCTCATAAACGA
CCAATCGACAACTCACGAATGATCGAAATCCAAttcgatcaaacttcatc
gcaagataaaaatatcgacATCAAACTTTGTAACATGCTTTGTATATTCA
ACGTTGAGTTTATCATGGTCCTGTTGAAAACGTTGCAAGCTGCCATACCT
AAAGATGATAGTCTGCAACATGGCCATTCAATGAGTAGTCTAGACTCGGC
GGCAGGGTCTGGCGGCAGCGATGACGAGGACTCTTTAGAAGCCAGCGAGA
TTGTCCTCTGCACTGGTGATCAAGAAAGACCTGAGACTAAAGTCTCTATC
TTCGTCCATAACCCGCAAATTGTTTTACTAGCAGATGCAAAGGATGTCAA
AACAAATGCACTCTTTCTTACAACCGagatcaattttcaatatttcgaaT
TGCGAGATACTCAAAAAATGATTGGCGCTGTTTCTAACACCGCTATTTTG
TCAACTGCTTTCAAGAATGACCATCGGAGTGATATATCAACAGTGTTGTC
ATTAGATTCCATCAATCTCCACTCGTCATCACCCATCAATGGTAAACCTC
ATATGAGTGTCAGCACAACTTTGATCAAACTGAATATCTCACCCAAAACC
ATCCGAACTTTATCAGCGTGTGCTGGTTACATCTCCAATGATCCAACAGA
TGAAGAAATCAAAGAAGCTCGAAAAGCCATGCGTGATTTATGGCAAATTC
AAACGTTCACCAATAAGCGACCGTGGTATTTAAACCACCCACCACAACAA
GTCTTAAGTGCTGGCAGCTTCGTCCTTGCGCGAACGAGAACAGGAGAATA
TAAGCATGGTTTCTTAGCTAAAAAGGATGTCTCGTATCAAGTCTATTTTT
CAGAGGAGCGAGGAACAGCCAGTCACCGAGCCATGGATATCTCATCTGTT
GTTTTGGATATCGTACCGCTGATCGGTGATCTATGTGTTGGATGTAATGT
TTTAGCTGTGGAATCGAAAGAACATGGATATCGTACTGGTCGAATTACTC
AGGTTTGGGATTCGAATGTGGATAAAGATTCTTCGGATGGCGCCAAACAA
TCTGTTTCTGTCAAGACAACTGCTATTGCTCCAATCAAATACCTTGTCAA
TTTCTATGACAACCAAACGGAGAACTTCTTCCCGCCTGATGAACTTCGTA
TCATTGGTAAACCCATCAAGGGGGTTGTCCCTGGACTAGGGGCGTGTGTT
TACGCCCGCTTTAATGATGGTTTTTACTATCGGGGCAAAGTTGATGACAT
CGAGGATTATCGAATCCGAGTGCAATTGGATGAGATCAGTGGAGAAATCG
AACACGACATCGATGATCCGTCAGCCGTTATTTTGAACCTGACGCCTCAA
TACCGTCAAGTCAAAAAGCATTTCAAAGTCATTGCATCCAAAGGAAGCAC
AACTAAAGGATATCATCCGGGGAAAGTGACCGCCATCCAAGGTGAAGGAA
ATAACCGATTGTATTCGATACGCTTCGAAGACGGTACAATTAACCAAGTA
CCCATCacgaaattgattttgatgccAAAAGCACCTTTTGATGCTTTACC
TGAAGTTGGCACATACGTTTATTCCCGAGTGTCACGCGACGCTCCTTTAT
ACGAGAAGGGTATCGTAGCAGAGAAGAACACAATGATCTGCGTTAAACAT
TTAAATGGACGGAAATTGGCTCACGAAATACAAAACATTCATTTTGTTGT
CCGAAATATCGTTCCTCTCGTGTCATCAttgaagGTTGGTTTGGACGTCA
TAGTGCAACCTGACAATGACGATCAGAAAATGTATTTGGCTGTCATTAGG
GAAGTCACCAAAAAAGAAGGTGACAAAACGAACCGTTATCTAGTGGAGTT
TACGGATGGATCCAAGAAGAGAGTGACGCCCAGCCGGATCCGTATACTTT
CTCAATACGGAAGTGCAGAAACGAGTGAAGAAAATGCTGACATTATCACA
ACAAGACAGGAGGAACTAGTTCTCGATGTGCAAGGTATCTCATTACGTGT
GGAAGGTTACTTGGGAGGCGTGTTGACACCCATGCTCAAAATGGATTCCA
AAATCACAGCTAACTTGAAGGATTGGTCAAGCCAAATGAATGCACACGCT
ACTGTATCATTAGAAGCCAGTTATTATAACGAAAACGTTGCCGAATGGGA
GCCAGTTATTGAACCTTTGATGGAGAAACGGAGGGAAAGACCGTGGCAAC
TCTCTGTCAATTACACGATGGAAGGTGACGACAATTCTGCTTCATCCACT
TCCAACGAACTCGTTTTACAAAAACCGGAATCCAACCTGAAAATCAAATC
TCAAGATAATCTTGAATTGACAATTTCAAAATCATGTCTTGCTTTACTCG
GTGAATTGGGACAGGTGTTTGGAGATGCAGTAGAATCTGTGGACGTTTTA
CCACAAGTCCTGGTCGAAAAAGAACCTTTCATGATCGAAAACTTGCTCTC
CAAGAAGGTGACAGTAACATTGAATGAACTTCTGCAGGGACCAAATGGAG
ATTCGACAATCGAGCTAGCATCTTCTTCGAATCCTGTTGGCATTACTTTT
GCTCCCAagaaatttgagaaacgaaAGACCAACGATCTATACACAATCAA
TTTAtcgGTGGACGGTTTTCATGACATTAAAGACATTGTGGTTCAAAGAA
AGCGAAGCGTTATCTATGATCTTGTACCAATAAAACTATTATCAGCACAG
TCTTCATATTCGATAGTGGTACAAGTGAAGACAACAGACGGACAACGTAT
CATCGTACTCCGATCACCATTGCAGTTGAAAAATCACTTTCCAATGCCGT
TGGATGTCAGCTACATTTCCAAAGAAAACCAACCAGTTAAACTGACAACA
GTGGGATCGGGAGATATCTATTCCTTCCCTTTGTTGTTAACCTACCACAG
TGTTTTTCATCTCAAACCTGCTGGTTTCGACTACGGTGATTGCACAGAAG
CTCTCAATTGGAGTGATTTGAAGACGAGCAACGAAAAACAGTTCTCCTGC
CCTTCACCTGACAAAAGTGCTGACCCTTTCTACATGCAGGTGGTGATGAA
AGAGGAGACGTACTCTTCCGTACACGGCATGTTGGACTGTGTACCACGTT
ACACGTTGGAGTGCTTTCCCGTCATCACGCTGCATAATTACCTACCTTGC
ACTATTAATTATAAGATCAAGGGTATGGCGAAATCGGAAAGTCTACCAGG
CGGACACAATTGGCCTTTGTTTACCGTCAACTTCAGTGATAAACCTTCCA
TCTATATCGAGATTGAGTCGTATAACAACCAAAGATGGGAAGGAGGTTTG
ACATTACCAACAAAACCGGTAGATTCTTTGAACAAACCATCATTATCTTT
CGTCATGATGTCTGGTGAACGCAAAATGGAATTGGGTGTTTATTACCAGT
TAGACGGTTCATTGAACATCACCTTATATTCGCCTTACTGGCTTCTCAAT
AAAACTGGAAAACCACTTGTCTATCAGCCAGCGGGGAGCAGCATCCAGCA
AGTTCACCAAGAGAACGATGTAAATGCTCTTATGATGCTCGTCAAAGGGA
AACATAAAAAGgcgaaagtgaaagtgaaaaataGCGAGTCATGGTCAAAT
GAATTTTCATTGGATACTGTTGGCAGTGGTGGTTCCTTGAAATGCAATGG
TCCAAGAGATCGAGTTTATGAGATTGGTTTGAACATCAGTTTGTCATACT
TTGGATTGACGAAGATTGTGACGTTCACGCCACTCCGAATGTTATCTAAC
CACACCAAGTACACCATCAGTATGGCAGAAAGTAATTCTAAATCGTCAGA
ATGGCACACGGTAAACCCTGACGAGaacattccatTCTGGCCGACGAAAC
TTCCTTTGGTCAACCTTTACATTAACATCAATGGGCAAGATTCAGTGAAA
TTCAACCCTGAAGTTGGAAAAACTTTACTGTTGAAGTTCCAGAATGAGGT
TGGAGGAGTTTGCGTGGATTACCAAGAAAAGGACTCGTCCTCAGTCCTTT
CGTTTAATCCGTACTTCGCAGGTGCAGCTCCTGTGCGGCttgaaaatctt
tgcaaaaaGATCGGCATGATCGCTTATAAACAAGCAGGTTCGGTAATGGG
TCACGTGTTAACACATGACCAATCAGTGTTGTACACGTGGGATGATCCAA
CCATGGAACAAGAATTGATTTGTTCCATTGTCAATGATGAAGCCAGTGAA
ACAAGGATCAAACTCGATGCCAACGATTTCGGACGAATGAGAGTTGGAGA
TGGTGCAATTTATTGGGTTTCCTTTCTGGATGGTCTTCAACGTGTTCTAT
TGTTCACTGATAACTTCAAATCTGCTTACTGCGCATGTCAGgaGCAAAAT
TTACGCCCAACCATGGAAGTTGACTTTGAGATTGAGAGTTTTGGTTTGTC
TCTGGTCAATGTTGATAAGAGAATGGAGATTGGCTACTTAGCTATCCGAC
AAAGCAAGACTGTATGGGAGCAACGCAAGAAAAAGAACCGCTGGAAAGCT
TTACCGCTTGCCATGTGTGAAGCTCTCGAAGAAGGTTATCTCAATTATCA
AAACAGAAAAGGTGCAGTCAAAGAGAAAGTTCTGGATAAGGAGGTGGATT
ACGAGAAGATGTTTATTACGAAACCTGAGAAGATTAAGATCAGAAGAACG
TACCACAGCGGTCTTGGTTTCAAATACACAATCTCACCCAATGAAATGCG
TGTGCATGCTTCTATCAGCTCAATACAGTTGGATAGCCATGTTCCAGGTT
CGACCTTTCCAACAGTCTTGCATATGGTTGAACCACCAAAATCTGTTGCT
TCAGAAAACGCTCCAAAGCCATTCTttgaattgagtttaatgaCAAGGAT
CGGTGATAAAAATGTGGTCAATGAAGTcagCTATTGTCACGTGTTGATTC
AAGAGATGGATGTGAGGGTTGATATTGGATTTTTATTGGCTCTGATGGAA
CTCTTCAGTCATGCAAGAGCTCGAACAACCGAGAAAGAACAATACGCGCT
TGATATTGGCCAAGCAGCAACAAAGTTTGAAGAAAGCGCTGAATTTCAGG
CAGCCAAACAAGATCGATATTACGTTTTGAACGACTTTCATTTATCACCG
CTAAAGATTCACGTCAGTTTCTCTTTGACGGGTGGTTCCAAAGATGAAAA
TGCTATTGCTTCATTACATGGTAACGTGTTGAACTTGTTGTTACAAAGTG
TCGGACTGGCCTTCACTGAAATACAAGACGTACAATTCAAATTAGCATGT
TACGAAGTGCATAAGTCCATGCAGAGTAATTCGCAGCTCGGTGATGGAAT
AACTAAACATTATCAAACACAGGCTATCAAGCAACTTTATGTGTTGGTAC
TCGGGCTAGACGTTCTTGGTAATCCGTATGGTTTGATATCTGGTGTTGGA
ACCGGAGCAAAGAATTTCTTCTACGAACCTTACCAGGGATTAATTCAAGG
ACCAGAAGAATTTGCGGAAGGATTGGCGTATGGGGTGAAGAGTCTTGTTG
GTGGAACCGTGGGTGGAGTATCAGGAGCTGTGAGTAAGATTACCGGTACC
TTCGGTAAAGGTTTGGCTGCATTGACCTTGGATGAAGAATATCAACAAAA
GAGACGTGAAAACATGAGCCAACGCCCAACTAACCTCGGTGAAGGTCTCG
CCAAAGGTGGTAAAGGCCTTGTAAAGGGTATCGTGTCTGGTGTTACAGGG
ATCGTTACCAAACCCTATGAAGGTGCCAAGAATGATGGTGCAGGTGGCTT
TTTTAAGGGCGTTGGAAAAGGCCTGATTGGCGTGGTTGCACGCCCTGTTG
GTGGAGTGGTAGATATGGCCAGTAACACGTTTGATGGTTTGAAAAGCACG
ACATCTGGCGTGAAAGCGATCGAGTTGAGCCGTGTTACTCGCGTCTTCCA
CGCAGATAAGGTTTTACGACCTTTCAATCTGTACGAAGCAGATGGAAACA
AAATTCTTATGCAATGTAACAAAGGAGAATACGCCAAGAAGAATTTTTAT
ATCACTCATGTAGTGGACAAGAAGAACTATCTCATCCTCACTCAATCaaa
cATTTTGTATGTTGGAAAGAACGAGTTGAAAATGGGTGAATGGGAATCgg
tttgggttatcgagttcaATGAGCTAAAACGTGAACCAGAAGTGAAAGAG
ACAAAGATTATTTTCCATATCCATAATACGGACACGCGACGTTCAATTTT
CAAGAAATCGACGAACACACGTGAAGTGATATTGGAGTCTAGTGCTGTTG
CAGACTGGTTTATCTTAAAGCTTAGAGATGCTAAAATGTTATAGatggta
tttgaaTCTTTGGTTGCTGACCTCTTGAACAAGTATCTGGGTCAATATGT
GAAAAATCTTGATGCTTCTCAATTGAAGATTGGCATTTGGGGAGGAAATG
TTGTCCTGACAGAACTTGAACTGAAAGATACAGCTCTGGATGATCTTGAC
TTACCCATAAAAGTTGTTCGTGGATATTTGGgtAAATTGGTCTTGTCCAT
CCCATGGAAAAATCTTTACACTGAATCAACTGTTGTCGATATTCAAGATC
TCCACCTTGTCGCTAAGCCTAATTTTGACATCAAATACAATGAAGAACgc
gaagaaaaatcaaaacatgacAAGAAACAACAACAGATTCACAATATCGA
AGAAGCGAGGCAAAGAGAAGAAGACAAAAAGAAAGGCGCCAAGAAAGAAG
AGAGTGACGGTTTTGCTGAGAAACTTGCAACAAACGTCATAAAAAATCTA
CAGGTTACGATCAAGAACATACATGTTCGATATGAAGACTCAATCAGTGA
TGTGAATGGACCCTTTTCAGTCGGTCTTACAATGGAAAGTTTAACAGCAC
AAACCACAGATGAAGATTTTGTTCCAAAGATTATCAAAGAATCTGTCTCA
TTAATTCATAAGatggTGAAATTAGACAATTTGGCTTTATATTGGAATCC
AGGAGACGAACTGATTGATCCTTCACTTGATACCAAGCAATGGTTGgaag
tTTCAACGAAGCAAATTTCAACACACCAATCGAAGCCAGAGAAAACGAAA
TATATTTTGAGTCCCATGGTTGCAACGAAGAAATTGAAGCTGAACACCAA
ACCAGGTTCCAACCTTGACATCCCGAAGatgttTTTGAACTTGGTTTTGG
AAGAACTTGGTATCATCGTGGCAAGAAGTCAATATCATGGCGTGGTGCAA
CTGATTGAATCATTTGAACGAATGAATAGGAACCAACCTTTTCGTAAATA
CAGACCACATACCTCCGTTCTTGGGAACGAAAGTATTTGGTGGAAGTACT
GCATGTCCAGCATACTGGAGGTGGATGTCAAAAGACGATCTCAAATGTGG
AGCTGGAAGCATATTCAAAAACATCGAGTTCTTTGCAAAGCTTACAAAGT
GAAGTAcaaggaaaaattgaaacagaaaaATCCATCCAAACAAATTCTCA
CTGAACTAGAGaGCATGGAGGATGAGTTGAATATTGCAAGCATCACCATT
TTTCGACAGCTTGCAGCTACAGAGGTTTTAACGGAACAAAAGAAGAAAGG
CACTAAAGGAAGTTTCTTCAGTTTCTTCTCCAGATCAAAAGAACCAGAAA
AGTCTGCTGCTAATAAAATTGGAGATTTAATGGGTGATGACCAGGAGAAG
GAAATGCAGAAATTGTATGACGCAATCGGTTATACTGAAAATGAAGTCAT
CACTCCCTTTCCTAAAGAGTACGTGGCGATGTCAGTGGAATCGATTCTCC
AGAAATTATTCATCAGCCTCATCGATGACACAGATAAGGCGAAAGAATTC
AAAGTGTTGGATTTTTCACTCAACAACATCATTGTAGAAGTTTTCCAAAG
ACCTTCTGCTCAAGCTCTCAAATTATGTGCAAAGATAGGAGAGATGAAGT
TATTTGGTACAGCTTCTGCTCAATGTACACCTCtcatcatcaaaaacatg
ttaCAAGGTCGAGGTATGGAATTTCTGCCGTTGGTGGACTTCATCTTTGA
GACGAATCCTTTGAAGAAACCGGACATTGACCAATGTATCACTGCTATTT
GTCAACCCTTAGAAATCATCTATGATGCTAACACGATCAACCATATCATT
AGTTTCTTCAAACCTCCTGAACATGTTATCTTGCAAGATTTACAAGACAA
AGCGTATTCTACTTTCGAAGATTTTAAAGTTTCAAGTACGGCTGGTCTTC
TACATGCTATGGAACAAAGAACGGTTATGGACATCGACATTGATGTTGGA
GCATCTCATTTGATCATCCCTGAAAAAGGTTCTTACAATGGTTGTACAGA
TATGCTGGTGATCGACTTTGGTAAAATCACGATGAGCAGCGATCCTAGTC
AAATCAGACACCTTGACCCTAAGGACATTGAGGATGTGAATGAAGTACAA
AGCAAAGCTTATGATCGATTCTTGTTGTCGCTTCAAGCTCTTCAAATATT
ACTCGTTAGAGAAGGTGAAGATTTAAAGAGTGCTAAAAGCAACGTCAGTA
AAGCTTCATCACACATTTTGCATCCCATCAATTTCGATGGCAAACTTGCC
AAAGCTATACTTCCACAAGATCCACGTTTAAAACAGATATGTGTCTCTGG
TGAATTATCTTCGCTGTTTGTTTCTGTATCGGATGATAAAGTCAGTCGTC
TCATCAAGCTAGCAGACTCGATACCACTCCCTCAATCACCTTCTCACGAT
AACATCGACGGAGAAGAAAAACCTGAAGGACTCTTCACCAAGGCGTTGTC
AATGATAAGCTTGACAGGTGACAATGACACAGGGGTGGACATCGGAGGAT
TTTCCATCCCTGTACCGACATCTCCAACATCAGTGACGTCAGATGAAGAT
GAATACGGGACACCACCTGATGGCTCCATATTACAGTTACAACAAGAAGC
TGGTCCGGACTTTTCATCAGGAGTGGCGAACCAAGTCAAAGTGGACTTGA
ACTTTAAAATCCATAAAGTGATGATCGCCATTGGTTTGACTGACAAAGCA
TTGAAACAGGAAAAAGAATGTCTGAAATTCATCGTGGACGACATCAATAC
AGAGgtGATACTACGAAGATGGGATTTGTTCGTCAATGCAGAAGTTGGTC
GTCTGGTGTTGAATGAAATGACATGGGGTGTTGATGGAGAACCTTTCGCC
ATCATGAGTACacccaaaaacaccaaaatgttGAAATTCAGCTATCGGAG
GTGTGAATTCAACGAAAGTTTGAATCTCGGTCCAAGTTACTTTTATTCCA
AAGAAGCGCAAGTCAGAGCTTTACATTTCAAAGATGAATTTGGCGCCACG
GATCAGATTTTAGATGTACAAGTGGCTACTTTATTTCTGATGCTTCATCA
AGAAGCACTTTTGAGCATCATGTCATTGATCTACCAAGTACTGGAACCAC
TCAACAAACATGATAAGGAAGCCACACAGAAGATCAAACGGAGTTTGAGT
ACGGCAGGTAGTCGTTTGAGTCTCTCCatcgaagaaaaagaaaaggagaG
ACAGATACAACGAAAATTAGCCAACCCTAAAGCACTGGAAGCTGCCAACG
AACTTAAGCAACAGGTTGGcttagaagaagaaaaaaagatgaGAGTGACC
GCCCACCTGGATGGTGTTGGTATCATGATTTGTTCAGCCAAAGTTGACCT
TGCACAAGCCTTCGTTAAAGGGTTATCTGCTAAAGTACTGATGAAAGATG
ACTTATTAGAAGTGAAAGCCAGCATGAAAGATATGCAAGTACAAGATAAT
GTTGGCGAAACAAAGTACAAAGACATCATTAGCATGCGATCTGATGAAGT
GTTCGATTTAGAGTTGGCTATTTACGAGAATGGATCTTCTGGTAGCAAGC
AATACGATATGTCGTGTGTCGACACCAGTGTCAAACTGAACTTCGGTCAA
ATGCGCGTTGTTTTCTTGTATAGATTCATACAAGACTTAATGTCATTCAC
CGAAAACTTCGAAGAAGCACAGAAAGCAGTTGTGGAAGCTGGTAAAGCTG
CCAAGGATAAAGCTCTGGAAACAGCGACCGATTTGAATAGACATTCTTCT
CGTGTCAAACTAAATGTGGTTCTGAAAGCACCGACTATTATCATTCCAGT
TGGATCAAACAATGAATTGGCTTTACTGGTGGATCTGGGTGAATTGCGTA
TTTACAACACATTCAAACTCCTCAACGATGATCAATACCATAAGAAATCT
ATCATCACTGATAACATGACCATTAAGTTATCCAATCTGAAATTGTTAAA
AGCACTTATTCAAGATGGTAAAGATTTCTTGCATCAACGAGCCATTATTG
AACCTATGATGCTACAAATAACTATTGTTCGTAATTTAACGAAAGGTAAC
CATTCCATACCGGATGTTTCAGTTCAAGCAAAGATGCCAGCTATTCTGTT
ATCAATCAGTGAAGAAGATGTGACCGTAGCTCTAAAGATTGTCCAAGGGA
ATCTCGCCGAAGGTGAGTCACATGCGCCGAAGAAGCAAGCCAAGCCTGCC
AAACAAACGTTAAACGTGCCACAAGATCGTTTAGCAGACATTTACGAGGA
GcctgaagatgaagatgagaaTCGACAAGGATATCTTCAAACCAAACTAT
CCTTCGATCTGGCTAAAATTGACATCAAGCTTTACTTGAAACCATCTGAT
ATGACATTTGAAGATGAATTTTTAGCGAGGACGGATGATTTGTTGTTAGC
TTTGTTCACTATTGGTAACCTGTGTGTTGATGGAGACATCATGTCCACGC
AAGCTATGAAGATGAGCGTTCGATTGGACACTTTGGTGTTGGATGATATG
AGACCTATCGAGGAGCATGAAGGTGTTAAACGTATGATCAACTACAGTCC
CGAGCCACTCCTTGAAGAAGTCAAAACCTCTTCTCATAAACGACCAATCG
ACAACTCACGAATGATCGAAATCCAAttcgatcaaacttcatcgcaagat
aaaaatatcgacATCAAACTTTGTAACATGCTTTGTATATTCAACGTTGA
GTTTATCATGGTCCTGTTGAAAACGTTGCAAGCTGCCATACCTAAAGATG
ATAGTCTGCAACATGGCCATTCAATGAGTAGTCTAGACTCGGCGGCAGGG
TCTGGCGGCAGCGATGACGAGGACTCTTTAGAAGCCAGCGAGATTGTCCT
CTGCACTGGTGATCAAGAAAGACCTGAGACTAAAGTCTCTATCTTCGTCC
ATAACCCGCAAATTGTTTTACTAGCAGATGCAAAGGATGTCAAAACAAAT
GCACTCTTTCTTACAACCGagatcaattttcaatatttcgaaTTGCGAGA
TACTCAAAAAATGATTGGCGCTGTTTCTAACACCGCTATTTTGTCAACTG
CTTTCAAGAATGACCATCGGAGTGATATATCAACAGTGTTGTCATTAGAT
TCCATCAATCTCCACTCGTCATCACCCATCAATGGTAAACCTCATATGAG
TGTCAGCACAACTTTGATCAAACTGAATATCTCACCCAAAACCATCCGAA
CTTTATCAGCGTGTGCTGGTTACATCTCCAATGATCCAACAGATGAAGAA
ATCAAAGAAGCTCGAAAAGCCATGCGTGATTTATGGCAAATTCAAACGTT
CACCAATAAGCGACCGTGGTATTTAAACCACCCACCACAACAAGTCTTAA
GTGCTGGCAGCTTCGTCCTTGCGCGAACGAGAACAGGAGAATATAAGCAT
GGTTTCTTAGCTAAAAAGGATGTCTCGTATCAAGTCTATTTTTCAGAGGA
GCGAGGAACAGCCAGTCACCGAGCCATGGATATCTCATCTGTTGTTTTGG
ATATCGTACCGCTGATCGGTGATCTATGTGTTGGATGTAATGTTTTAGCT
GTGGAATCGAAAGAACATGGATATCGTACTGGTCGAATTACTCAGGTTTG
GGATTCGAATGTGGATAAAGATTCTTCGGATGGCGCCAAACAATCTGTTT
CTGTCAAGACAACTGCTATTGCTCCAATCAAATACCTTGTCAATTTCTAT
GACAACCAAACGGAGAACTTCTTCCCGCCTGATGAACTTCGTATCATTGG
TAAACCCATCAAGGGGGTTGTCCCTGGACTAGGGGCGTGTGTTTACGCCC
GCTTTAATGATGGTTTTTACTATCGGGGCAAAGTTGATGACATCGAGGAT
TATCGAATCCGAGTGCAATTGGATGAGATCAGTGGAGAAATCGAACACGA
CATCGATGATCCGTCAGCCGTTATTTTGAACCTGACGCCTCAATACCGTC
AAGTCAAAAAGCATTTCAAAGTCATTGCATCCAAAGGAAGCACAACTAAA
GGATATCATCCGGGGAAAGTGACCGCCATCCAAGGTGAAGGAAATAACCG
ATTGTATTCGATACGCTTCGAAGACGGTACAATTAACCAAGTACCCATCa
cgaaattgattttgatgccAAAAGCACCTTTTGATGCTTTACCTGAAGTT
GGCACATACGTTTATTCCCGAGTGTCACGCGACGCTCCTTTATACGAGAA
GGGTATCGTAGCAGAGAAGAACACAATGATCTGCGTTAAACATTTAAATG
GACGGAAATTGGCTCACGAAATACAAAACATTCATTTTGTTGTCCGAAAT
ATCGTTCCTCTCGTGTCATCAttgaagGTTGGTTTGGACGTCATAGTGCA
ACCTGACAATGACGATCAGAAAATGTATTTGGCTGTCATTAGGGAAGTCA
CCAAAAAAGAAGGTGACAAAACGAACCGTTATCTAGTGGAGTTTACGGAT
GGATCCAAGAAGAGAGTGACGCCCAGCCGGATCCGTATACTTTCTCAATA
CGGAAGTGCAGAAACGAGTGAAGAAAATGCTGACATTATCACAACAAGAC
AGGAGGAACTAGTTCTCGATGTGCAAGGTATCTCATTACGTGTGGAAGGT
TACTTGGGAGGCGTGTTGACACCCATGCTCAAAATGGATTCCAAAATCAC
AGCTAACTTGAAGGATTGGTCAAGCCAAATGAATGCACACGCTACTGTAT
CATTAGAAGCCAGTTATTATAACGAAAACGTTGCCGAATGGGAGCCAGTT
ATTGAACCTTTGATGGAGAAACGGAGGGAAAGACCGTGGCAACTCTCTGT
CAATTACACGATGGAAGGTGACGACAATTCTGCTTCATCCACTTCCAACG
AACTCGTTTTACAAAAACCGGAATCCAACCTGAAAATCAAATCTCAAGAT
AATCTTGAATTGACAATTTCAAAATCATGTCTTGCTTTACTCGGTGAATT
GGGACAGGTGTTTGGAGATGCAGTAGAATCTGTGGACGTTTTACCACAAG
TCCTGGTCGAAAAAGAACCTTTCATGATCGAAAACTTGCTCTCCAAGAAG
GTGACAGTAACATTGAATGAACTTCTGCAGGGACCAAATGGAGATTCGAC
AATCGAGCTAGCATCTTCTTCGAATCCTGTTGGCATTACTTTTGCTCCCA
agaaatttgagaaacgaaAGACCAACGATCTATACACAATCAATTTAtcg
GTGGACGGTTTTCATGACATTAAAGACATTGTGGTTCAAAGAAAGCGAAG
CGTTATCTATGATCTTGTACCAATAAAACTATTATCAGCACAGTCTTCAT
ATTCGATAGTGGTACAAGTGAAGACAACAGACGGACAACGTATCATCGTA
CTCCGATCACCATTGCAGTTGAAAAATCACTTTCCAATGCCGTTGGATGT
CAGCTACATTTCCAAAGAAAACCAACCAGTTAAACTGACAACAGTGGGAT
CGGGAGATATCTATTCCTTCCCTTTGTTGTTAACCTACCACAGTGTTTTT
CATCTCAAACCTGCTGGTTTCGACTACGGTGATTGCACAGAAGCTCTCAA
TTGGAGTGATTTGAAGACGAGCAACGAAAAACAGTTCTCCTGCCCTTCAC
CTGACAAAAGTGCTGACCCTTTCTACATGCAGGTGGTGATGAAAGAGGAG
ACGTACTCTTCCGTACACGGCATGTTGGACTGTGTACCACGTTACACGTT
GGAGTGCTTTCCCGTCATCACGCTGCATAATTACCTACCTTGCACTATTA
ATTATAAGATCAAGGGTATGGCGAAATCGGAAAGTCTACCAGGCGGACAC
AATTGGCCTTTGTTTACCGTCAACTTCAGTGATAAACCTTCCATCTATAT
CGAGATTGAGTCGTATAACAACCAAAGATGGGAAGGAGGTTTGACATTAC
CAACAAAACCGGTAGATTCTTTGAACAAACCATCATTATCTTTCGTCATG
ATGTCTGGTGAACGCAAAATGGAATTGGGTGTTTATTACCAGTTAGACGG
TTCATTGAACATCACCTTATATTCGCCTTACTGGCTTCTCAATAAAACTG
GAAAACCACTTGTCTATCAGCCAGCGGGGAGCAGCATCCAGCAAGTTCAC
CAAGAGAACGATGTAAATGCTCTTATGATGCTCGTCAAAGGGAAACATAA
AAAGgcgaaagtgaaagtgaaaaataGCGAGTCATGGTCAAATGAATTTT
CATTGGATACTGTTGGCAGTGGTGGTTCCTTGAAATGCAATGGTCCAAGA
GATCGAGTTTATGAGATTGGTTTGAACATCAGTTTGTCATACTTTGGATT
GACGAAGATTGTGACGTTCACGCCACTCCGAATGTTATCTAACCACACCA
AGTACACCATCAGTATGGCAGAAAGTAATTCTAAATCGTCAGAATGGCAC
ACGGTAAACCCTGACGAGaacattccatTCTGGCCGACGAAACTTCCTTT
GGTCAACCTTTACATTAACATCAATGGGCAAGATTCAGTGAAATTCAACC
CTGAAGTTGGAAAAACTTTACTGTTGAAGTTCCAGAATGAGGTTGGAGGA
GTTTGCGTGGATTACCAAGAAAAGGACTCGTCCTCAGTCCTTTCGTTTAA
TCCGTACTTCGCAGGTGCAGCTCCTGTGCGGCttgaaaatctttgcaaaa
aGATCGGCATGATCGCTTATAAACAAGCAGGTTCGGTAATGGGTCACGTG
TTAACACATGACCAATCAGTGTTGTACACGTGGGATGATCCAACCATGGA
ACAAGAATTGATTTGTTCCATTGTCAATGATGAAGCCAGTGAAACAAGGA
TCAAACTCGATGCCAACGATTTCGGACGAATGAGAGTTGGAGATGGTGCA
ATTTATTGGGTTTCCTTTCTGGATGGTCTTCAACGTGTTCTATTGTTCAC
TGATAACTTCAAATCTGCTTACTGCGCATGTCAGgaGCAAAATTTACGCC
CAACCATGGAAGTTGACTTTGAGATTGAGAGTTTTGGTTTGTCTCTGGTC
AATGTTGATAAGAGAATGGAGATTGGCTACTTAGCTATCCGACAAAGCAA
GACTGTATGGGAGCAACGCAAGAAAAAGAACCGCTGGAAAGCTTTACCGC
TTGCCATGTGTGAAGCTCTCGAAGAAGGTTATCTCAATTATCAAAACAGA
AAAGGTGCAGTCAAAGAGAAAGTTCTGGATAAGGAGGTGGATTACGAGAA
GATGTTTATTACGAAACCTGAGAAGATTAAGATCAGAAGAACGTACCACA
GCGGTCTTGGTTTCAAATACACAATCTCACCCAATGAAATGCGTGTGCAT
GCTTCTATCAGCTCAATACAGTTGGATAGCCATGTTCCAGGTTCGACCTT
TCCAACAGTCTTGCATATGGTTGAACCACCAAAATCTGTTGCTTCAGAAA
ACGCTCCAAAGCCATTCTttgaattgagtttaatgaCAAGGATCGGTGAT
AAAAATGTGGTCAATGAAGTcagCTATTGTCACGTGTTGATTCAAGAGAT
GGATGTGAGGGTTGATATTGGATTTTTATTGGCTCTGATGGAACTCTTCA
GTCATGCAAGAGCTCGAACAACCGAGAAAGAACAATACGCGCTTGATATT
GGCCAAGCAGCAACAAAGTTTGAAGAAAGCGCTGAATTTCAGGCAGCCAA
ACAAGATCGATATTACGTTTTGAACGACTTTCATTTATCACCGCTAAAGA
TTCACGTCAGTTTCTCTTTGACGGGTGGTTCCAAAGATGAAAATGCTATT
GCTTCATTACATGGTAACGTGTTGAACTTGTTGTTACAAAGTGTCGGACT
GGCCTTCACTGAAATACAAGACGTACAATTCAAATTAGCATGTTACGAAG
TGCATAAGTCCATGCAGAGTAATTCGCAGCTCGGTGATGGAATAACTAAA
CATTATCAAACACAGGCTATCAAGCAACTTTATGTGTTGGTACTCGGGCT
AGACGTTCTTGGTAATCCGTATGGTTTGATATCTGGTGTTGGAACCGGAG
CAAAGAATTTCTTCTACGAACCTTACCAGGGATTAATTCAAGGACCAGAA
GAATTTGCGGAAGGATTGGCGTATGGGGTGAAGAGTCTTGTTGGTGGAAC
CGTGGGTGGAGTATCAGGAGCTGTGAGTAAGATTACCGGTACCTTCGGTA
AAGGTTTGGCTGCATTGACCTTGGATGAAGAATATCAACAAAAGAGACGT
GAAAACATGAGCCAACGCCCAACTAACCTCGGTGAAGGTCTCGCCAAAGG
TGGTAAAGGCCTTGTAAAGGGTATCGTGTCTGGTGTTACAGGGATCGTTA
CCAAACCCTATGAAGGTGCCAAGAATGATGGTGCAGGTGGCTTTTTTAAG
GGCGTTGGAAAAGGCCTGATTGGCGTGGTTGCACGCCCTGTTGGTGGAGT
GGTAGATATGGCCAGTAACACGTTTGATGGTTTGAAAAGCACGACATCTG
GCGTGAAAGCGATCGAGTTGAGCCGTGTTACTCGCGTCTTCCACGCAGAT
AAGGTTTTACGACCTTTCAATCTGTACGAAGCAGATGGAAACAAAATTCT
TATGCAATGTAACAAAGGAGAATACGCCAAGAAGAATTTTTATATCACTC
ATGTAGTGGACAAGAAGAACTATCTCATCCTCACTCAATCaaacATTTTG
TATGTTGGAAAGAACGAGTTGAAAATGGGTGAATGGGAATCggtttgggt
tatcgagttcaATGAGCTAAAACGTGAACCAGAAGTGAAAGAGACAAAGA
TTATTTTCCATATCCATAATACGGACACGCGACGTTCAATTTTCAAGAAA
TCGACGAACACACGTGAAGTGATATTGGAGTCTAGTGCTGTTGCAGACTG
GTTTATCTTAAAGCTTAGAGATGCTAAAATGTTATAGatggtatttgaaT
CTTTGGTTGCTGACCTCTTGAACAAGTATCTGGGTCAATATGTGAAAAAT
CTTGATGCTTCTCAATTGAAGATTGGCATTTGGGGAGGAAATGTTGTCCT
GACAGAACTTGAACTGAAAGATACAGCTCTGGATGATCTTGACTTACCCA
TAAAAGTTGTTCGTGGATATTTGGgtAAATTGGTCTTGTCCATCCCATGG
AAAAATCTTTACACTGAATCAACTGTTGTCGATATTCAAGATCTCCACCT
TGTCGCTAAGCCTAATTTTGACATCAAATACAATGAAGAACgcgaagaaa
aatcaaaacatgacAAGAAACAACAACAGATTCACAATATCGAAGAAGCG
AGGCAAAGAGAAGAAGACAAAAAGAAAGGCGCCAAGAAAGAAGAGAGTGA
CGGTTTTGCTGAGAAACTTGCAACAAACGTCATAAAAAATCTACAGGTTA
CGATCAAGAACATACATGTTCGATATGAAGACTCAATCAGTGATGTGAAT
GGACCCTTTTCAGTCGGTCTTACAATGGAAAGTTTAACAGCACAAACCAC
AGATGAAGATTTTGTTCCAAAGATTATCAAAGAATCTGTCTCATTAATTC
ATAAGatggTGAAATTAGACAATTTGGCTTTATATTGGAATCCAGGAGAC
GAACTGATTGATCCTTCACTTGATACCAAGCAATGGTTGgaagtTTCAAC
GAAGCAAATTTCAACACACCAATCGAAGCCAGAGAAAACGAAATATATTT
TGAGTCCCATGGTTGCAACGAAGAAATTGAAGCTGAACACCAAACCAGGT
TCCAACCTTGACATCCCGAAGatgttTTTGAACTTGGTTTTGGAAGAACT
TGGTATCATCGTGGCAAGAAGTCAATATCATGGCGTGGTGCAACTGATTG
AATCATTTGAACGAATGAATAGGAACCAACCTTTTCGTAAATACAGACCA
CATACCTCCGTTCTTGGGAACGAAAGTATTTGGTGGAAGTACTGCATGTC
CAGCATACTGGAGGTGGATGTCAAAAGACGATCTCAAATGTGGAGCTGGA
AGCATATTCAAAAACATCGAGTTCTTTGCAAAGCTTACAAAGTGAAGTAc
aaggaaaaattgaaacagaaaaATCCATCCAAACAAATTCTCACTGAACT
AGAGaGCATGGAGGATGAGTTGAATATTGCAAGCATCACCATTTTTCGAC
AGCTTGCAGCTACAGAGGTTTTAACGGAACAAAAGAAGAAAGGCACTAAA
GGAAGTTTCTTCAGTTTCTTCTCCAGATCAAAAGAACCAGAAAAGTCTGC
TGCTAATAAAATTGGAGATTTAATGGGTGATGACCAGGAGAAGGAAATGC
AGAAATTGTATGACGCAATCGGTTATACTGAAAATGAAGTCATCACTCCC
TTTCCTAAAGAGTACGTGGCGATGTCAGTGGAATCGATTCTCCAGAAATT
ATTCATCAGCCTCATCGATGACACAGATAAGGCGAAAGAATTCAAAGTGT
TGGATTTTTCACTCAACAACATCATTGTAGAAGTTTTCCAAAGACCTTCT
GCTCAAGCTCTCAAATTATGTGCAAAGATAGGAGAGATGAAGTTATTTGG
TACAGCTTCTGCTCAATGTACACCTCtcatcatcaaaaacatgttaCAAG
GTCGAGGTATGGAATTTCTGCCGTTGGTGGACTTCATCTTTGAGACGAAT
CCTTTGAAGAAACCGGACATTGACCAATGTATCACTGCTATTTGTCAACC
CTTAGAAATCATCTATGATGCTAACACGATCAACCATATCATTAGTTTCT
TCAAACCTCCTGAACATGTTATCTTGCAAGATTTACAAGACAAAGCGTAT
TCTACTTTCGAAGATTTTAAAGTTTCAAGTACGGCTGGTCTTCTACATGC
TATGGAACAAAGAACGGTTATGGACATCGACATTGATGTTGGAGCATCTC
ATTTGATCATCCCTGAAAAAGGTTCTTACAATGGTTGTACAGATATGCTG
GTGATCGACTTTGGTAAAATCACGATGAGCAGCGATCCTAGTCAAATCAG
ACACCTTGACCCTAAGGACATTGAGGATGTGAATGAAGTACAAAGCAAAG
CTTATGATCGATTCTTGTTGTCGCTTCAAGCTCTTCAAATATTACTCGTT
AGAGAAGGTGAAGATTTAAAGAGTGCTAAAAGCAACGTCAGTAAAGCTTC
ATCACACATTTTGCATCCCATCAATTTCGATGGCAAACTTGCCAAAGCTA
TACTTCCACAAGATCCACGTTTAAAACAGATATGTGTCTCTGGTGAATTA
TCTTCGCTGTTTGTTTCTGTATCGGATGATAAAGTCAGTCGTCTCATCAA
GCTAGCAGACTCGATACCACTCCCTCAATCACCTTCTCACGATAACATCG
ACGGAGAAGAAAAACCTGAAGGACTCTTCACCAAGGCGTTGTCAATGATA
AGCTTGACAGGTGACAATGACACAGGGGTGGACATCGGAGGATTTTCCAT
CCCTGTACCGACATCTCCAACATCAGTGACGTCAGATGAAGATGAATACG
GGACACCACCTGATGGCTCCATATTACAGTTACAACAAGAAGCTGGTCCG
GACTTTTCATCAGGAGTGGCGAACCAAGTCAAAGTGGACTTGAACTTTAA
AATCCATAAAGTGATGATCGCCATTGGTTTGACTGACAAAGCATTGAAAC
AGGAAAAAGAATGTCTGAAATTCATCGTGGACGACATCAATACAGAGgtG
ATACTACGAAGATGGGATTTGTTCGTCAATGCAGAAGTTGGTCGTCTGGT
GTTGAATGAAATGACATGGGGTGTTGATGGAGAACCTTTCGCCATCATGA
GTACacccaaaaacaccaaaatgttGAAATTCAGCTATCGGAGGTGTGAA
TTCAACGAAAGTTTGAATCTCGGTCCAAGTTACTTTTATTCCAAAGAAGC
GCAAGTCAGAGCTTTACATTTCAAAGATGAATTTGGCGCCACGGATCAGA
TTTTAGATGTACAAGTGGCTACTTTATTTCTGATGCTTCATCAAGAAGCA
CTTTTGAGCATCATGTCATTGATCTACCAAGTACTGGAACCACTCAACAA
ACATGATAAGGAAGCCACACAGAAGATCAAACGGAGTTTGAGTACGGCAG
GTAGTCGTTTGAGTCTCTCCatcgaagaaaaagaaaaggagaGACAGATA
CAACGAAAATTAGCCAACCCTAAAGCACTGGAAGCTGCCAACGAACTTAA
GCAACAGGTTGGcttagaagaagaaaaaaagatgaGAGTGACCGCCCACC
TGGATGGTGTTGGTATCATGATTTGTTCAGCCAAAGTTGACCTTGCACAA
GCCTTCGTTAAAGGGTTATCTGCTAAAGTACTGATGAAAGATGACTTATT
AGAAGTGAAAGCCAGCATGAAAGATATGCAAGTACAAGATAATGTTGGCG
AAACAAAGTACAAAGACATCATTAGCATGCGATCTGATGAAGTGTTCGAT
TTAGAGTTGGCTATTTACGAGAATGGATCTTCTGGTAGCAAGCAATACGA
TATGTCGTGTGTCGACACCAGTGTCAAACTGAACTTCGGTCAAATGCGCG
TTGTTTTCTTGTATAGATTCATACAAGACTTAATGTCATTCACCGAAAAC
TTCGAAGAAGCACAGAAAGCAGTTGTGGAAGCTGGTAAAGCTGCCAAGGA
TAAAGCTCTGGAAACAGCGACCGATTTGAATAGACATTCTTCTCGTGTCA
AACTAAATGTGGTTCTGAAAGCACCGACTATTATCATTCCAGTTGGATCA
AACAATGAATTGGCTTTACTGGTGGATCTGGGTGAATTGCGTATTTACAA
CACATTCAAACTCCTCAACGATGATCAATACCATAAGAAATCTATCATCA
CTGATAACATGACCATTAAGTTATCCAATCTGAAATTGTTAAAAGCACTT
ATTCAAGATGGTAAAGATTTCTTGCATCAACGAGCCATTATTGAACCTAT
GATGCTACAAATAACTATTGTTCGTAATTTAACGAAAGGTAACCATTCCA
TACCGGATGTTTCAGTTCAAGCAAAGATGCCAGCTATTCTGTTATCAATC
AGTGAAGAAGATGTGACCGTAGCTCTAAAGATTGTCCAAGGGAATCTCGC
CGAAGGTGAGTCACATGCGCCGAAGAAGCAAGCCAAGCCTGCCAAACAAA
CGTTAAACGTGCCACAAGATCGTTTAGCAGACATTTACGAGGAGcctgaa
gatgaagatgagaaTCGACAAGGATATCTTCAAACCAAACTATCCTTCGA
TCTGGCTAAAATTGACATCAAGCTTTACTTGAAACCATCTGATATGACAT
TTGAAGATGAATTTTTAGCGAGGACGGATGATTTGTTGTTAGCTTTGTTC
ACTATTGGTAACCTGTGTGTTGATGGAGACATCATGTCCACGCAAGCTAT
GAAGATGAGCGTTCGATTGGACACTTTGGTGTTGGATGATATGAGACCTA
TCGAGGAGCATGAAGGTGTTAAACGTATGATCAACTACAGTCCCGAGCCA
CTCCTTGAAGAAGTCAAAACCTCTTCTCATAAACGACCAATCGACAACTC
ACGAATGATCGAAATCCAAttcgatcaaacttcatcgcaagataaaaata
tcgacATCAAACTTTGTAACATGCTTTGTATATTCAACGTTGAGTTTATC
ATGGTCCTGTTGAAAACGTTGCAAGCTGCCATACCTAAAGATGATAGTCT
GCAACATGGCCATTCAATGAGTAGTCTAGACTCGGCGGCAGGGTCTGGCG
GCAGCGATGACGAGGACTCTTTAGAAGCCAGCGAGATTGTCCTCTGCACT
GGTGATCAAGAAAGACCTGAGACTAAAGTCTCTATCTTCGTCCATAACCC
GCAAATTGTTTTACTAGCAGATGCAAAGGATGTCAAAACAAATGCACTCT
TTCTTACAACCGagatcaattttcaatatttcgaaTTGCGAGATACTCAA
AAAATGATTGGCGCTGTTTCTAACACCGCTATTTTGTCAACTGCTTTCAA
GAATGACCATCGGAGTGATATATCAACAGTGTTGTCATTAGATTCCATCA
ATCTCCACTCGTCATCACCCATCAATGGTAAACCTCATATGAGTGTCAGC
ACAACTTTGATCAAACTGAATATCTCACCCAAAACCATCCGAACTTTATC
AGCGTGTGCTGGTTACATCTCCAATGATCCAACAGATGAAGAAATCAAAG
AAGCTCGAAAAGCCATGCGTGATTTATGGCAAATTCAAACGTTCACCAAT
AAGCGACCGTGGTATTTAAACCACCCACCACAACAAGTCTTAAGTGCTGG
CAGCTTCGTCCTTGCGCGAACGAGAACAGGAGAATATAAGCATGGTTTCT
TAGCTAAAAAGGATGTCTCGTATCAAGTCTATTTTTCAGAGGAGCGAGGA
ACAGCCAGTCACCGAGCCATGGATATCTCATCTGTTGTTTTGGATATCGT
ACCGCTGATCGGTGATCTATGTGTTGGATGTAATGTTTTAGCTGTGGAAT
CGAAAGAACATGGATATCGTACTGGTCGAATTACTCAGGTTTGGGATTCG
AATGTGGATAAAGATTCTTCGGATGGCGCCAAACAATCTGTTTCTGTCAA
GACAACTGCTATTGCTCCAATCAAATACCTTGTCAATTTCTATGACAACC
AAACGGAGAACTTCTTCCCGCCTGATGAACTTCGTATCATTGGTAAACCC
ATCAAGGGGGTTGTCCCTGGACTAGGGGCGTGTGTTTACGCCCGCTTTAA
TGATGGTTTTTACTATCGGGGCAAAGTTGATGACATCGAGGATTATCGAA
TCCGAGTGCAATTGGATGAGATCAGTGGAGAAATCGAACACGACATCGAT
GATCCGTCAGCCGTTATTTTGAACCTGACGCCTCAATACCGTCAAGTCAA
AAAGCATTTCAAAGTCATTGCATCCAAAGGAAGCACAACTAAAGGATATC
ATCCGGGGAAAGTGACCGCCATCCAAGGTGAAGGAAATAACCGATTGTAT
TCGATACGCTTCGAAGACGGTACAATTAACCAAGTACCCATCacgaaatt
gattttgatgccAAAAGCACCTTTTGATGCTTTACCTGAAGTTGGCACAT
ACGTTTATTCCCGAGTGTCACGCGACGCTCCTTTATACGAGAAGGGTATC
GTAGCAGAGAAGAACACAATGATCTGCGTTAAACATTTAAATGGACGGAA
ATTGGCTCACGAAATACAAAACATTCATTTTGTTGTCCGAAATATCGTTC
CTCTCGTGTCATCAttgaagGTTGGTTTGGACGTCATAGTGCAACCTGAC
AATGACGATCAGAAAATGTATTTGGCTGTCATTAGGGAAGTCACCAAAAA
AGAAGGTGACAAAACGAACCGTTATCTAGTGGAGTTTACGGATGGATCCA
AGAAGAGAGTGACGCCCAGCCGGATCCGTATACTTTCTCAATACGGAAGT
GCAGAAACGAGTGAAGAAAATGCTGACATTATCACAACAAGACAGGAGGA
ACTAGTTCTCGATGTGCAAGGTATCTCATTACGTGTGGAAGGTTACTTGG
GAGGCGTGTTGACACCCATGCTCAAAATGGATTCCAAAATCACAGCTAAC
TTGAAGGATTGGTCAAGCCAAATGAATGCACACGCTACTGTATCATTAGA
AGCCAGTTATTATAACGAAAACGTTGCCGAATGGGAGCCAGTTATTGAAC
CTTTGATGGAGAAACGGAGGGAAAGACCGTGGCAACTCTCTGTCAATTAC
ACGATGGAAGGTGACGACAATTCTGCTTCATCCACTTCCAACGAACTCGT
TTTACAAAAACCGGAATCCAACCTGAAAATCAAATCTCAAGATAATCTTG
AATTGACAATTTCAAAATCATGTCTTGCTTTACTCGGTGAATTGGGACAG
GTGTTTGGAGATGCAGTAGAATCTGTGGACGTTTTACCACAAGTCCTGGT
CGAAAAAGAACCTTTCATGATCGAAAACTTGCTCTCCAAGAAGGTGACAG
TAACATTGAATGAACTTCTGCAGGGACCAAATGGAGATTCGACAATCGAG
CTAGCATCTTCTTCGAATCCTGTTGGCATTACTTTTGCTCCCAagaaatt
tgagaaacgaaAGACCAACGATCTATACACAATCAATTTAtcgGTGGACG
GTTTTCATGACATTAAAGACATTGTGGTTCAAAGAAAGCGAAGCGTTATC
TATGATCTTGTACCAATAAAACTATTATCAGCACAGTCTTCATATTCGAT
AGTGGTACAAGTGAAGACAACAGACGGACAACGTATCATCGTACTCCGAT
CACCATTGCAGTTGAAAAATCACTTTCCAATGCCGTTGGATGTCAGCTAC
ATTTCCAAAGAAAACCAACCAGTTAAACTGACAACAGTGGGATCGGGAGA
TATCTATTCCTTCCCTTTGTTGTTAACCTACCACAGTGTTTTTCATCTCA
AACCTGCTGGTTTCGACTACGGTGATTGCACAGAAGCTCTCAATTGGAGT
GATTTGAAGACGAGCAACGAAAAACAGTTCTCCTGCCCTTCACCTGACAA
AAGTGCTGACCCTTTCTACATGCAGGTGGTGATGAAAGAGGAGACGTACT
CTTCCGTACACGGCATGTTGGACTGTGTACCACGTTACACGTTGGAGTGC
TTTCCCGTCATCACGCTGCATAATTACCTACCTTGCACTATTAATTATAA
GATCAAGGGTATGGCGAAATCGGAAAGTCTACCAGGCGGACACAATTGGC
CTTTGTTTACCGTCAACTTCAGTGATAAACCTTCCATCTATATCGAGATT
GAGTCGTATAACAACCAAAGATGGGAAGGAGGTTTGACATTACCAACAAA
ACCGGTAGATTCTTTGAACAAACCATCATTATCTTTCGTCATGATGTCTG
GTGAACGCAAAATGGAATTGGGTGTTTATTACCAGTTAGACGGTTCATTG
AACATCACCTTATATTCGCCTTACTGGCTTCTCAATAAAACTGGAAAACC
ACTTGTCTATCAGCCAGCGGGGAGCAGCATCCAGCAAGTTCACCAAGAGA
ACGATGTAAATGCTCTTATGATGCTCGTCAAAGGGAAACATAAAAAGgcg
aaagtgaaagtgaaaaataGCGAGTCATGGTCAAATGAATTTTCATTGGA
TACTGTTGGCAGTGGTGGTTCCTTGAAATGCAATGGTCCAAGAGATCGAG
TTTATGAGATTGGTTTGAACATCAGTTTGTCATACTTTGGATTGACGAAG
ATTGTGACGTTCACGCCACTCCGAATGTTATCTAACCACACCAAGTACAC
CATCAGTATGGCAGAAAGTAATTCTAAATCGTCAGAATGGCACACGGTAA
ACCCTGACGAGaacattccatTCTGGCCGACGAAACTTCCTTTGGTCAAC
CTTTACATTAACATCAATGGGCAAGATTCAGTGAAATTCAACCCTGAAGT
TGGAAAAACTTTACTGTTGAAGTTCCAGAATGAGGTTGGAGGAGTTTGCG
TGGATTACCAAGAAAAGGACTCGTCCTCAGTCCTTTCGTTTAATCCGTAC
TTCGCAGGTGCAGCTCCTGTGCGGCttgaaaatctttgcaaaaaGATCGG
CATGATCGCTTATAAACAAGCAGGTTCGGTAATGGGTCACGTGTTAACAC
ATGACCAATCAGTGTTGTACACGTGGGATGATCCAACCATGGAACAAGAA
TTGATTTGTTCCATTGTCAATGATGAAGCCAGTGAAACAAGGATCAAACT
CGATGCCAACGATTTCGGACGAATGAGAGTTGGAGATGGTGCAATTTATT
GGGTTTCCTTTCTGGATGGTCTTCAACGTGTTCTATTGTTCACTGATAAC
TTCAAATCTGCTTACTGCGCATGTCAGgaGCAAAATTTACGCCCAACCAT
GGAAGTTGACTTTGAGATTGAGAGTTTTGGTTTGTCTCTGGTCAATGTTG
ATAAGAGAATGGAGATTGGCTACTTAGCTATCCGACAAAGCAAGACTGTA
TGGGAGCAACGCAAGAAAAAGAACCGCTGGAAAGCTTTACCGCTTGCCAT
GTGTGAAGCTCTCGAAGAAGGTTATCTCAATTATCAAAACAGAAAAGGTG
CAGTCAAAGAGAAAGTTCTGGATAAGGAGGTGGATTACGAGAAGATGTTT
ATTACGAAACCTGAGAAGATTAAGATCAGAAGAACGTACCACAGCGGTCT
TGGTTTCAAATACACAATCTCACCCAATGAAATGCGTGTGCATGCTTCTA
TCAGCTCAATACAGTTGGATAGCCATGTTCCAGGTTCGACCTTTCCAACA
GTCTTGCATATGGTTGAACCACCAAAATCTGTTGCTTCAGAAAACGCTCC
AAAGCCATTCTttgaattgagtttaatgaCAAGGATCGGTGATAAAAATG
TGGTCAATGAAGTcagCTATTGTCACGTGTTGATTCAAGAGATGGATGTG
AGGGTTGATATTGGATTTTTATTGGCTCTGATGGAACTCTTCAGTCATGC
AAGAGCTCGAACAACCGAGAAAGAACAATACGCGCTTGATATTGGCCAAG
CAGCAACAAAGTTTGAAGAAAGCGCTGAATTTCAGGCAGCCAAACAAGAT
CGATATTACGTTTTGAACGACTTTCATTTATCACCGCTAAAGATTCACGT
CAGTTTCTCTTTGACGGGTGGTTCCAAAGATGAAAATGCTATTGCTTCAT
TACATGGTAACGTGTTGAACTTGTTGTTACAAAGTGTCGGACTGGCCTTC
ACTGAAATACAAGACGTACAATTCAAATTAGCATGTTACGAAGTGCATAA
GTCCATGCAGAGTAATTCGCAGCTCGGTGATGGAATAACTAAACATTATC
AAACACAGGCTATCAAGCAACTTTATGTGTTGGTACTCGGGCTAGACGTT
CTTGGTAATCCGTATGGTTTGATATCTGGTGTTGGAACCGGAGCAAAGAA
TTTCTTCTACGAACCTTACCAGGGATTAATTCAAGGACCAGAAGAATTTG
CGGAAGGATTGGCGTATGGGGTGAAGAGTCTTGTTGGTGGAACCGTGGGT
GGAGTATCAGGAGCTGTGAGTAAGATTACCGGTACCTTCGGTAAAGGTTT
GGCTGCATTGACCTTGGATGAAGAATATCAACAAAAGAGACGTGAAAACA
TGAGCCAACGCCCAACTAACCTCGGTGAAGGTCTCGCCAAAGGTGGTAAA
GGCCTTGTAAAGGGTATCGTGTCTGGTGTTACAGGGATCGTTACCAAACC
CTATGAAGGTGCCAAGAATGATGGTGCAGGTGGCTTTTTTAAGGGCGTTG
GAAAAGGCCTGATTGGCGTGGTTGCACGCCCTGTTGGTGGAGTGGTAGAT
ATGGCCAGTAACACGTTTGATGGTTTGAAAAGCACGACATCTGGCGTGAA
AGCGATCGAGTTGAGCCGTGTTACTCGCGTCTTCCACGCAGATAAGGTTT
TACGACCTTTCAATCTGTACGAAGCAGATGGAAACAAAATTCTTATGCAA
TGTAACAAAGGAGAATACGCCAAGAAGAATTTTTATATCACTCATGTAGT
GGACAAGAAGAACTATCTCATCCTCACTCAATCaaacATTTTGTATGTTG
GAAAGAACGAGTTGAAAATGGGTGAATGGGAATCggtttgggttatcgag
ttcaATGAGCTAAAACGTGAACCAGAAGTGAAAGAGACAAAGATTATTTT
CCATATCCATAATACGGACACGCGACGTTCAATTTTCAAGAAATCGACGA
ACACACGTGAAGTGATATTGGAGTCTAGTGCTGTTGCAGACTGGTTTATC
TTAAAGCTTAGAGATGCTAAAATGTTATAGatggtatttgaaTCTTTGGT
TGCTGACCTCTTGAACAAGTATCTGGGTCAATATGTGAAAAATCTTGATG
CTTCTCAATTGAAGATTGGCATTTGGGGAGGAAATGTTGTCCTGACAGAA
CTTGAACTGAAAGATACAGCTCTGGATGATCTTGACTTACCCATAAAAGT
TGTTCGTGGATATTTGGgtAAATTGGTCTTGTCCATCCCATGGAAAAATC
TTTACACTGAATCAACTGTTGTCGATATTCAAGATCTCCACCTTGTCGCT
AAGCCTAATTTTGACATCAAATACAATGAAGAACgcgaagaaaaatcaaa
acatgacAAGAAACAACAACAGATTCACAATATCGAAGAAGCGAGGCAAA
GAGAAGAAGACAAAAAGAAAGGCGCCAAGAAAGAAGAGAGTGACGGTTTT
GCTGAGAAACTTGCAACAAACGTCATAAAAAATCTACAGGTTACGATCAA
GAACATACATGTTCGATATGAAGACTCAATCAGTGATGTGAATGGACCCT
TTTCAGTCGGTCTTACAATGGAAAGTTTAACAGCACAAACCACAGATGAA
GATTTTGTTCCAAAGATTATCAAAGAATCTGTCTCATTAATTCATAAGat
ggTGAAATTAGACAATTTGGCTTTATATTGGAATCCAGGAGACGAACTGA
TTGATCCTTCACTTGATACCAAGCAATGGTTGgaagtTTCAACGAAGCAA
ATTTCAACACACCAATCGAAGCCAGAGAAAACGAAATATATTTTGAGTCC
CATGGTTGCAACGAAGAAATTGAAGCTGAACACCAAACCAGGTTCCAACC
TTGACATCCCGAAGatgttTTTGAACTTGGTTTTGGAAGAACTTGGTATC
ATCGTGGCAAGAAGTCAATATCATGGCGTGGTGCAACTGATTGAATCATT
TGAACGAATGAATAGGAACCAACCTTTTCGTAAATACAGACCACATACCT
CCGTTCTTGGGAACGAAAGTATTTGGTGGAAGTACTGCATGTCCAGCATA
CTGGAGGTGGATGTCAAAAGACGATCTCAAATGTGGAGCTGGAAGCATAT
TCAAAAACATCGAGTTCTTTGCAAAGCTTACAAAGTGAAGTAcaaggaaa
aattgaaacagaaaaATCCATCCAAACAAATTCTCACTGAACTAGAGaGC
ATGGAGGATGAGTTGAATATTGCAAGCATCACCATTTTTCGACAGCTTGC
AGCTACAGAGGTTTTAACGGAACAAAAGAAGAAAGGCACTAAAGGAAGTT
TCTTCAGTTTCTTCTCCAGATCAAAAGAACCAGAAAAGTCTGCTGCTAAT
AAAATTGGAGATTTAATGGGTGATGACCAGGAGAAGGAAATGCAGAAATT
GTATGACGCAATCGGTTATACTGAAAATGAAGTCATCACTCCCTTTCCTA
AAGAGTACGTGGCGATGTCAGTGGAATCGATTCTCCAGAAATTATTCATC
AGCCTCATCGATGACACAGATAAGGCGAAAGAATTCAAAGTGTTGGATTT
TTCACTCAACAACATCATTGTAGAAGTTTTCCAAAGACCTTCTGCTCAAG
CTCTCAAATTATGTGCAAAGATAGGAGAGATGAAGTTATTTGGTACAGCT
TCTGCTCAATGTACACCTCtcatcatcaaaaacatgttaCAAGGTCGAGG
TATGGAATTTCTGCCGTTGGTGGACTTCATCTTTGAGACGAATCCTTTGA
AGAAACCGGACATTGACCAATGTATCACTGCTATTTGTCAACCCTTAGAA
ATCATCTATGATGCTAACACGATCAACCATATCATTAGTTTCTTCAAACC
TCCTGAACATGTTATCTTGCAAGATTTACAAGACAAAGCGTATTCTACTT
TCGAAGATTTTAAAGTTTCAAGTACGGCTGGTCTTCTACATGCTATGGAA
CAAAGAACGGTTATGGACATCGACATTGATGTTGGAGCATCTCATTTGAT
CATCCCTGAAAAAGGTTCTTACAATGGTTGTACAGATATGCTGGTGATCG
ACTTTGGTAAAATCACGATGAGCAGCGATCCTAGTCAAATCAGACACCTT
GACCCTAAGGACATTGAGGATGTGAATGAAGTACAAAGCAAAGCTTATGA
TCGATTCTTGTTGTCGCTTCAAGCTCTTCAAATATTACTCGTTAGAGAAG
GTGAAGATTTAAAGAGTGCTAAAAGCAACGTCAGTAAAGCTTCATCACAC
ATTTTGCATCCCATCAATTTCGATGGCAAACTTGCCAAAGCTATACTTCC
ACAAGATCCACGTTTAAAACAGATATGTGTCTCTGGTGAATTATCTTCGC
TGTTTGTTTCTGTATCGGATGATAAAGTCAGTCGTCTCATCAAGCTAGCA
GACTCGATACCACTCCCTCAATCACCTTCTCACGATAACATCGACGGAGA
AGAAAAACCTGAAGGACTCTTCACCAAGGCGTTGTCAATGATAAGCTTGA
CAGGTGACAATGACACAGGGGTGGACATCGGAGGATTTTCCATCCCTGTA
CCGACATCTCCAACATCAGTGACGTCAGATGAAGATGAATACGGGACACC
ACCTGATGGCTCCATATTACAGTTACAACAAGAAGCTGGTCCGGACTTTT
CATCAGGAGTGGCGAACCAAGTCAAAGTGGACTTGAACTTTAAAATCCAT
AAAGTGATGATCGCCATTGGTTTGACTGACAAAGCATTGAAACAGGAAAA
AGAATGTCTGAAATTCATCGTGGACGACATCAATACAGAGgtGATACTAC
GAAGATGGGATTTGTTCGTCAATGCAGAAGTTGGTCGTCTGGTGTTGAAT
GAAATGACATGGGGTGTTGATGGAGAACCTTTCGCCATCATGAGTACacc
caaaaacaccaaaatgttGAAATTCAGCTATCGGAGGTGTGAATTCAACG
AAAGTTTGAATCTCGGTCCAAGTTACTTTTATTCCAAAGAAGCGCAAGTC
AGAGCTTTACATTTCAAAGATGAATTTGGCGCCACGGATCAGATTTTAGA
TGTACAAGTGGCTACTTTATTTCTGATGCTTCATCAAGAAGCACTTTTGA
GCATCATGTCATTGATCTACCAAGTACTGGAACCACTCAACAAACATGAT
AAGGAAGCCACACAGAAGATCAAACGGAGTTTGAGTACGGCAGGTAGTCG
TTTGAGTCTCTCCatcgaagaaaaagaaaaggagaGACAGATACAACGAA
AATTAGCCAACCCTAAAGCACTGGAAGCTGCCAACGAACTTAAGCAACAG
GTTGGcttagaagaagaaaaaaagatgaGAGTGACCGCCCACCTGGATGG
TGTTGGTATCATGATTTGTTCAGCCAAAGTTGACCTTGCACAAGCCTTCG
TTAAAGGGTTATCTGCTAAAGTACTGATGAAAGATGACTTATTAGAAGTG
AAAGCCAGCATGAAAGATATGCAAGTACAAGATAATGTTGGCGAAACAAA
GTACAAAGACATCATTAGCATGCGATCTGATGAAGTGTTCGATTTAGAGT
TGGCTATTTACGAGAATGGATCTTCTGGTAGCAAGCAATACGATATGTCG
TGTGTCGACACCAGTGTCAAACTGAACTTCGGTCAAATGCGCGTTGTTTT
CTTGTATAGATTCATACAAGACTTAATGTCATTCACCGAAAACTTCGAAG
AAGCACAGAAAGCAGTTGTGGAAGCTGGTAAAGCTGCCAAGGATAAAGCT
CTGGAAACAGCGACCGATTTGAATAGACATTCTTCTCGTGTCAAACTAAA
TGTGGTTCTGAAAGCACCGACTATTATCATTCCAGTTGGATCAAACAATG
AATTGGCTTTACTGGTGGATCTGGGTGAATTGCGTATTTACAACACATTC
AAACTCCTCAACGATGATCAATACCATAAGAAATCTATCATCACTGATAA
CATGACCATTAAGTTATCCAATCTGAAATTGTTAAAAGCACTTATTCAAG
ATGGTAAAGATTTCTTGCATCAACGAGCCATTATTGAACCTATGATGCTA
CAAATAACTATTGTTCGTAATTTAACGAAAGGTAACCATTCCATACCGGA
TGTTTCAGTTCAAGCAAAGATGCCAGCTATTCTGTTATCAATCAGTGAAG
AAGATGTGACCGTAGCTCTAAAGATTGTCCAAGGGAATCTCGCCGAAGGT
GAGTCACATGCGCCGAAGAAGCAAGCCAAGCCTGCCAAACAAACGTTAAA
CGTGCCACAAGATCGTTTAGCAGACATTTACGAGGAGcctgaagatgaag
atgagaaTCGACAAGGATATCTTCAAACCAAACTATCCTTCGATCTGGCT
AAAATTGACATCAAGCTTTACTTGAAACCATCTGATATGACATTTGAAGA
TGAATTTTTAGCGAGGACGGATGATTTGTTGTTAGCTTTGTTCACTATTG
GTAACCTGTGTGTTGATGGAGACATCATGTCCACGCAAGCTATGAAGATG
AGCGTTCGATTGGACACTTTGGTGTTGGATGATATGAGACCTATCGAGGA
GCATGAAGGTGTTAAACGTATGATCAACTACAGTCCCGAGCCACTCCTTG
AAGAAGTCAAAACCTCTTCTCATAAACGACCAATCGACAACTCACGAATG
ATCGAAATCCAAttcgatcaaacttcatcgcaagataaaaatatcgacAT
CAAACTTTGTAACATGCTTTGTATATTCAACGTTGAGTTTATCATGGTCC
TGTTGAAAACGTTGCAAGCTGCCATACCTAAAGATGATAGTCTGCAACAT
GGCCATTCAATGAGTAGTCTAGACTCGGCGGCAGGGTCTGGCGGCAGCGA
TGACGAGGACTCTTTAGAAGCCAGCGAGATTGTCCTCTGCACTGGTGATC
AAGAAAGACCTGAGACTAAAGTCTCTATCTTCGTCCATAACCCGCAAATT
GTTTTACTAGCAGATGCAAAGGATGTCAAAACAAATGCACTCTTTCTTAC
AACCGagatcaattttcaatatttcgaaTTGCGAGATACTCAAAAAATGA
TTGGCGCTGTTTCTAACACCGCTATTTTGTCAACTGCTTTCAAGAATGAC
CATCGGAGTGATATATCAACAGTGTTGTCATTAGATTCCATCAATCTCCA
CTCGTCATCACCCATCAATGGTAAACCTCATATGAGTGTCAGCACAACTT
TGATCAAACTGAATATCTCACCCAAAACCATCCGAACTTTATCAGCGTGT
GCTGGTTACATCTCCAATGATCCAACAGATGAAGAAATCAAAGAAGCTCG
AAAAGCCATGCGTGATTTATGGCAAATTCAAACGTTCACCAATAAGCGAC
CGTGGTATTTAAACCACCCACCACAACAAGTCTTAAGTGCTGGCAGCTTC
GTCCTTGCGCGAACGAGAACAGGAGAATATAAGCATGGTTTCTTAGCTAA
AAAGGATGTCTCGTATCAAGTCTATTTTTCAGAGGAGCGAGGAACAGCCA
GTCACCGAGCCATGGATATCTCATCTGTTGTTTTGGATATCGTACCGCTG
ATCGGTGATCTATGTGTTGGATGTAATGTTTTAGCTGTGGAATCGAAAGA
ACATGGATATCGTACTGGTCGAATTACTCAGGTTTGGGATTCGAATGTGG
ATAAAGATTCTTCGGATGGCGCCAAACAATCTGTTTCTGTCAAGACAACT
GCTATTGCTCCAATCAAATACCTTGTCAATTTCTATGACAACCAAACGGA
GAACTTCTTCCCGCCTGATGAACTTCGTATCATTGGTAAACCCATCAAGG
GGGTTGTCCCTGGACTAGGGGCGTGTGTTTACGCCCGCTTTAATGATGGT
TTTTACTATCGGGGCAAAGTTGATGACATCGAGGATTATCGAATCCGAGT
GCAATTGGATGAGATCAGTGGAGAAATCGAACACGACATCGATGATCCGT
CAGCCGTTATTTTGAACCTGACGCCTCAATACCGTCAAGTCAAAAAGCAT
TTCAAAGTCATTGCATCCAAAGGAAGCACAACTAAAGGATATCATCCGGG
GAAAGTGACCGCCATCCAAGGTGAAGGAAATAACCGATTGTATTCGATAC
GCTTCGAAGACGGTACAATTAACCAAGTACCCATCacgaaattgattttg
atgccAAAAGCACCTTTTGATGCTTTACCTGAAGTTGGCACATACGTTTA
TTCCCGAGTGTCACGCGACGCTCCTTTATACGAGAAGGGTATCGTAGCAG
AGAAGAACACAATGATCTGCGTTAAACATTTAAATGGACGGAAATTGGCT
CACGAAATACAAAACATTCATTTTGTTGTCCGAAATATCGTTCCTCTCGT
GTCATCAttgaagGTTGGTTTGGACGTCATAGTGCAACCTGACAATGACG
ATCAGAAAATGTATTTGGCTGTCATTAGGGAAGTCACCAAAAAAGAAGGT
GACAAAACGAACCGTTATCTAGTGGAGTTTACGGATGGATCCAAGAAGAG
AGTGACGCCCAGCCGGATCCGTATACTTTCTCAATACGGAAGTGCAGAAA
CGAGTGAAGAAAATGCTGACATTATCACAACAAGACAGGAGGAACTAGTT
CTCGATGTGCAAGGTATCTCATTACGTGTGGAAGGTTACTTGGGAGGCGT
GTTGACACCCATGCTCAAAATGGATTCCAAAATCACAGCTAACTTGAAGG
ATTGGTCAAGCCAAATGAATGCACACGCTACTGTATCATTAGAAGCCAGT
TATTATAACGAAAACGTTGCCGAATGGGAGCCAGTTATTGAACCTTTGAT
GGAGAAACGGAGGGAAAGACCGTGGCAACTCTCTGTCAATTACACGATGG
AAGGTGACGACAATTCTGCTTCATCCACTTCCAACGAACTCGTTTTACAA
AAACCGGAATCCAACCTGAAAATCAAATCTCAAGATAATCTTGAATTGAC
AATTTCAAAATCATGTCTTGCTTTACTCGGTGAATTGGGACAGGTGTTTG
GAGATGCAGTAGAATCTGTGGACGTTTTACCACAAGTCCTGGTCGAAAAA
GAACCTTTCATGATCGAAAACTTGCTCTCCAAGAAGGTGACAGTAACATT
GAATGAACTTCTGCAGGGACCAAATGGAGATTCGACAATCGAGCTAGCAT
CTTCTTCGAATCCTGTTGGCATTACTTTTGCTCCCAagaaatttgagaaa
cgaaAGACCAACGATCTATACACAATCAATTTAtcgGTGGACGGTTTTCA
TGACATTAAAGACATTGTGGTTCAAAGAAAGCGAAGCGTTATCTATGATC
TTGTACCAATAAAACTATTATCAGCACAGTCTTCATATTCGATAGTGGTA
CAAGTGAAGACAACAGACGGACAACGTATCATCGTACTCCGATCACCATT
GCAGTTGAAAAATCACTTTCCAATGCCGTTGGATGTCAGCTACATTTCCA
AAGAAAACCAACCAGTTAAACTGACAACAGTGGGATCGGGAGATATCTAT
TCCTTCCCTTTGTTGTTAACCTACCACAGTGTTTTTCATCTCAAACCTGC
TGGTTTCGACTACGGTGATTGCACAGAAGCTCTCAATTGGAGTGATTTGA
AGACGAGCAACGAAAAACAGTTCTCCTGCCCTTCACCTGACAAAAGTGCT
GACCCTTTCTACATGCAGGTGGTGATGAAAGAGGAGACGTACTCTTCCGT
ACACGGCATGTTGGACTGTGTACCACGTTACACGTTGGAGTGCTTTCCCG
TCATCACGCTGCATAATTACCTACCTTGCACTATTAATTATAAGATCAAG
GGTATGGCGAAATCGGAAAGTCTACCAGGCGGACACAATTGGCCTTTGTT
TACCGTCAACTTCAGTGATAAACCTTCCATCTATATCGAGATTGAGTCGT
ATAACAACCAAAGATGGGAAGGAGGTTTGACATTACCAACAAAACCGGTA
GATTCTTTGAACAAACCATCATTATCTTTCGTCATGATGTCTGGTGAACG
CAAAATGGAATTGGGTGTTTATTACCAGTTAGACGGTTCATTGAACATCA
CCTTATATTCGCCTTACTGGCTTCTCAATAAAACTGGAAAACCACTTGTC
TATCAGCCAGCGGGGAGCAGCATCCAGCAAGTTCACCAAGAGAACGATGT
AAATGCTCTTATGATGCTCGTCAAAGGGAAACATAAAAAGgcgaaagtga
aagtgaaaaataGCGAGTCATGGTCAAATGAATTTTCATTGGATACTGTT
GGCAGTGGTGGTTCCTTGAAATGCAATGGTCCAAGAGATCGAGTTTATGA
GATTGGTTTGAACATCAGTTTGTCATACTTTGGATTGACGAAGATTGTGA
CGTTCACGCCACTCCGAATGTTATCTAACCACACCAAGTACACCATCAGT
ATGGCAGAAAGTAATTCTAAATCGTCAGAATGGCACACGGTAAACCCTGA
CGAGaacattccatTCTGGCCGACGAAACTTCCTTTGGTCAACCTTTACA
TTAACATCAATGGGCAAGATTCAGTGAAATTCAACCCTGAAGTTGGAAAA
ACTTTACTGTTGAAGTTCCAGAATGAGGTTGGAGGAGTTTGCGTGGATTA
CCAAGAAAAGGACTCGTCCTCAGTCCTTTCGTTTAATCCGTACTTCGCAG
GTGCAGCTCCTGTGCGGCttgaaaatctttgcaaaaaGATCGGCATGATC
GCTTATAAACAAGCAGGTTCGGTAATGGGTCACGTGTTAACACATGACCA
ATCAGTGTTGTACACGTGGGATGATCCAACCATGGAACAAGAATTGATTT
GTTCCATTGTCAATGATGAAGCCAGTGAAACAAGGATCAAACTCGATGCC
AACGATTTCGGACGAATGAGAGTTGGAGATGGTGCAATTTATTGGGTTTC
CTTTCTGGATGGTCTTCAACGTGTTCTATTGTTCACTGATAACTTCAAAT
CTGCTTACTGCGCATGTCAGgaGCAAAATTTACGCCCAACCATGGAAGTT
GACTTTGAGATTGAGAGTTTTGGTTTGTCTCTGGTCAATGTTGATAAGAG
AATGGAGATTGGCTACTTAGCTATCCGACAAAGCAAGACTGTATGGGAGC
AACGCAAGAAAAAGAACCGCTGGAAAGCTTTACCGCTTGCCATGTGTGAA
GCTCTCGAAGAAGGTTATCTCAATTATCAAAACAGAAAAGGTGCAGTCAA
AGAGAAAGTTCTGGATAAGGAGGTGGATTACGAGAAGATGTTTATTACGA
AACCTGAGAAGATTAAGATCAGAAGAACGTACCACAGCGGTCTTGGTTTC
AAATACACAATCTCACCCAATGAAATGCGTGTGCATGCTTCTATCAGCTC
AATACAGTTGGATAGCCATGTTCCAGGTTCGACCTTTCCAACAGTCTTGC
ATATGGTTGAACCACCAAAATCTGTTGCTTCAGAAAACGCTCCAAAGCCA
TTCTttgaattgagtttaatgaCAAGGATCGGTGATAAAAATGTGGTCAA
TGAAGTcagCTATTGTCACGTGTTGATTCAAGAGATGGATGTGAGGGTTG
ATATTGGATTTTTATTGGCTCTGATGGAACTCTTCAGTCATGCAAGAGCT
CGAACAACCGAGAAAGAACAATACGCGCTTGATATTGGCCAAGCAGCAAC
AAAGTTTGAAGAAAGCGCTGAATTTCAGGCAGCCAAACAAGATCGATATT
ACGTTTTGAACGACTTTCATTTATCACCGCTAAAGATTCACGTCAGTTTC
TCTTTGACGGGTGGTTCCAAAGATGAAAATGCTATTGCTTCATTACATGG
TAACGTGTTGAACTTGTTGTTACAAAGTGTCGGACTGGCCTTCACTGAAA
TACAAGACGTACAATTCAAATTAGCATGTTACGAAGTGCATAAGTCCATG
CAGAGTAATTCGCAGCTCGGTGATGGAATAACTAAACATTATCAAACACA
GGCTATCAAGCAACTTTATGTGTTGGTACTCGGGCTAGACGTTCTTGGTA
ATCCGTATGGTTTGATATCTGGTGTTGGAACCGGAGCAAAGAATTTCTTC
TACGAACCTTACCAGGGATTAATTCAAGGACCAGAAGAATTTGCGGAAGG
ATTGGCGTATGGGGTGAAGAGTCTTGTTGGTGGAACCGTGGGTGGAGTAT
CAGGAGCTGTGAGTAAGATTACCGGTACCTTCGGTAAAGGTTTGGCTGCA
TTGACCTTGGATGAAGAATATCAACAAAAGAGACGTGAAAACATGAGCCA
ACGCCCAACTAACCTCGGTGAAGGTCTCGCCAAAGGTGGTAAAGGCCTTG
TAAAGGGTATCGTGTCTGGTGTTACAGGGATCGTTACCAAACCCTATGAA
GGTGCCAAGAATGATGGTGCAGGTGGCTTTTTTAAGGGCGTTGGAAAAGG
CCTGATTGGCGTGGTTGCACGCCCTGTTGGTGGAGTGGTAGATATGGCCA
GTAACACGTTTGATGGTTTGAAAAGCACGACATCTGGCGTGAAAGCGATC
GAGTTGAGCCGTGTTACTCGCGTCTTCCACGCAGATAAGGTTTTACGACC
TTTCAATCTGTACGAAGCAGATGGAAACAAAATTCTTATGCAATGTAACA
AAGGAGAATACGCCAAGAAGAATTTTTATATCACTCATGTAGTGGACAAG
AAGAACTATCTCATCCTCACTCAATCaaacATTTTGTATGTTGGAAAGAA
CGAGTTGAAAATGGGTGAATGGGAATCggtttgggttatcgagttcaATG
AGCTAAAACGTGAACCAGAAGTGAAAGAGACAAAGATTATTTTCCATATC
CATAATACGGACACGCGACGTTCAATTTTCAAGAAATCGACGAACACACG
TGAAGTGATATTGGAGTCTAGTGCTGTTGCAGACTGGTTTATCTTAAAGC
TTAGAGATGCTAAAATGTTATAGatggtatttgaaTCTTTGGTTGCTGAC
CTCTTGAACAAGTATCTGGGTCAATATGTGAAAAATCTTGATGCTTCTCA
ATTGAAGATTGGCATTTGGGGAGGAAATGTTGTCCTGACAGAACTTGAAC
TGAAAGATACAGCTCTGGATGATCTTGACTTACCCATAAAAGTTGTTCGT
GGATATTTGGgtAAATTGGTCTTGTCCATCCCATGGAAAAATCTTTACAC
TGAATCAACTGTTGTCGATATTCAAGATCTCCACCTTGTCGCTAAGCCTA
ATTTTGACATCAAATACAATGAAGAACgcgaagaaaaatcaaaacatgac
AAGAAACAACAACAGATTCACAATATCGAAGAAGCGAGGCAAAGAGAAGA
AGACAAAAAGAAAGGCGCCAAGAAAGAAGAGAGTGACGGTTTTGCTGAGA
AACTTGCAACAAACGTCATAAAAAATCTACAGGTTACGATCAAGAACATA
CATGTTCGATATGAAGACTCAATCAGTGATGTGAATGGACCCTTTTCAGT
CGGTCTTACAATGGAAAGTTTAACAGCACAAACCACAGATGAAGATTTTG
TTCCAAAGATTATCAAAGAATCTGTCTCATTAATTCATAAGatggTGAAA
TTAGACAATTTGGCTTTATATTGGAATCCAGGAGACGAACTGATTGATCC
TTCACTTGATACCAAGCAATGGTTGgaagtTTCAACGAAGCAAATTTCAA
CACACCAATCGAAGCCAGAGAAAACGAAATATATTTTGAGTCCCATGGTT
GCAACGAAGAAATTGAAGCTGAACACCAAACCAGGTTCCAACCTTGACAT
CCCGAAGatgttTTTGAACTTGGTTTTGGAAGAACTTGGTATCATCGTGG
CAAGAAGTCAATATCATGGCGTGGTGCAACTGATTGAATCATTTGAACGA
ATGAATAGGAACCAACCTTTTCGTAAATACAGACCACATACCTCCGTTCT
TGGGAACGAAAGTATTTGGTGGAAGTACTGCATGTCCAGCATACTGGAGG
TGGATGTCAAAAGACGATCTCAAATGTGGAGCTGGAAGCATATTCAAAAA
CATCGAGTTCTTTGCAAAGCTTACAAAGTGAAGTAcaaggaaaaattgaa
acagaaaaATCCATCCAAACAAATTCTCACTGAACTAGAGaGCATGGAGG
ATGAGTTGAATATTGCAAGCATCACCATTTTTCGACAGCTTGCAGCTACA
GAGGTTTTAACGGAACAAAAGAAGAAAGGCACTAAAGGAAGTTTCTTCAG
TTTCTTCTCCAGATCAAAAGAACCAGAAAAGTCTGCTGCTAATAAAATTG
GAGATTTAATGGGTGATGACCAGGAGAAGGAAATGCAGAAATTGTATGAC
GCAATCGGTTATACTGAAAATGAAGTCATCACTCCCTTTCCTAAAGAGTA
CGTGGCGATGTCAGTGGAATCGATTCTCCAGAAATTATTCATCAGCCTCA
TCGATGACACAGATAAGGCGAAAGAATTCAAAGTGTTGGATTTTTCACTC
AACAACATCATTGTAGAAGTTTTCCAAAGACCTTCTGCTCAAGCTCTCAA
ATTATGTGCAAAGATAGGAGAGATGAAGTTATTTGGTACAGCTTCTGCTC
AATGTACACCTCtcatcatcaaaaacatgttaCAAGGTCGAGGTATGGAA
TTTCTGCCGTTGGTGGACTTCATCTTTGAGACGAATCCTTTGAAGAAACC
GGACATTGACCAATGTATCACTGCTATTTGTCAACCCTTAGAAATCATCT
ATGATGCTAACACGATCAACCATATCATTAGTTTCTTCAAACCTCCTGAA
CATGTTATCTTGCAAGATTTACAAGACAAAGCGTATTCTACTTTCGAAGA
TTTTAAAGTTTCAAGTACGGCTGGTCTTCTACATGCTATGGAACAAAGAA
CGGTTATGGACATCGACATTGATGTTGGAGCATCTCATTTGATCATCCCT
GAAAAAGGTTCTTACAATGGTTGTACAGATATGCTGGTGATCGACTTTGG
TAAAATCACGATGAGCAGCGATCCTAGTCAAATCAGACACCTTGACCCTA
AGGACATTGAGGATGTGAATGAAGTACAAAGCAAAGCTTATGATCGATTC
TTGTTGTCGCTTCAAGCTCTTCAAATATTACTCGTTAGAGAAGGTGAAGA
TTTAAAGAGTGCTAAAAGCAACGTCAGTAAAGCTTCATCACACATTTTGC
ATCCCATCAATTTCGATGGCAAACTTGCCAAAGCTATACTTCCACAAGAT
CCACGTTTAAAACAGATATGTGTCTCTGGTGAATTATCTTCGCTGTTTGT
TTCTGTATCGGATGATAAAGTCAGTCGTCTCATCAAGCTAGCAGACTCGA
TACCACTCCCTCAATCACCTTCTCACGATAACATCGACGGAGAAGAAAAA
CCTGAAGGACTCTTCACCAAGGCGTTGTCAATGATAAGCTTGACAGGTGA
CAATGACACAGGGGTGGACATCGGAGGATTTTCCATCCCTGTACCGACAT
CTCCAACATCAGTGACGTCAGATGAAGATGAATACGGGACACCACCTGAT
GGCTCCATATTACAGTTACAACAAGAAGCTGGTCCGGACTTTTCATCAGG
AGTGGCGAACCAAGTCAAAGTGGACTTGAACTTTAAAATCCATAAAGTGA
TGATCGCCATTGGTTTGACTGACAAAGCATTGAAACAGGAAAAAGAATGT
CTGAAATTCATCGTGGACGACATCAATACAGAGgtGATACTACGAAGATG
GGATTTGTTCGTCAATGCAGAAGTTGGTCGTCTGGTGTTGAATGAAATGA
CATGGGGTGTTGATGGAGAACCTTTCGCCATCATGAGTACacccaaaaac
accaaaatgttGAAATTCAGCTATCGGAGGTGTGAATTCAACGAAAGTTT
GAATCTCGGTCCAAGTTACTTTTATTCCAAAGAAGCGCAAGTCAGAGCTT
TACATTTCAAAGATGAATTTGGCGCCACGGATCAGATTTTAGATGTACAA
GTGGCTACTTTATTTCTGATGCTTCATCAAGAAGCACTTTTGAGCATCAT
GTCATTGATCTACCAAGTACTGGAACCACTCAACAAACATGATAAGGAAG
CCACACAGAAGATCAAACGGAGTTTGAGTACGGCAGGTAGTCGTTTGAGT
CTCTCCatcgaagaaaaagaaaaggagaGACAGATACAACGAAAATTAGC
CAACCCTAAAGCACTGGAAGCTGCCAACGAACTTAAGCAACAGGTTGGct
tagaagaagaaaaaaagatgaGAGTGACCGCCCACCTGGATGGTGTTGGT
ATCATGATTTGTTCAGCCAAAGTTGACCTTGCACAAGCCTTCGTTAAAGG
GTTATCTGCTAAAGTACTGATGAAAGATGACTTATTAGAAGTGAAAGCCA
GCATGAAAGATATGCAAGTACAAGATAATGTTGGCGAAACAAAGTACAAA
GACATCATTAGCATGCGATCTGATGAAGTGTTCGATTTAGAGTTGGCTAT
TTACGAGAATGGATCTTCTGGTAGCAAGCAATACGATATGTCGTGTGTCG
ACACCAGTGTCAAACTGAACTTCGGTCAAATGCGCGTTGTTTTCTTGTAT
AGATTCATACAAGACTTAATGTCATTCACCGAAAACTTCGAAGAAGCACA
GAAAGCAGTTGTGGAAGCTGGTAAAGCTGCCAAGGATAAAGCTCTGGAAA
CAGCGACCGATTTGAATAGACATTCTTCTCGTGTCAAACTAAATGTGGTT
CTGAAAGCACCGACTATTATCATTCCAGTTGGATCAAACAATGAATTGGC
TTTACTGGTGGATCTGGGTGAATTGCGTATTTACAACACATTCAAACTCC
TCAACGATGATCAATACCATAAGAAATCTATCATCACTGATAACATGACC
ATTAAGTTATCCAATCTGAAATTGTTAAAAGCACTTATTCAAGATGGTAA
AGATTTCTTGCATCAACGAGCCATTATTGAACCTATGATGCTACAAATAA
CTATTGTTCGTAATTTAACGAAAGGTAACCATTCCATACCGGATGTTTCA
GTTCAAGCAAAGATGCCAGCTATTCTGTTATCAATCAGTGAAGAAGATGT
GACCGTAGCTCTAAAGATTGTCCAAGGGAATCTCGCCGAAGGTGAGTCAC
ATGCGCCGAAGAAGCAAGCCAAGCCTGCCAAACAAACGTTAAACGTGCCA
CAAGATCGTTTAGCAGACATTTACGAGGAGcctgaagatgaagatgagaa
TCGACAAGGATATCTTCAAACCAAACTATCCTTCGATCTGGCTAAAATTG
ACATCAAGCTTTACTTGAAACCATCTGATATGACATTTGAAGATGAATTT
TTAGCGAGGACGGATGATTTGTTGTTAGCTTTGTTCACTATTGGTAACCT
GTGTGTTGATGGAGACATCATGTCCACGCAAGCTATGAAGATGAGCGTTC
GATTGGACACTTTGGTGTTGGATGATATGAGACCTATCGAGGAGCATGAA
GGTGTTAAACGTATGATCAACTACAGTCCCGAGCCACTCCTTGAAGAAGT
CAAAACCTCTTCTCATAAACGACCAATCGACAACTCACGAATGATCGAAA
TCCAAttcgatcaaacttcatcgcaagataaaaatatcgacATCAAACTT
TGTAACATGCTTTGTATATTCAACGTTGAGTTTATCATGGTCCTGTTGAA
AACGTTGCAAGCTGCCATACCTAAAGATGATAGTCTGCAACATGGCCATT
CAATGAGTAGTCTAGACTCGGCGGCAGGGTCTGGCGGCAGCGATGACGAG
GACTCTTTAGAAGCCAGCGAGATTGTCCTCTGCACTGGTGATCAAGAAAG
ACCTGAGACTAAAGTCTCTATCTTCGTCCATAACCCGCAAATTGTTTTAC
TAGCAGATGCAAAGGATGTCAAAACAAATGCACTCTTTCTTACAACCGag
atcaattttcaatatttcgaaTTGCGAGATACTCAAAAAATGATTGGCGC
TGTTTCTAACACCGCTATTTTGTCAACTGCTTTCAAGAATGACCATCGGA
GTGATATATCAACAGTGTTGTCATTAGATTCCATCAATCTCCACTCGTCA
TCACCCATCAATGGTAAACCTCATATGAGTGTCAGCACAACTTTGATCAA
ACTGAATATCTCACCCAAAACCATCCGAACTTTATCAGCGTGTGCTGGTT
ACATCTCCAATGATCCAACAGATGAAGAAATCAAAGAAGCTCGAAAAGCC
ATGCGTGATTTATGGCAAATTCAAACGTTCACCAATAAGCGACCGTGGTA
TTTAAACCACCCACCACAACAAGTCTTAAGTGCTGGCAGCTTCGTCCTTG
CGCGAACGAGAACAGGAGAATATAAGCATGGTTTCTTAGCTAAAAAGGAT
GTCTCGTATCAAGTCTATTTTTCAGAGGAGCGAGGAACAGCCAGTCACCG
AGCCATGGATATCTCATCTGTTGTTTTGGATATCGTACCGCTGATCGGTG
ATCTATGTGTTGGATGTAATGTTTTAGCTGTGGAATCGAAAGAACATGGA
TATCGTACTGGTCGAATTACTCAGGTTTGGGATTCGAATGTGGATAAAGA
TTCTTCGGATGGCGCCAAACAATCTGTTTCTGTCAAGACAACTGCTATTG
CTCCAATCAAATACCTTGTCAATTTCTATGACAACCAAACGGAGAACTTC
TTCCCGCCTGATGAACTTCGTATCATTGGTAAACCCATCAAGGGGGTTGT
CCCTGGACTAGGGGCGTGTGTTTACGCCCGCTTTAATGATGGTTTTTACT
ATCGGGGCAAAGTTGATGACATCGAGGATTATCGAATCCGAGTGCAATTG
GATGAGATCAGTGGAGAAATCGAACACGACATCGATGATCCGTCAGCCGT
TATTTTGAACCTGACGCCTCAATACCGTCAAGTCAAAAAGCATTTCAAAG
TCATTGCATCCAAAGGAAGCACAACTAAAGGATATCATCCGGGGAAAGTG
ACCGCCATCCAAGGTGAAGGAAATAACCGATTGTATTCGATACGCTTCGA
AGACGGTACAATTAACCAAGTACCCATCacgaaattgattttgatgccAA
AAGCACCTTTTGATGCTTTACCTGAAGTTGGCACATACGTTTATTCCCGA
GTGTCACGCGACGCTCCTTTATACGAGAAGGGTATCGTAGCAGAGAAGAA
CACAATGATCTGCGTTAAACATTTAAATGGACGGAAATTGGCTCACGAAA
TACAAAACATTCATTTTGTTGTCCGAAATATCGTTCCTCTCGTGTCATCA
ttgaagGTTGGTTTGGACGTCATAGTGCAACCTGACAATGACGATCAGAA
AATGTATTTGGCTGTCATTAGGGAAGTCACCAAAAAAGAAGGTGACAAAA
CGAACCGTTATCTAGTGGAGTTTACGGATGGATCCAAGAAGAGAGTGACG
CCCAGCCGGATCCGTATACTTTCTCAATACGGAAGTGCAGAAACGAGTGA
AGAAAATGCTGACATTATCACAACAAGACAGGAGGAACTAGTTCTCGATG
TGCAAGGTATCTCATTACGTGTGGAAGGTTACTTGGGAGGCGTGTTGACA
CCCATGCTCAAAATGGATTCCAAAATCACAGCTAACTTGAAGGATTGGTC
AAGCCAAATGAATGCACACGCTACTGTATCATTAGAAGCCAGTTATTATA
ACGAAAACGTTGCCGAATGGGAGCCAGTTATTGAACCTTTGATGGAGAAA
CGGAGGGAAAGACCGTGGCAACTCTCTGTCAATTACACGATGGAAGGTGA
CGACAATTCTGCTTCATCCACTTCCAACGAACTCGTTTTACAAAAACCGG
AATCCAACCTGAAAATCAAATCTCAAGATAATCTTGAATTGACAATTTCA
AAATCATGTCTTGCTTTACTCGGTGAATTGGGACAGGTGTTTGGAGATGC
AGTAGAATCTGTGGACGTTTTACCACAAGTCCTGGTCGAAAAAGAACCTT
TCATGATCGAAAACTTGCTCTCCAAGAAGGTGACAGTAACATTGAATGAA
CTTCTGCAGGGACCAAATGGAGATTCGACAATCGAGCTAGCATCTTCTTC
GAATCCTGTTGGCATTACTTTTGCTCCCAagaaatttgagaaacgaaAGA
CCAACGATCTATACACAATCAATTTAtcgGTGGACGGTTTTCATGACATT
AAAGACATTGTGGTTCAAAGAAAGCGAAGCGTTATCTATGATCTTGTACC
AATAAAACTATTATCAGCACAGTCTTCATATTCGATAGTGGTACAAGTGA
AGACAACAGACGGACAACGTATCATCGTACTCCGATCACCATTGCAGTTG
AAAAATCACTTTCCAATGCCGTTGGATGTCAGCTACATTTCCAAAGAAAA
CCAACCAGTTAAACTGACAACAGTGGGATCGGGAGATATCTATTCCTTCC
CTTTGTTGTTAACCTACCACAGTGTTTTTCATCTCAAACCTGCTGGTTTC
GACTACGGTGATTGCACAGAAGCTCTCAATTGGAGTGATTTGAAGACGAG
CAACGAAAAACAGTTCTCCTGCCCTTCACCTGACAAAAGTGCTGACCCTT
TCTACATGCAGGTGGTGATGAAAGAGGAGACGTACTCTTCCGTACACGGC
ATGTTGGACTGTGTACCACGTTACACGTTGGAGTGCTTTCCCGTCATCAC
GCTGCATAATTACCTACCTTGCACTATTAATTATAAGATCAAGGGTATGG
CGAAATCGGAAAGTCTACCAGGCGGACACAATTGGCCTTTGTTTACCGTC
AACTTCAGTGATAAACCTTCCATCTATATCGAGATTGAGTCGTATAACAA
CCAAAGATGGGAAGGAGGTTTGACATTACCAACAAAACCGGTAGATTCTT
TGAACAAACCATCATTATCTTTCGTCATGATGTCTGGTGAACGCAAAATG
GAATTGGGTGTTTATTACCAGTTAGACGGTTCATTGAACATCACCTTATA
TTCGCCTTACTGGCTTCTCAATAAAACTGGAAAACCACTTGTCTATCAGC
CAGCGGGGAGCAGCATCCAGCAAGTTCACCAAGAGAACGATGTAAATGCT
CTTATGATGCTCGTCAAAGGGAAACATAAAAAGgcgaaagtgaaagtgaa
aaataGCGAGTCATGGTCAAATGAATTTTCATTGGATACTGTTGGCAGTG
GTGGTTCCTTGAAATGCAATGGTCCAAGAGATCGAGTTTATGAGATTGGT
TTGAACATCAGTTTGTCATACTTTGGATTGACGAAGATTGTGACGTTCAC
GCCACTCCGAATGTTATCTAACCACACCAAGTACACCATCAGTATGGCAG
AAAGTAATTCTAAATCGTCAGAATGGCACACGGTAAACCCTGACGAGaac
attccatTCTGGCCGACGAAACTTCCTTTGGTCAACCTTTACATTAACAT
CAATGGGCAAGATTCAGTGAAATTCAACCCTGAAGTTGGAAAAACTTTAC
TGTTGAAGTTCCAGAATGAGGTTGGAGGAGTTTGCGTGGATTACCAAGAA
AAGGACTCGTCCTCAGTCCTTTCGTTTAATCCGTACTTCGCAGGTGCAGC
TCCTGTGCGGCttgaaaatctttgcaaaaaGATCGGCATGATCGCTTATA
AACAAGCAGGTTCGGTAATGGGTCACGTGTTAACACATGACCAATCAGTG
TTGTACACGTGGGATGATCCAACCATGGAACAAGAATTGATTTGTTCCAT
TGTCAATGATGAAGCCAGTGAAACAAGGATCAAACTCGATGCCAACGATT
TCGGACGAATGAGAGTTGGAGATGGTGCAATTTATTGGGTTTCCTTTCTG
GATGGTCTTCAACGTGTTCTATTGTTCACTGATAACTTCAAATCTGCTTA
CTGCGCATGTCAGgaGCAAAATTTACGCCCAACCATGGAAGTTGACTTTG
AGATTGAGAGTTTTGGTTTGTCTCTGGTCAATGTTGATAAGAGAATGGAG
ATTGGCTACTTAGCTATCCGACAAAGCAAGACTGTATGGGAGCAACGCAA
GAAAAAGAACCGCTGGAAAGCTTTACCGCTTGCCATGTGTGAAGCTCTCG
AAGAAGGTTATCTCAATTATCAAAACAGAAAAGGTGCAGTCAAAGAGAAA
GTTCTGGATAAGGAGGTGGATTACGAGAAGATGTTTATTACGAAACCTGA
GAAGATTAAGATCAGAAGAACGTACCACAGCGGTCTTGGTTTCAAATACA
CAATCTCACCCAATGAAATGCGTGTGCATGCTTCTATCAGCTCAATACAG
TTGGATAGCCATGTTCCAGGTTCGACCTTTCCAACAGTCTTGCATATGGT
TGAACCACCAAAATCTGTTGCTTCAGAAAACGCTCCAAAGCCATTCTttg
aattgagtttaatgaCAAGGATCGGTGATAAAAATGTGGTCAATGAAGTc
agCTATTGTCACGTGTTGATTCAAGAGATGGATGTGAGGGTTGATATTGG
ATTTTTATTGGCTCTGATGGAACTCTTCAGTCATGCAAGAGCTCGAACAA
CCGAGAAAGAACAATACGCGCTTGATATTGGCCAAGCAGCAACAAAGTTT
GAAGAAAGCGCTGAATTTCAGGCAGCCAAACAAGATCGATATTACGTTTT
GAACGACTTTCATTTATCACCGCTAAAGATTCACGTCAGTTTCTCTTTGA
CGGGTGGTTCCAAAGATGAAAATGCTATTGCTTCATTACATGGTAACGTG
TTGAACTTGTTGTTACAAAGTGTCGGACTGGCCTTCACTGAAATACAAGA
CGTACAATTCAAATTAGCATGTTACGAAGTGCATAAGTCCATGCAGAGTA
ATTCGCAGCTCGGTGATGGAATAACTAAACATTATCAAACACAGGCTATC
AAGCAACTTTATGTGTTGGTACTCGGGCTAGACGTTCTTGGTAATCCGTA
TGGTTTGATATCTGGTGTTGGAACCGGAGCAAAGAATTTCTTCTACGAAC
CTTACCAGGGATTAATTCAAGGACCAGAAGAATTTGCGGAAGGATTGGCG
TATGGGGTGAAGAGTCTTGTTGGTGGAACCGTGGGTGGAGTATCAGGAGC
TGTGAGTAAGATTACCGGTACCTTCGGTAAAGGTTTGGCTGCATTGACCT
TGGATGAAGAATATCAACAAAAGAGACGTGAAAACATGAGCCAACGCCCA
ACTAACCTCGGTGAAGGTCTCGCCAAAGGTGGTAAAGGCCTTGTAAAGGG
TATCGTGTCTGGTGTTACAGGGATCGTTACCAAACCCTATGAAGGTGCCA
AGAATGATGGTGCAGGTGGCTTTTTTAAGGGCGTTGGAAAAGGCCTGATT
GGCGTGGTTGCACGCCCTGTTGGTGGAGTGGTAGATATGGCCAGTAACAC
GTTTGATGGTTTGAAAAGCACGACATCTGGCGTGAAAGCGATCGAGTTGA
GCCGTGTTACTCGCGTCTTCCACGCAGATAAGGTTTTACGACCTTTCAAT
CTGTACGAAGCAGATGGAAACAAAATTCTTATGCAATGTAACAAAGGAGA
ATACGCCAAGAAGAATTTTTATATCACTCATGTAGTGGACAAGAAGAACT
ATCTCATCCTCACTCAATCaaacATTTTGTATGTTGGAAAGAACGAGTTG
AAAATGGGTGAATGGGAATCggtttgggttatcgagttcaATGAGCTAAA
ACGTGAACCAGAAGTGAAAGAGACAAAGATTATTTTCCATATCCATAATA
CGGACACGCGACGTTCAATTTTCAAGAAATCGACGAACACACGTGAAGTG
ATATTGGAGTCTAGTGCTGTTGCAGACTGGTTTATCTTAAAGCTTAGAGA
TGCTAAAATGTTATAGatggtatttgaaTCTTTGGTTGCTGACCTCTTGA
ACAAGTATCTGGGTCAATATGTGAAAAATCTTGATGCTTCTCAATTGAAG
ATTGGCATTTGGGGAGGAAATGTTGTCCTGACAGAACTTGAACTGAAAGA
TACAGCTCTGGATGATCTTGACTTACCCATAAAAGTTGTTCGTGGATATT
TGGgtAAATTGGTCTTGTCCATCCCATGGAAAAATCTTTACACTGAATCA
ACTGTTGTCGATATTCAAGATCTCCACCTTGTCGCTAAGCCTAATTTTGA
CATCAAATACAATGAAGAACgcgaagaaaaatcaaaacatgacAAGAAAC
AACAACAGATTCACAATATCGAAGAAGCGAGGCAAAGAGAAGAAGACAAA
AAGAAAGGCGCCAAGAAAGAAGAGAGTGACGGTTTTGCTGAGAAACTTGC
AACAAACGTCATAAAAAATCTACAGGTTACGATCAAGAACATACATGTTC
GATATGAAGACTCAATCAGTGATGTGAATGGACCCTTTTCAGTCGGTCTT
ACAATGGAAAGTTTAACAGCACAAACCACAGATGAAGATTTTGTTCCAAA
GATTATCAAAGAATCTGTCTCATTAATTCATAAGatggTGAAATTAGACA
ATTTGGCTTTATATTGGAATCCAGGAGACGAACTGATTGATCCTTCACTT
GATACCAAGCAATGGTTGgaagtTTCAACGAAGCAAATTTCAACACACCA
ATCGAAGCCAGAGAAAACGAAATATATTTTGAGTCCCATGGTTGCAACGA
AGAAATTGAAGCTGAACACCAAACCAGGTTCCAACCTTGACATCCCGAAG
atgttTTTGAACTTGGTTTTGGAAGAACTTGGTATCATCGTGGCAAGAAG
TCAATATCATGGCGTGGTGCAACTGATTGAATCATTTGAACGAATGAATA
GGAACCAACCTTTTCGTAAATACAGACCACATACCTCCGTTCTTGGGAAC
GAAAGTATTTGGTGGAAGTACTGCATGTCCAGCATACTGGAGGTGGATGT
CAAAAGACGATCTCAAATGTGGAGCTGGAAGCATATTCAAAAACATCGAG
TTCTTTGCAAAGCTTACAAAGTGAAGTAcaaggaaaaattgaaacagaaa
aATCCATCCAAACAAATTCTCACTGAACTAGAGaGCATGGAGGATGAGTT
GAATATTGCAAGCATCACCATTTTTCGACAGCTTGCAGCTACAGAGGTTT
TAACGGAACAAAAGAAGAAAGGCACTAAAGGAAGTTTCTTCAGTTTCTTC
TCCAGATCAAAAGAACCAGAAAAGTCTGCTGCTAATAAAATTGGAGATTT
AATGGGTGATGACCAGGAGAAGGAAATGCAGAAATTGTATGACGCAATCG
GTTATACTGAAAATGAAGTCATCACTCCCTTTCCTAAAGAGTACGTGGCG
ATGTCAGTGGAATCGATTCTCCAGAAATTATTCATCAGCCTCATCGATGA
CACAGATAAGGCGAAAGAATTCAAAGTGTTGGATTTTTCACTCAACAACA
TCATTGTAGAAGTTTTCCAAAGACCTTCTGCTCAAGCTCTCAAATTATGT
GCAAAGATAGGAGAGATGAAGTTATTTGGTACAGCTTCTGCTCAATGTAC
ACCTCtcatcatcaaaaacatgttaCAAGGTCGAGGTATGGAATTTCTGC
CGTTGGTGGACTTCATCTTTGAGACGAATCCTTTGAAGAAACCGGACATT
GACCAATGTATCACTGCTATTTGTCAACCCTTAGAAATCATCTATGATGC
TAACACGATCAACCATATCATTAGTTTCTTCAAACCTCCTGAACATGTTA
TCTTGCAAGATTTACAAGACAAAGCGTATTCTACTTTCGAAGATTTTAAA
GTTTCAAGTACGGCTGGTCTTCTACATGCTATGGAACAAAGAACGGTTAT
GGACATCGACATTGATGTTGGAGCATCTCATTTGATCATCCCTGAAAAAG
GTTCTTACAATGGTTGTACAGATATGCTGGTGATCGACTTTGGTAAAATC
ACGATGAGCAGCGATCCTAGTCAAATCAGACACCTTGACCCTAAGGACAT
TGAGGATGTGAATGAAGTACAAAGCAAAGCTTATGATCGATTCTTGTTGT
CGCTTCAAGCTCTTCAAATATTACTCGTTAGAGAAGGTGAAGATTTAAAG
AGTGCTAAAAGCAACGTCAGTAAAGCTTCATCACACATTTTGCATCCCAT
CAATTTCGATGGCAAACTTGCCAAAGCTATACTTCCACAAGATCCACGTT
TAAAACAGATATGTGTCTCTGGTGAATTATCTTCGCTGTTTGTTTCTGTA
TCGGATGATAAAGTCAGTCGTCTCATCAAGCTAGCAGACTCGATACCACT
CCCTCAATCACCTTCTCACGATAACATCGACGGAGAAGAAAAACCTGAAG
GACTCTTCACCAAGGCGTTGTCAATGATAAGCTTGACAGGTGACAATGAC
ACAGGGGTGGACATCGGAGGATTTTCCATCCCTGTACCGACATCTCCAAC
ATCAGTGACGTCAGATGAAGATGAATACGGGACACCACCTGATGGCTCCA
TATTACAGTTACAACAAGAAGCTGGTCCGGACTTTTCATCAGGAGTGGCG
AACCAAGTCAAAGTGGACTTGAACTTTAAAATCCATAAAGTGATGATCGC
CATTGGTTTGACTGACAAAGCATTGAAACAGGAAAAAGAATGTCTGAAAT
TCATCGTGGACGACATCAATACAGAGgtGATACTACGAAGATGGGATTTG
TTCGTCAATGCAGAAGTTGGTCGTCTGGTGTTGAATGAAATGACATGGGG
TGTTGATGGAGAACCTTTCGCCATCATGAGTACacccaaaaacaccaaaa
tgttGAAATTCAGCTATCGGAGGTGTGAATTCAACGAAAGTTTGAATCTC
GGTCCAAGTTACTTTTATTCCAAAGAAGCGCAAGTCAGAGCTTTACATTT
CAAAGATGAATTTGGCGCCACGGATCAGATTTTAGATGTACAAGTGGCTA
CTTTATTTCTGATGCTTCATCAAGAAGCACTTTTGAGCATCATGTCATTG
ATCTACCAAGTACTGGAACCACTCAACAAACATGATAAGGAAGCCACACA
GAAGATCAAACGGAGTTTGAGTACGGCAGGTAGTCGTTTGAGTCTCTCCa
tcgaagaaaaagaaaaggagaGACAGATACAACGAAAATTAGCCAACCCT
AAAGCACTGGAAGCTGCCAACGAACTTAAGCAACAGGTTGGcttagaaga
agaaaaaaagatgaGAGTGACCGCCCACCTGGATGGTGTTGGTATCATGA
TTTGTTCAGCCAAAGTTGACCTTGCACAAGCCTTCGTTAAAGGGTTATCT
GCTAAAGTACTGATGAAAGATGACTTATTAGAAGTGAAAGCCAGCATGAA
AGATATGCAAGTACAAGATAATGTTGGCGAAACAAAGTACAAAGACATCA
TTAGCATGCGATCTGATGAAGTGTTCGATTTAGAGTTGGCTATTTACGAG
AATGGATCTTCTGGTAGCAAGCAATACGATATGTCGTGTGTCGACACCAG
TGTCAAACTGAACTTCGGTCAAATGCGCGTTGTTTTCTTGTATAGATTCA
TACAAGACTTAATGTCATTCACCGAAAACTTCGAAGAAGCACAGAAAGCA
GTTGTGGAAGCTGGTAAAGCTGCCAAGGATAAAGCTCTGGAAACAGCGAC
CGATTTGAATAGACATTCTTCTCGTGTCAAACTAAATGTGGTTCTGAAAG
CACCGACTATTATCATTCCAGTTGGATCAAACAATGAATTGGCTTTACTG
GTGGATCTGGGTGAATTGCGTATTTACAACACATTCAAACTCCTCAACGA
TGATCAATACCATAAGAAATCTATCATCACTGATAACATGACCATTAAGT
TATCCAATCTGAAATTGTTAAAAGCACTTATTCAAGATGGTAAAGATTTC
TTGCATCAACGAGCCATTATTGAACCTATGATGCTACAAATAACTATTGT
TCGTAATTTAACGAAAGGTAACCATTCCATACCGGATGTTTCAGTTCAAG
CAAAGATGCCAGCTATTCTGTTATCAATCAGTGAAGAAGATGTGACCGTA
GCTCTAAAGATTGTCCAAGGGAATCTCGCCGAAGGTGAGTCACATGCGCC
GAAGAAGCAAGCCAAGCCTGCCAAACAAACGTTAAACGTGCCACAAGATC
GTTTAGCAGACATTTACGAGGAGcctgaagatgaagatgagaaTCGACAA
GGATATCTTCAAACCAAACTATCCTTCGATCTGGCTAAAATTGACATCAA
GCTTTACTTGAAACCATCTGATATGACATTTGAAGATGAATTTTTAGCGA
GGACGGATGATTTGTTGTTAGCTTTGTTCACTATTGGTAACCTGTGTGTT
GATGGAGACATCATGTCCACGCAAGCTATGAAGATGAGCGTTCGATTGGA
CACTTTGGTGTTGGATGATATGAGACCTATCGAGGAGCATGAAGGTGTTA
AACGTATGATCAACTACAGTCCCGAGCCACTCCTTGAAGAAGTCAAAACC
TCTTCTCATAAACGACCAATCGACAACTCACGAATGATCGAAATCCAAtt
cgatcaaacttcatcgcaagataaaaatatcgacATCAAACTTTGTAACA
TGCTTTGTATATTCAACGTTGAGTTTATCATGGTCCTGTTGAAAACGTTG
CAAGCTGCCATACCTAAAGATGATAGTCTGCAACATGGCCATTCAATGAG
TAGTCTAGACTCGGCGGCAGGGTCTGGCGGCAGCGATGACGAGGACTCTT
TAGAAGCCAGCGAGATTGTCCTCTGCACTGGTGATCAAGAAAGACCTGAG
ACTAAAGTCTCTATCTTCGTCCATAACCCGCAAATTGTTTTACTAGCAGA
TGCAAAGGATGTCAAAACAAATGCACTCTTTCTTACAACCGagatcaatt
ttcaatatttcgaaTTGCGAGATACTCAAAAAATGATTGGCGCTGTTTCT
AACACCGCTATTTTGTCAACTGCTTTCAAGAATGACCATCGGAGTGATAT
ATCAACAGTGTTGTCATTAGATTCCATCAATCTCCACTCGTCATCACCCA
TCAATGGTAAACCTCATATGAGTGTCAGCACAACTTTGATCAAACTGAAT
ATCTCACCCAAAACCATCCGAACTTTATCAGCGTGTGCTGGTTACATCTC
CAATGATCCAACAGATGAAGAAATCAAAGAAGCTCGAAAAGCCATGCGTG
ATTTATGGCAAATTCAAACGTTCACCAATAAGCGACCGTGGTATTTAAAC
CACCCACCACAACAAGTCTTAAGTGCTGGCAGCTTCGTCCTTGCGCGAAC
GAGAACAGGAGAATATAAGCATGGTTTCTTAGCTAAAAAGGATGTCTCGT
ATCAAGTCTATTTTTCAGAGGAGCGAGGAACAGCCAGTCACCGAGCCATG
GATATCTCATCTGTTGTTTTGGATATCGTACCGCTGATCGGTGATCTATG
TGTTGGATGTAATGTTTTAGCTGTGGAATCGAAAGAACATGGATATCGTA
CTGGTCGAATTACTCAGGTTTGGGATTCGAATGTGGATAAAGATTCTTCG
GATGGCGCCAAACAATCTGTTTCTGTCAAGACAACTGCTATTGCTCCAAT
CAAATACCTTGTCAATTTCTATGACAACCAAACGGAGAACTTCTTCCCGC
CTGATGAACTTCGTATCATTGGTAAACCCATCAAGGGGGTTGTCCCTGGA
CTAGGGGCGTGTGTTTACGCCCGCTTTAATGATGGTTTTTACTATCGGGG
CAAAGTTGATGACATCGAGGATTATCGAATCCGAGTGCAATTGGATGAGA
TCAGTGGAGAAATCGAACACGACATCGATGATCCGTCAGCCGTTATTTTG
AACCTGACGCCTCAATACCGTCAAGTCAAAAAGCATTTCAAAGTCATTGC
ATCCAAAGGAAGCACAACTAAAGGATATCATCCGGGGAAAGTGACCGCCA
TCCAAGGTGAAGGAAATAACCGATTGTATTCGATACGCTTCGAAGACGGT
ACAATTAACCAAGTACCCATCacgaaattgattttgatgccAAAAGCACC
TTTTGATGCTTTACCTGAAGTTGGCACATACGTTTATTCCCGAGTGTCAC
GCGACGCTCCTTTATACGAGAAGGGTATCGTAGCAGAGAAGAACACAATG
ATCTGCGTTAAACATTTAAATGGACGGAAATTGGCTCACGAAATACAAAA
CATTCATTTTGTTGTCCGAAATATCGTTCCTCTCGTGTCATCAttgaagG
TTGGTTTGGACGTCATAGTGCAACCTGACAATGACGATCAGAAAATGTAT
TTGGCTGTCATTAGGGAAGTCACCAAAAAAGAAGGTGACAAAACGAACCG
TTATCTAGTGGAGTTTACGGATGGATCCAAGAAGAGAGTGACGCCCAGCC
GGATCCGTATACTTTCTCAATACGGAAGTGCAGAAACGAGTGAAGAAAAT
GCTGACATTATCACAACAAGACAGGAGGAACTAGTTCTCGATGTGCAAGG
TATCTCATTACGTGTGGAAGGTTACTTGGGAGGCGTGTTGACACCCATGC
TCAAAATGGATTCCAAAATCACAGCTAACTTGAAGGATTGGTCAAGCCAA
ATGAATGCACACGCTACTGTATCATTAGAAGCCAGTTATTATAACGAAAA
CGTTGCCGAATGGGAGCCAGTTATTGAACCTTTGATGGAGAAACGGAGGG
AAAGACCGTGGCAACTCTCTGTCAATTACACGATGGAAGGTGACGACAAT
TCTGCTTCATCCACTTCCAACGAACTCGTTTTACAAAAACCGGAATCCAA
CCTGAAAATCAAATCTCAAGATAATCTTGAATTGACAATTTCAAAATCAT
GTCTTGCTTTACTCGGTGAATTGGGACAGGTGTTTGGAGATGCAGTAGAA
TCTGTGGACGTTTTACCACAAGTCCTGGTCGAAAAAGAACCTTTCATGAT
CGAAAACTTGCTCTCCAAGAAGGTGACAGTAACATTGAATGAACTTCTGC
AGGGACCAAATGGAGATTCGACAATCGAGCTAGCATCTTCTTCGAATCCT
GTTGGCATTACTTTTGCTCCCAagaaatttgagaaacgaaAGACCAACGA
TCTATACACAATCAATTTAtcgGTGGACGGTTTTCATGACATTAAAGACA
TTGTGGTTCAAAGAAAGCGAAGCGTTATCTATGATCTTGTACCAATAAAA
CTATTATCAGCACAGTCTTCATATTCGATAGTGGTACAAGTGAAGACAAC
AGACGGACAACGTATCATCGTACTCCGATCACCATTGCAGTTGAAAAATC
ACTTTCCAATGCCGTTGGATGTCAGCTACATTTCCAAAGAAAACCAACCA
GTTAAACTGACAACAGTGGGATCGGGAGATATCTATTCCTTCCCTTTGTT
GTTAACCTACCACAGTGTTTTTCATCTCAAACCTGCTGGTTTCGACTACG
GTGATTGCACAGAAGCTCTCAATTGGAGTGATTTGAAGACGAGCAACGAA
AAACAGTTCTCCTGCCCTTCACCTGACAAAAGTGCTGACCCTTTCTACAT
GCAGGTGGTGATGAAAGAGGAGACGTACTCTTCCGTACACGGCATGTTGG
ACTGTGTACCACGTTACACGTTGGAGTGCTTTCCCGTCATCACGCTGCAT
AATTACCTACCTTGCACTATTAATTATAAGATCAAGGGTATGGCGAAATC
GGAAAGTCTACCAGGCGGACACAATTGGCCTTTGTTTACCGTCAACTTCA
GTGATAAACCTTCCATCTATATCGAGATTGAGTCGTATAACAACCAAAGA
TGGGAAGGAGGTTTGACATTACCAACAAAACCGGTAGATTCTTTGAACAA
ACCATCATTATCTTTCGTCATGATGTCTGGTGAACGCAAAATGGAATTGG
GTGTTTATTACCAGTTAGACGGTTCATTGAACATCACCTTATATTCGCCT
TACTGGCTTCTCAATAAAACTGGAAAACCACTTGTCTATCAGCCAGCGGG
GAGCAGCATCCAGCAAGTTCACCAAGAGAACGATGTAAATGCTCTTATGA
TGCTCGTCAAAGGGAAACATAAAAAGgcgaaagtgaaagtgaaaaataGC
GAGTCATGGTCAAATGAATTTTCATTGGATACTGTTGGCAGTGGTGGTTC
CTTGAAATGCAATGGTCCAAGAGATCGAGTTTATGAGATTGGTTTGAACA
TCAGTTTGTCATACTTTGGATTGACGAAGATTGTGACGTTCACGCCACTC
CGAATGTTATCTAACCACACCAAGTACACCATCAGTATGGCAGAAAGTAA
TTCTAAATCGTCAGAATGGCACACGGTAAACCCTGACGAGaacattccat
TCTGGCCGACGAAACTTCCTTTGGTCAACCTTTACATTAACATCAATGGG
CAAGATTCAGTGAAATTCAACCCTGAAGTTGGAAAAACTTTACTGTTGAA
GTTCCAGAATGAGGTTGGAGGAGTTTGCGTGGATTACCAAGAAAAGGACT
CGTCCTCAGTCCTTTCGTTTAATCCGTACTTCGCAGGTGCAGCTCCTGTG
CGGCttgaaaatctttgcaaaaaGATCGGCATGATCGCTTATAAACAAGC
AGGTTCGGTAATGGGTCACGTGTTAACACATGACCAATCAGTGTTGTACA
CGTGGGATGATCCAACCATGGAACAAGAATTGATTTGTTCCATTGTCAAT
GATGAAGCCAGTGAAACAAGGATCAAACTCGATGCCAACGATTTCGGACG
AATGAGAGTTGGAGATGGTGCAATTTATTGGGTTTCCTTTCTGGATGGTC
TTCAACGTGTTCTATTGTTCACTGATAACTTCAAATCTGCTTACTGCGCA
TGTCAGgaGCAAAATTTACGCCCAACCATGGAAGTTGACTTTGAGATTGA
GAGTTTTGGTTTGTCTCTGGTCAATGTTGATAAGAGAATGGAGATTGGCT
ACTTAGCTATCCGACAAAGCAAGACTGTATGGGAGCAACGCAAGAAAAAG
AACCGCTGGAAAGCTTTACCGCTTGCCATGTGTGAAGCTCTCGAAGAAGG
TTATCTCAATTATCAAAACAGAAAAGGTGCAGTCAAAGAGAAAGTTCTGG
ATAAGGAGGTGGATTACGAGAAGATGTTTATTACGAAACCTGAGAAGATT
AAGATCAGAAGAACGTACCACAGCGGTCTTGGTTTCAAATACACAATCTC
ACCCAATGAAATGCGTGTGCATGCTTCTATCAGCTCAATACAGTTGGATA
GCCATGTTCCAGGTTCGACCTTTCCAACAGTCTTGCATATGGTTGAACCA
CCAAAATCTGTTGCTTCAGAAAACGCTCCAAAGCCATTCTttgaattgag
tttaatgaCAAGGATCGGTGATAAAAATGTGGTCAATGAAGTcagCTATT
GTCACGTGTTGATTCAAGAGATGGATGTGAGGGTTGATATTGGATTTTTA
TTGGCTCTGATGGAACTCTTCAGTCATGCAAGAGCTCGAACAACCGAGAA
AGAACAATACGCGCTTGATATTGGCCAAGCAGCAACAAAGTTTGAAGAAA
GCGCTGAATTTCAGGCAGCCAAACAAGATCGATATTACGTTTTGAACGAC
TTTCATTTATCACCGCTAAAGATTCACGTCAGTTTCTCTTTGACGGGTGG
TTCCAAAGATGAAAATGCTATTGCTTCATTACATGGTAACGTGTTGAACT
TGTTGTTACAAAGTGTCGGACTGGCCTTCACTGAAATACAAGACGTACAA
TTCAAATTAGCATGTTACGAAGTGCATAAGTCCATGCAGAGTAATTCGCA
GCTCGGTGATGGAATAACTAAACATTATCAAACACAGGCTATCAAGCAAC
TTTATGTGTTGGTACTCGGGCTAGACGTTCTTGGTAATCCGTATGGTTTG
ATATCTGGTGTTGGAACCGGAGCAAAGAATTTCTTCTACGAACCTTACCA
GGGATTAATTCAAGGACCAGAAGAATTTGCGGAAGGATTGGCGTATGGGG
TGAAGAGTCTTGTTGGTGGAACCGTGGGTGGAGTATCAGGAGCTGTGAGT
AAGATTACCGGTACCTTCGGTAAAGGTTTGGCTGCATTGACCTTGGATGA
AGAATATCAACAAAAGAGACGTGAAAACATGAGCCAACGCCCAACTAACC
TCGGTGAAGGTCTCGCCAAAGGTGGTAAAGGCCTTGTAAAGGGTATCGTG
TCTGGTGTTACAGGGATCGTTACCAAACCCTATGAAGGTGCCAAGAATGA
TGGTGCAGGTGGCTTTTTTAAGGGCGTTGGAAAAGGCCTGATTGGCGTGG
TTGCACGCCCTGTTGGTGGAGTGGTAGATATGGCCAGTAACACGTTTGAT
GGTTTGAAAAGCACGACATCTGGCGTGAAAGCGATCGAGTTGAGCCGTGT
TACTCGCGTCTTCCACGCAGATAAGGTTTTACGACCTTTCAATCTGTACG
AAGCAGATGGAAACAAAATTCTTATGCAATGTAACAAAGGAGAATACGCC
AAGAAGAATTTTTATATCACTCATGTAGTGGACAAGAAGAACTATCTCAT
CCTCACTCAATCaaacATTTTGTATGTTGGAAAGAACGAGTTGAAAATGG
GTGAATGGGAATCggtttgggttatcgagttcaATGAGCTAAAACGTGAA
CCAGAAGTGAAAGAGACAAAGATTATTTTCCATATCCATAATACGGACAC
GCGACGTTCAATTTTCAAGAAATCGACGAACACACGTGAAGTGATATTGG
AGTCTAGTGCTGTTGCAGACTGGTTTATCTTAAAGCTTAGAGATGCTAAA
ATGTTATAGatggtatttgaaTCTTTGGTTGCTGACCTCTTGAACAAGTA
TCTGGGTCAATATGTGAAAAATCTTGATGCTTCTCAATTGAAGATTGGCA
TTTGGGGAGGAAATGTTGTCCTGACAGAACTTGAACTGAAAGATACAGCT
CTGGATGATCTTGACTTACCCATAAAAGTTGTTCGTGGATATTTGGgtAA
ATTGGTCTTGTCCATCCCATGGAAAAATCTTTACACTGAATCAACTGTTG
TCGATATTCAAGATCTCCACCTTGTCGCTAAGCCTAATTTTGACATCAAA
TACAATGAAGAACgcgaagaaaaatcaaaacatgacAAGAAACAACAACA
GATTCACAATATCGAAGAAGCGAGGCAAAGAGAAGAAGACAAAAAGAAAG
GCGCCAAGAAAGAAGAGAGTGACGGTTTTGCTGAGAAACTTGCAACAAAC
GTCATAAAAAATCTACAGGTTACGATCAAGAACATACATGTTCGATATGA
AGACTCAATCAGTGATGTGAATGGACCCTTTTCAGTCGGTCTTACAATGG
AAAGTTTAACAGCACAAACCACAGATGAAGATTTTGTTCCAAAGATTATC
AAAGAATCTGTCTCATTAATTCATAAGatggTGAAATTAGACAATTTGGC
TTTATATTGGAATCCAGGAGACGAACTGATTGATCCTTCACTTGATACCA
AGCAATGGTTGgaagtTTCAACGAAGCAAATTTCAACACACCAATCGAAG
CCAGAGAAAACGAAATATATTTTGAGTCCCATGGTTGCAACGAAGAAATT
GAAGCTGAACACCAAACCAGGTTCCAACCTTGACATCCCGAAGatgttTT
TGAACTTGGTTTTGGAAGAACTTGGTATCATCGTGGCAAGAAGTCAATAT
CATGGCGTGGTGCAACTGATTGAATCATTTGAACGAATGAATAGGAACCA
ACCTTTTCGTAAATACAGACCACATACCTCCGTTCTTGGGAACGAAAGTA
TTTGGTGGAAGTACTGCATGTCCAGCATACTGGAGGTGGATGTCAAAAGA
CGATCTCAAATGTGGAGCTGGAAGCATATTCAAAAACATCGAGTTCTTTG
CAAAGCTTACAAAGTGAAGTAcaaggaaaaattgaaacagaaaaATCCAT
CCAAACAAATTCTCACTGAACTAGAGaGCATGGAGGATGAGTTGAATATT
GCAAGCATCACCATTTTTCGACAGCTTGCAGCTACAGAGGTTTTAACGGA
ACAAAAGAAGAAAGGCACTAAAGGAAGTTTCTTCAGTTTCTTCTCCAGAT
CAAAAGAACCAGAAAAGTCTGCTGCTAATAAAATTGGAGATTTAATGGGT
GATGACCAGGAGAAGGAAATGCAGAAATTGTATGACGCAATCGGTTATAC
TGAAAATGAAGTCATCACTCCCTTTCCTAAAGAGTACGTGGCGATGTCAG
TGGAATCGATTCTCCAGAAATTATTCATCAGCCTCATCGATGACACAGAT
AAGGCGAAAGAATTCAAAGTGTTGGATTTTTCACTCAACAACATCATTGT
AGAAGTTTTCCAAAGACCTTCTGCTCAAGCTCTCAAATTATGTGCAAAGA
TAGGAGAGATGAAGTTATTTGGTACAGCTTCTGCTCAATGTACACCTCtc
atcatcaaaaacatgttaCAAGGTCGAGGTATGGAATTTCTGCCGTTGGT
GGACTTCATCTTTGAGACGAATCCTTTGAAGAAACCGGACATTGACCAAT
GTATCACTGCTATTTGTCAACCCTTAGAAATCATCTATGATGCTAACACG
ATCAACCATATCATTAGTTTCTTCAAACCTCCTGAACATGTTATCTTGCA
AGATTTACAAGACAAAGCGTATTCTACTTTCGAAGATTTTAAAGTTTCAA
GTACGGCTGGTCTTCTACATGCTATGGAACAAAGAACGGTTATGGACATC
GACATTGATGTTGGAGCATCTCATTTGATCATCCCTGAAAAAGGTTCTTA
CAATGGTTGTACAGATATGCTGGTGATCGACTTTGGTAAAATCACGATGA
GCAGCGATCCTAGTCAAATCAGACACCTTGACCCTAAGGACATTGAGGAT
GTGAATGAAGTACAAAGCAAAGCTTATGATCGATTCTTGTTGTCGCTTCA
AGCTCTTCAAATATTACTCGTTAGAGAAGGTGAAGATTTAAAGAGTGCTA
AAAGCAACGTCAGTAAAGCTTCATCACACATTTTGCATCCCATCAATTTC
GATGGCAAACTTGCCAAAGCTATACTTCCACAAGATCCACGTTTAAAACA
GATATGTGTCTCTGGTGAATTATCTTCGCTGTTTGTTTCTGTATCGGATG
ATAAAGTCAGTCGTCTCATCAAGCTAGCAGACTCGATACCACTCCCTCAA
TCACCTTCTCACGATAACATCGACGGAGAAGAAAAACCTGAAGGACTCTT
CACCAAGGCGTTGTCAATGATAAGCTTGACAGGTGACAATGACACAGGGG
TGGACATCGGAGGATTTTCCATCCCTGTACCGACATCTCCAACATCAGTG
ACGTCAGATGAAGATGAATACGGGACACCACCTGATGGCTCCATATTACA
GTTACAACAAGAAGCTGGTCCGGACTTTTCATCAGGAGTGGCGAACCAAG
TCAAAGTGGACTTGAACTTTAAAATCCATAAAGTGATGATCGCCATTGGT
TTGACTGACAAAGCATTGAAACAGGAAAAAGAATGTCTGAAATTCATCGT
GGACGACATCAATACAGAGgtGATACTACGAAGATGGGATTTGTTCGTCA
ATGCAGAAGTTGGTCGTCTGGTGTTGAATGAAATGACATGGGGTGTTGAT
GGAGAACCTTTCGCCATCATGAGTACacccaaaaacaccaaaatgttGAA
ATTCAGCTATCGGAGGTGTGAATTCAACGAAAGTTTGAATCTCGGTCCAA
GTTACTTTTATTCCAAAGAAGCGCAAGTCAGAGCTTTACATTTCAAAGAT
GAATTTGGCGCCACGGATCAGATTTTAGATGTACAAGTGGCTACTTTATT
TCTGATGCTTCATCAAGAAGCACTTTTGAGCATCATGTCATTGATCTACC
AAGTACTGGAACCACTCAACAAACATGATAAGGAAGCCACACAGAAGATC
AAACGGAGTTTGAGTACGGCAGGTAGTCGTTTGAGTCTCTCCatcgaaga
aaaagaaaaggagaGACAGATACAACGAAAATTAGCCAACCCTAAAGCAC
TGGAAGCTGCCAACGAACTTAAGCAACAGGTTGGcttagaagaagaaaaa
aagatgaGAGTGACCGCCCACCTGGATGGTGTTGGTATCATGATTTGTTC
AGCCAAAGTTGACCTTGCACAAGCCTTCGTTAAAGGGTTATCTGCTAAAG
TACTGATGAAAGATGACTTATTAGAAGTGAAAGCCAGCATGAAAGATATG
CAAGTACAAGATAATGTTGGCGAAACAAAGTACAAAGACATCATTAGCAT
GCGATCTGATGAAGTGTTCGATTTAGAGTTGGCTATTTACGAGAATGGAT
CTTCTGGTAGCAAGCAATACGATATGTCGTGTGTCGACACCAGTGTCAAA
CTGAACTTCGGTCAAATGCGCGTTGTTTTCTTGTATAGATTCATACAAGA
CTTAATGTCATTCACCGAAAACTTCGAAGAAGCACAGAAAGCAGTTGTGG
AAGCTGGTAAAGCTGCCAAGGATAAAGCTCTGGAAACAGCGACCGATTTG
AATAGACATTCTTCTCGTGTCAAACTAAATGTGGTTCTGAAAGCACCGAC
TATTATCATTCCAGTTGGATCAAACAATGAATTGGCTTTACTGGTGGATC
TGGGTGAATTGCGTATTTACAACACATTCAAACTCCTCAACGATGATCAA
TACCATAAGAAATCTATCATCACTGATAACATGACCATTAAGTTATCCAA
TCTGAAATTGTTAAAAGCACTTATTCAAGATGGTAAAGATTTCTTGCATC
AACGAGCCATTATTGAACCTATGATGCTACAAATAACTATTGTTCGTAAT
TTAACGAAAGGTAACCATTCCATACCGGATGTTTCAGTTCAAGCAAAGAT
GCCAGCTATTCTGTTATCAATCAGTGAAGAAGATGTGACCGTAGCTCTAA
AGATTGTCCAAGGGAATCTCGCCGAAGGTGAGTCACATGCGCCGAAGAAG
CAAGCCAAGCCTGCCAAACAAACGTTAAACGTGCCACAAGATCGTTTAGC
AGACATTTACGAGGAGcctgaagatgaagatgagaaTCGACAAGGATATC
TTCAAACCAAACTATCCTTCGATCTGGCTAAAATTGACATCAAGCTTTAC
TTGAAACCATCTGATATGACATTTGAAGATGAATTTTTAGCGAGGACGGA
TGATTTGTTGTTAGCTTTGTTCACTATTGGTAACCTGTGTGTTGATGGAG
ACATCATGTCCACGCAAGCTATGAAGATGAGCGTTCGATTGGACACTTTG
GTGTTGGATGATATGAGACCTATCGAGGAGCATGAAGGTGTTAAACGTAT
GATCAACTACAGTCCCGAGCCACTCCTTGAAGAAGTCAAAACCTCTTCTC
ATAAACGACCAATCGACAACTCACGAATGATCGAAATCCAAttcgatcaa
acttcatcgcaagataaaaatatcgacATCAAACTTTGTAACATGCTTTG
TATATTCAACGTTGAGTTTATCATGGTCCTGTTGAAAACGTTGCAAGCTG
CCATACCTAAAGATGATAGTCTGCAACATGGCCATTCAATGAGTAGTCTA
GACTCGGCGGCAGGGTCTGGCGGCAGCGATGACGAGGACTCTTTAGAAGC
CAGCGAGATTGTCCTCTGCACTGGTGATCAAGAAAGACCTGAGACTAAAG
TCTCTATCTTCGTCCATAACCCGCAAATTGTTTTACTAGCAGATGCAAAG
GATGTCAAAACAAATGCACTCTTTCTTACAACCGagatcaattttcaata
tttcgaaTTGCGAGATACTCAAAAAATGATTGGCGCTGTTTCTAACACCG
CTATTTTGTCAACTGCTTTCAAGAATGACCATCGGAGTGATATATCAACA
GTGTTGTCATTAGATTCCATCAATCTCCACTCGTCATCACCCATCAATGG
TAAACCTCATATGAGTGTCAGCACAACTTTGATCAAACTGAATATCTCAC
CCAAAACCATCCGAACTTTATCAGCGTGTGCTGGTTACATCTCCAATGAT
CCAACAGATGAAGAAATCAAAGAAGCTCGAAAAGCCATGCGTGATTTATG
GCAAATTCAAACGTTCACCAATAAGCGACCGTGGTATTTAAACCACCCAC
CACAACAAGTCTTAAGTGCTGGCAGCTTCGTCCTTGCGCGAACGAGAACA
GGAGAATATAAGCATGGTTTCTTAGCTAAAAAGGATGTCTCGTATCAAGT
CTATTTTTCAGAGGAGCGAGGAACAGCCAGTCACCGAGCCATGGATATCT
CATCTGTTGTTTTGGATATCGTACCGCTGATCGGTGATCTATGTGTTGGA
TGTAATGTTTTAGCTGTGGAATCGAAAGAACATGGATATCGTACTGGTCG
AATTACTCAGGTTTGGGATTCGAATGTGGATAAAGATTCTTCGGATGGCG
CCAAACAATCTGTTTCTGTCAAGACAACTGCTATTGCTCCAATCAAATAC
CTTGTCAATTTCTATGACAACCAAACGGAGAACTTCTTCCCGCCTGATGA
ACTTCGTATCATTGGTAAACCCATCAAGGGGGTTGTCCCTGGACTAGGGG
CGTGTGTTTACGCCCGCTTTAATGATGGTTTTTACTATCGGGGCAAAGTT
GATGACATCGAGGATTATCGAATCCGAGTGCAATTGGATGAGATCAGTGG
AGAAATCGAACACGACATCGATGATCCGTCAGCCGTTATTTTGAACCTGA
CGCCTCAATACCGTCAAGTCAAAAAGCATTTCAAAGTCATTGCATCCAAA
GGAAGCACAACTAAAGGATATCATCCGGGGAAAGTGACCGCCATCCAAGG
TGAAGGAAATAACCGATTGTATTCGATACGCTTCGAAGACGGTACAATTA
ACCAAGTACCCATCacgaaattgattttgatgccAAAAGCACCTTTTGAT
GCTTTACCTGAAGTTGGCACATACGTTTATTCCCGAGTGTCACGCGACGC
TCCTTTATACGAGAAGGGTATCGTAGCAGAGAAGAACACAATGATCTGCG
TTAAACATTTAAATGGACGGAAATTGGCTCACGAAATACAAAACATTCAT
TTTGTTGTCCGAAATATCGTTCCTCTCGTGTCATCAttgaagGTTGGTTT
GGACGTCATAGTGCAACCTGACAATGACGATCAGAAAATGTATTTGGCTG
TCATTAGGGAAGTCACCAAAAAAGAAGGTGACAAAACGAACCGTTATCTA
GTGGAGTTTACGGATGGATCCAAGAAGAGAGTGACGCCCAGCCGGATCCG
TATACTTTCTCAATACGGAAGTGCAGAAACGAGTGAAGAAAATGCTGACA
TTATCACAACAAGACAGGAGGAACTAGTTCTCGATGTGCAAGGTATCTCA
TTACGTGTGGAAGGTTACTTGGGAGGCGTGTTGACACCCATGCTCAAAAT
GGATTCCAAAATCACAGCTAACTTGAAGGATTGGTCAAGCCAAATGAATG
CACACGCTACTGTATCATTAGAAGCCAGTTATTATAACGAAAACGTTGCC
GAATGGGAGCCAGTTATTGAACCTTTGATGGAGAAACGGAGGGAAAGACC
GTGGCAACTCTCTGTCAATTACACGATGGAAGGTGACGACAATTCTGCTT
CATCCACTTCCAACGAACTCGTTTTACAAAAACCGGAATCCAACCTGAAA
ATCAAATCTCAAGATAATCTTGAATTGACAATTTCAAAATCATGTCTTGC
TTTACTCGGTGAATTGGGACAGGTGTTTGGAGATGCAGTAGAATCTGTGG
ACGTTTTACCACAAGTCCTGGTCGAAAAAGAACCTTTCATGATCGAAAAC
TTGCTCTCCAAGAAGGTGACAGTAACATTGAATGAACTTCTGCAGGGACC
AAATGGAGATTCGACAATCGAGCTAGCATCTTCTTCGAATCCTGTTGGCA
TTACTTTTGCTCCCAagaaatttgagaaacgaaAGACCAACGATCTATAC
ACAATCAATTTAtcgGTGGACGGTTTTCATGACATTAAAGACATTGTGGT
TCAAAGAAAGCGAAGCGTTATCTATGATCTTGTACCAATAAAACTATTAT
CAGCACAGTCTTCATATTCGATAGTGGTACAAGTGAAGACAACAGACGGA
CAACGTATCATCGTACTCCGATCACCATTGCAGTTGAAAAATCACTTTCC
AATGCCGTTGGATGTCAGCTACATTTCCAAAGAAAACCAACCAGTTAAAC
TGACAACAGTGGGATCGGGAGATATCTATTCCTTCCCTTTGTTGTTAACC
TACCACAGTGTTTTTCATCTCAAACCTGCTGGTTTCGACTACGGTGATTG
CACAGAAGCTCTCAATTGGAGTGATTTGAAGACGAGCAACGAAAAACAGT
TCTCCTGCCCTTCACCTGACAAAAGTGCTGACCCTTTCTACATGCAGGTG
GTGATGAAAGAGGAGACGTACTCTTCCGTACACGGCATGTTGGACTGTGT
ACCACGTTACACGTTGGAGTGCTTTCCCGTCATCACGCTGCATAATTACC
TACCTTGCACTATTAATTATAAGATCAAGGGTATGGCGAAATCGGAAAGT
CTACCAGGCGGACACAATTGGCCTTTGTTTACCGTCAACTTCAGTGATAA
ACCTTCCATCTATATCGAGATTGAGTCGTATAACAACCAAAGATGGGAAG
GAGGTTTGACATTACCAACAAAACCGGTAGATTCTTTGAACAAACCATCA
TTATCTTTCGTCATGATGTCTGGTGAACGCAAAATGGAATTGGGTGTTTA
TTACCAGTTAGACGGTTCATTGAACATCACCTTATATTCGCCTTACTGGC
TTCTCAATAAAACTGGAAAACCACTTGTCTATCAGCCAGCGGGGAGCAGC
ATCCAGCAAGTTCACCAAGAGAACGATGTAAATGCTCTTATGATGCTCGT
CAAAGGGAAACATAAAAAGgcgaaagtgaaagtgaaaaataGCGAGTCAT
GGTCAAATGAATTTTCATTGGATACTGTTGGCAGTGGTGGTTCCTTGAAA
TGCAATGGTCCAAGAGATCGAGTTTATGAGATTGGTTTGAACATCAGTTT
GTCATACTTTGGATTGACGAAGATTGTGACGTTCACGCCACTCCGAATGT
TATCTAACCACACCAAGTACACCATCAGTATGGCAGAAAGTAATTCTAAA
TCGTCAGAATGGCACACGGTAAACCCTGACGAGaacattccatTCTGGCC
GACGAAACTTCCTTTGGTCAACCTTTACATTAACATCAATGGGCAAGATT
CAGTGAAATTCAACCCTGAAGTTGGAAAAACTTTACTGTTGAAGTTCCAG
AATGAGGTTGGAGGAGTTTGCGTGGATTACCAAGAAAAGGACTCGTCCTC
AGTCCTTTCGTTTAATCCGTACTTCGCAGGTGCAGCTCCTGTGCGGCttg
aaaatctttgcaaaaaGATCGGCATGATCGCTTATAAACAAGCAGGTTCG
GTAATGGGTCACGTGTTAACACATGACCAATCAGTGTTGTACACGTGGGA
TGATCCAACCATGGAACAAGAATTGATTTGTTCCATTGTCAATGATGAAG
CCAGTGAAACAAGGATCAAACTCGATGCCAACGATTTCGGACGAATGAGA
GTTGGAGATGGTGCAATTTATTGGGTTTCCTTTCTGGATGGTCTTCAACG
TGTTCTATTGTTCACTGATAACTTCAAATCTGCTTACTGCGCATGTCAGg
aGCAAAATTTACGCCCAACCATGGAAGTTGACTTTGAGATTGAGAGTTTT
GGTTTGTCTCTGGTCAATGTTGATAAGAGAATGGAGATTGGCTACTTAGC
TATCCGACAAAGCAAGACTGTATGGGAGCAACGCAAGAAAAAGAACCGCT
GGAAAGCTTTACCGCTTGCCATGTGTGAAGCTCTCGAAGAAGGTTATCTC
AATTATCAAAACAGAAAAGGTGCAGTCAAAGAGAAAGTTCTGGATAAGGA
GGTGGATTACGAGAAGATGTTTATTACGAAACCTGAGAAGATTAAGATCA
GAAGAACGTACCACAGCGGTCTTGGTTTCAAATACACAATCTCACCCAAT
GAAATGCGTGTGCATGCTTCTATCAGCTCAATACAGTTGGATAGCCATGT
TCCAGGTTCGACCTTTCCAACAGTCTTGCATATGGTTGAACCACCAAAAT
CTGTTGCTTCAGAAAACGCTCCAAAGCCATTCTttgaattgagtttaatg
aCAAGGATCGGTGATAAAAATGTGGTCAATGAAGTcagCTATTGTCACGT
GTTGATTCAAGAGATGGATGTGAGGGTTGATATTGGATTTTTATTGGCTC
TGATGGAACTCTTCAGTCATGCAAGAGCTCGAACAACCGAGAAAGAACAA
TACGCGCTTGATATTGGCCAAGCAGCAACAAAGTTTGAAGAAAGCGCTGA
ATTTCAGGCAGCCAAACAAGATCGATATTACGTTTTGAACGACTTTCATT
TATCACCGCTAAAGATTCACGTCAGTTTCTCTTTGACGGGTGGTTCCAAA
GATGAAAATGCTATTGCTTCATTACATGGTAACGTGTTGAACTTGTTGTT
ACAAAGTGTCGGACTGGCCTTCACTGAAATACAAGACGTACAATTCAAAT
TAGCATGTTACGAAGTGCATAAGTCCATGCAGAGTAATTCGCAGCTCGGT
GATGGAATAACTAAACATTATCAAACACAGGCTATCAAGCAACTTTATGT
GTTGGTACTCGGGCTAGACGTTCTTGGTAATCCGTATGGTTTGATATCTG
GTGTTGGAACCGGAGCAAAGAATTTCTTCTACGAACCTTACCAGGGATTA
ATTCAAGGACCAGAAGAATTTGCGGAAGGATTGGCGTATGGGGTGAAGAG
TCTTGTTGGTGGAACCGTGGGTGGAGTATCAGGAGCTGTGAGTAAGATTA
CCGGTACCTTCGGTAAAGGTTTGGCTGCATTGACCTTGGATGAAGAATAT
CAACAAAAGAGACGTGAAAACATGAGCCAACGCCCAACTAACCTCGGTGA
AGGTCTCGCCAAAGGTGGTAAAGGCCTTGTAAAGGGTATCGTGTCTGGTG
TTACAGGGATCGTTACCAAACCCTATGAAGGTGCCAAGAATGATGGTGCA
GGTGGCTTTTTTAAGGGCGTTGGAAAAGGCCTGATTGGCGTGGTTGCACG
CCCTGTTGGTGGAGTGGTAGATATGGCCAGTAACACGTTTGATGGTTTGA
AAAGCACGACATCTGGCGTGAAAGCGATCGAGTTGAGCCGTGTTACTCGC
GTCTTCCACGCAGATAAGGTTTTACGACCTTTCAATCTGTACGAAGCAGA
TGGAAACAAAATTCTTATGCAATGTAACAAAGGAGAATACGCCAAGAAGA
ATTTTTATATCACTCATGTAGTGGACAAGAAGAACTATCTCATCCTCACT
CAATCaaacATTTTGTATGTTGGAAAGAACGAGTTGAAAATGGGTGAATG
GGAATCggtttgggttatcgagttcaATGAGCTAAAACGTGAACCAGAAG
TGAAAGAGACAAAGATTATTTTCCATATCCATAATACGGACACGCGACGT
TCAATTTTCAAGAAATCGACGAACACACGTGAAGTGATATTGGAGTCTAG
TGCTGTTGCAGACTGGTTTATCTTAAAGCTTAGAGATGCTAAAATGTTAT
AGatggtatttgaaTCTTTGGTTGCTGACCTCTTGAACAAGTATCTGGGT
CAATATGTGAAAAATCTTGATGCTTCTCAATTGAAGATTGGCATTTGGGG
AGGAAATGTTGTCCTGACAGAACTTGAACTGAAAGATACAGCTCTGGATG
ATCTTGACTTACCCATAAAAGTTGTTCGTGGATATTTGGgtAAATTGGTC
TTGTCCATCCCATGGAAAAATCTTTACACTGAATCAACTGTTGTCGATAT
TCAAGATCTCCACCTTGTCGCTAAGCCTAATTTTGACATCAAATACAATG
AAGAACgcgaagaaaaatcaaaacatgacAAGAAACAACAACAGATTCAC
AATATCGAAGAAGCGAGGCAAAGAGAAGAAGACAAAAAGAAAGGCGCCAA
GAAAGAAGAGAGTGACGGTTTTGCTGAGAAACTTGCAACAAACGTCATAA
AAAATCTACAGGTTACGATCAAGAACATACATGTTCGATATGAAGACTCA
ATCAGTGATGTGAATGGACCCTTTTCAGTCGGTCTTACAATGGAAAGTTT
AACAGCACAAACCACAGATGAAGATTTTGTTCCAAAGATTATCAAAGAAT
CTGTCTCATTAATTCATAAGatggTGAAATTAGACAATTTGGCTTTATAT
TGGAATCCAGGAGACGAACTGATTGATCCTTCACTTGATACCAAGCAATG
GTTGgaagtTTCAACGAAGCAAATTTCAACACACCAATCGAAGCCAGAGA
AAACGAAATATATTTTGAGTCCCATGGTTGCAACGAAGAAATTGAAGCTG
AACACCAAACCAGGTTCCAACCTTGACATCCCGAAGatgttTTTGAACTT
GGTTTTGGAAGAACTTGGTATCATCGTGGCAAGAAGTCAATATCATGGCG
TGGTGCAACTGATTGAATCATTTGAACGAATGAATAGGAACCAACCTTTT
CGTAAATACAGACCACATACCTCCGTTCTTGGGAACGAAAGTATTTGGTG
GAAGTACTGCATGTCCAGCATACTGGAGGTGGATGTCAAAAGACGATCTC
AAATGTGGAGCTGGAAGCATATTCAAAAACATCGAGTTCTTTGCAAAGCT
TACAAAGTGAAGTAcaaggaaaaattgaaacagaaaaATCCATCCAAACA
AATTCTCACTGAACTAGAGaGCATGGAGGATGAGTTGAATATTGCAAGCA
TCACCATTTTTCGACAGCTTGCAGCTACAGAGGTTTTAACGGAACAAAAG
AAGAAAGGCACTAAAGGAAGTTTCTTCAGTTTCTTCTCCAGATCAAAAGA
ACCAGAAAAGTCTGCTGCTAATAAAATTGGAGATTTAATGGGTGATGACC
AGGAGAAGGAAATGCAGAAATTGTATGACGCAATCGGTTATACTGAAAAT
GAAGTCATCACTCCCTTTCCTAAAGAGTACGTGGCGATGTCAGTGGAATC
GATTCTCCAGAAATTATTCATCAGCCTCATCGATGACACAGATAAGGCGA
AAGAATTCAAAGTGTTGGATTTTTCACTCAACAACATCATTGTAGAAGTT
TTCCAAAGACCTTCTGCTCAAGCTCTCAAATTATGTGCAAAGATAGGAGA
GATGAAGTTATTTGGTACAGCTTCTGCTCAATGTACACCTCtcatcatca
aaaacatgttaCAAGGTCGAGGTATGGAATTTCTGCCGTTGGTGGACTTC
ATCTTTGAGACGAATCCTTTGAAGAAACCGGACATTGACCAATGTATCAC
TGCTATTTGTCAACCCTTAGAAATCATCTATGATGCTAACACGATCAACC
ATATCATTAGTTTCTTCAAACCTCCTGAACATGTTATCTTGCAAGATTTA
CAAGACAAAGCGTATTCTACTTTCGAAGATTTTAAAGTTTCAAGTACGGC
TGGTCTTCTACATGCTATGGAACAAAGAACGGTTATGGACATCGACATTG
ATGTTGGAGCATCTCATTTGATCATCCCTGAAAAAGGTTCTTACAATGGT
TGTACAGATATGCTGGTGATCGACTTTGGTAAAATCACGATGAGCAGCGA
TCCTAGTCAAATCAGACACCTTGACCCTAAGGACATTGAGGATGTGAATG
AAGTACAAAGCAAAGCTTATGATCGATTCTTGTTGTCGCTTCAAGCTCTT
CAAATATTACTCGTTAGAGAAGGTGAAGATTTAAAGAGTGCTAAAAGCAA
CGTCAGTAAAGCTTCATCACACATTTTGCATCCCATCAATTTCGATGGCA
AACTTGCCAAAGCTATACTTCCACAAGATCCACGTTTAAAACAGATATGT
GTCTCTGGTGAATTATCTTCGCTGTTTGTTTCTGTATCGGATGATAAAGT
CAGTCGTCTCATCAAGCTAGCAGACTCGATACCACTCCCTCAATCACCTT
CTCACGATAACATCGACGGAGAAGAAAAACCTGAAGGACTCTTCACCAAG
GCGTTGTCAATGATAAGCTTGACAGGTGACAATGACACAGGGGTGGACAT
CGGAGGATTTTCCATCCCTGTACCGACATCTCCAACATCAGTGACGTCAG
ATGAAGATGAATACGGGACACCACCTGATGGCTCCATATTACAGTTACAA
CAAGAAGCTGGTCCGGACTTTTCATCAGGAGTGGCGAACCAAGTCAAAGT
GGACTTGAACTTTAAAATCCATAAAGTGATGATCGCCATTGGTTTGACTG
ACAAAGCATTGAAACAGGAAAAAGAATGTCTGAAATTCATCGTGGACGAC
ATCAATACAGAGgtGATACTACGAAGATGGGATTTGTTCGTCAATGCAGA
AGTTGGTCGTCTGGTGTTGAATGAAATGACATGGGGTGTTGATGGAGAAC
CTTTCGCCATCATGAGTACacccaaaaacaccaaaatgttGAAATTCAGC
TATCGGAGGTGTGAATTCAACGAAAGTTTGAATCTCGGTCCAAGTTACTT
TTATTCCAAAGAAGCGCAAGTCAGAGCTTTACATTTCAAAGATGAATTTG
GCGCCACGGATCAGATTTTAGATGTACAAGTGGCTACTTTATTTCTGATG
CTTCATCAAGAAGCACTTTTGAGCATCATGTCATTGATCTACCAAGTACT
GGAACCACTCAACAAACATGATAAGGAAGCCACACAGAAGATCAAACGGA
GTTTGAGTACGGCAGGTAGTCGTTTGAGTCTCTCCatcgaagaaaaagaa
aaggagaGACAGATACAACGAAAATTAGCCAACCCTAAAGCACTGGAAGC
TGCCAACGAACTTAAGCAACAGGTTGGcttagaagaagaaaaaaagatga
GAGTGACCGCCCACCTGGATGGTGTTGGTATCATGATTTGTTCAGCCAAA
GTTGACCTTGCACAAGCCTTCGTTAAAGGGTTATCTGCTAAAGTACTGAT
GAAAGATGACTTATTAGAAGTGAAAGCCAGCATGAAAGATATGCAAGTAC
AAGATAATGTTGGCGAAACAAAGTACAAAGACATCATTAGCATGCGATCT
GATGAAGTGTTCGATTTAGAGTTGGCTATTTACGAGAATGGATCTTCTGG
TAGCAAGCAATACGATATGTCGTGTGTCGACACCAGTGTCAAACTGAACT
TCGGTCAAATGCGCGTTGTTTTCTTGTATAGATTCATACAAGACTTAATG
TCATTCACCGAAAACTTCGAAGAAGCACAGAAAGCAGTTGTGGAAGCTGG
TAAAGCTGCCAAGGATAAAGCTCTGGAAACAGCGACCGATTTGAATAGAC
ATTCTTCTCGTGTCAAACTAAATGTGGTTCTGAAAGCACCGACTATTATC
ATTCCAGTTGGATCAAACAATGAATTGGCTTTACTGGTGGATCTGGGTGA
ATTGCGTATTTACAACACATTCAAACTCCTCAACGATGATCAATACCATA
AGAAATCTATCATCACTGATAACATGACCATTAAGTTATCCAATCTGAAA
TTGTTAAAAGCACTTATTCAAGATGGTAAAGATTTCTTGCATCAACGAGC
CATTATTGAACCTATGATGCTACAAATAACTATTGTTCGTAATTTAACGA
AAGGTAACCATTCCATACCGGATGTTTCAGTTCAAGCAAAGATGCCAGCT
ATTCTGTTATCAATCAGTGAAGAAGATGTGACCGTAGCTCTAAAGATTGT
CCAAGGGAATCTCGCCGAAGGTGAGTCACATGCGCCGAAGAAGCAAGCCA
AGCCTGCCAAACAAACGTTAAACGTGCCACAAGATCGTTTAGCAGACATT
TACGAGGAGcctgaagatgaagatgagaaTCGACAAGGATATCTTCAAAC
CAAACTATCCTTCGATCTGGCTAAAATTGACATCAAGCTTTACTTGAAAC
CATCTGATATGACATTTGAAGATGAATTTTTAGCGAGGACGGATGATTTG
TTGTTAGCTTTGTTCACTATTGGTAACCTGTGTGTTGATGGAGACATCAT
GTCCACGCAAGCTATGAAGATGAGCGTTCGATTGGACACTTTGGTGTTGG
ATGATATGAGACCTATCGAGGAGCATGAAGGTGTTAAACGTATGATCAAC
TACAGTCCCGAGCCACTCCTTGAAGAAGTCAAAACCTCTTCTCATAAACG
ACCAATCGACAACTCACGAATGATCGAAATCCAAttcgatcaaacttcat
cgcaagataaaaatatcgacATCAAACTTTGTAACATGCTTTGTATATTC
AACGTTGAGTTTATCATGGTCCTGTTGAAAACGTTGCAAGCTGCCATACC
TAAAGATGATAGTCTGCAACATGGCCATTCAATGAGTAGTCTAGACTCGG
CGGCAGGGTCTGGCGGCAGCGATGACGAGGACTCTTTAGAAGCCAGCGAG
ATTGTCCTCTGCACTGGTGATCAAGAAAGACCTGAGACTAAAGTCTCTAT
CTTCGTCCATAACCCGCAAATTGTTTTACTAGCAGATGCAAAGGATGTCA
AAACAAATGCACTCTTTCTTACAACCGagatcaattttcaatatttcgaa
TTGCGAGATACTCAAAAAATGATTGGCGCTGTTTCTAACACCGCTATTTT
GTCAACTGCTTTCAAGAATGACCATCGGAGTGATATATCAACAGTGTTGT
CATTAGATTCCATCAATCTCCACTCGTCATCACCCATCAATGGTAAACCT
CATATGAGTGTCAGCACAACTTTGATCAAACTGAATATCTCACCCAAAAC
CATCCGAACTTTATCAGCGTGTGCTGGTTACATCTCCAATGATCCAACAG
ATGAAGAAATCAAAGAAGCTCGAAAAGCCATGCGTGATTTATGGCAAATT
CAAACGTTCACCAATAAGCGACCGTGGTATTTAAACCACCCACCACAACA
AGTCTTAAGTGCTGGCAGCTTCGTCCTTGCGCGAACGAGAACAGGAGAAT
ATAAGCATGGTTTCTTAGCTAAAAAGGATGTCTCGTATCAAGTCTATTTT
TCAGAGGAGCGAGGAACAGCCAGTCACCGAGCCATGGATATCTCATCTGT
TGTTTTGGATATCGTACCGCTGATCGGTGATCTATGTGTTGGATGTAATG
TTTTAGCTGTGGAATCGAAAGAACATGGATATCGTACTGGTCGAATTACT
CAGGTTTGGGATTCGAATGTGGATAAAGATTCTTCGGATGGCGCCAAACA
ATCTGTTTCTGTCAAGACAACTGCTATTGCTCCAATCAAATACCTTGTCA
ATTTCTATGACAACCAAACGGAGAACTTCTTCCCGCCTGATGAACTTCGT
ATCATTGGTAAACCCATCAAGGGGGTTGTCCCTGGACTAGGGGCGTGTGT
TTACGCCCGCTTTAATGATGGTTTTTACTATCGGGGCAAAGTTGATGACA
TCGAGGATTATCGAATCCGAGTGCAATTGGATGAGATCAGTGGAGAAATC
GAACACGACATCGATGATCCGTCAGCCGTTATTTTGAACCTGACGCCTCA
ATACCGTCAAGTCAAAAAGCATTTCAAAGTCATTGCATCCAAAGGAAGCA
CAACTAAAGGATATCATCCGGGGAAAGTGACCGCCATCCAAGGTGAAGGA
AATAACCGATTGTATTCGATACGCTTCGAAGACGGTACAATTAACCAAGT
ACCCATCacgaaattgattttgatgccAAAAGCACCTTTTGATGCTTTAC
CTGAAGTTGGCACATACGTTTATTCCCGAGTGTCACGCGACGCTCCTTTA
TACGAGAAGGGTATCGTAGCAGAGAAGAACACAATGATCTGCGTTAAACA
TTTAAATGGACGGAAATTGGCTCACGAAATACAAAACATTCATTTTGTTG
TCCGAAATATCGTTCCTCTCGTGTCATCAttgaagGTTGGTTTGGACGTC
ATAGTGCAACCTGACAATGACGATCAGAAAATGTATTTGGCTGTCATTAG
GGAAGTCACCAAAAAAGAAGGTGACAAAACGAACCGTTATCTAGTGGAGT
TTACGGATGGATCCAAGAAGAGAGTGACGCCCAGCCGGATCCGTATACTT
TCTCAATACGGAAGTGCAGAAACGAGTGAAGAAAATGCTGACATTATCAC
AACAAGACAGGAGGAACTAGTTCTCGATGTGCAAGGTATCTCATTACGTG
TGGAAGGTTACTTGGGAGGCGTGTTGACACCCATGCTCAAAATGGATTCC
AAAATCACAGCTAACTTGAAGGATTGGTCAAGCCAAATGAATGCACACGC
TACTGTATCATTAGAAGCCAGTTATTATAACGAAAACGTTGCCGAATGGG
AGCCAGTTATTGAACCTTTGATGGAGAAACGGAGGGAAAGACCGTGGCAA
CTCTCTGTCAATTACACGATGGAAGGTGACGACAATTCTGCTTCATCCAC
TTCCAACGAACTCGTTTTACAAAAACCGGAATCCAACCTGAAAATCAAAT
CTCAAGATAATCTTGAATTGACAATTTCAAAATCATGTCTTGCTTTACTC
GGTGAATTGGGACAGGTGTTTGGAGATGCAGTAGAATCTGTGGACGTTTT
ACCACAAGTCCTGGTCGAAAAAGAACCTTTCATGATCGAAAACTTGCTCT
CCAAGAAGGTGACAGTAACATTGAATGAACTTCTGCAGGGACCAAATGGA
GATTCGACAATCGAGCTAGCATCTTCTTCGAATCCTGTTGGCATTACTTT
TGCTCCCAagaaatttgagaaacgaaAGACCAACGATCTATACACAATCA
ATTTAtcgGTGGACGGTTTTCATGACATTAAAGACATTGTGGTTCAAAGA
AAGCGAAGCGTTATCTATGATCTTGTACCAATAAAACTATTATCAGCACA
GTCTTCATATTCGATAGTGGTACAAGTGAAGACAACAGACGGACAACGTA
TCATCGTACTCCGATCACCATTGCAGTTGAAAAATCACTTTCCAATGCCG
TTGGATGTCAGCTACATTTCCAAAGAAAACCAACCAGTTAAACTGACAAC
AGTGGGATCGGGAGATATCTATTCCTTCCCTTTGTTGTTAACCTACCACA
GTGTTTTTCATCTCAAACCTGCTGGTTTCGACTACGGTGATTGCACAGAA
GCTCTCAATTGGAGTGATTTGAAGACGAGCAACGAAAAACAGTTCTCCTG
CCCTTCACCTGACAAAAGTGCTGACCCTTTCTACATGCAGGTGGTGATGA
AAGAGGAGACGTACTCTTCCGTACACGGCATGTTGGACTGTGTACCACGT
TACACGTTGGAGTGCTTTCCCGTCATCACGCTGCATAATTACCTACCTTG
CACTATTAATTATAAGATCAAGGGTATGGCGAAATCGGAAAGTCTACCAG
GCGGACACAATTGGCCTTTGTTTACCGTCAACTTCAGTGATAAACCTTCC
ATCTATATCGAGATTGAGTCGTATAACAACCAAAGATGGGAAGGAGGTTT
GACATTACCAACAAAACCGGTAGATTCTTTGAACAAACCATCATTATCTT
TCGTCATGATGTCTGGTGAACGCAAAATGGAATTGGGTGTTTATTACCAG
TTAGACGGTTCATTGAACATCACCTTATATTCGCCTTACTGGCTTCTCAA
TAAAACTGGAAAACCACTTGTCTATCAGCCAGCGGGGAGCAGCATCCAGC
AAGTTCACCAAGAGAACGATGTAAATGCTCTTATGATGCTCGTCAAAGGG
AAACATAAAAAGgcgaaagtgaaagtgaaaaataGCGAGTCATGGTCAAA
TGAATTTTCATTGGATACTGTTGGCAGTGGTGGTTCCTTGAAATGCAATG
GTCCAAGAGATCGAGTTTATGAGATTGGTTTGAACATCAGTTTGTCATAC
TTTGGATTGACGAAGATTGTGACGTTCACGCCACTCCGAATGTTATCTAA
CCACACCAAGTACACCATCAGTATGGCAGAAAGTAATTCTAAATCGTCAG
AATGGCACACGGTAAACCCTGACGAGaacattccatTCTGGCCGACGAAA
CTTCCTTTGGTCAACCTTTACATTAACATCAATGGGCAAGATTCAGTGAA
ATTCAACCCTGAAGTTGGAAAAACTTTACTGTTGAAGTTCCAGAATGAGG
TTGGAGGAGTTTGCGTGGATTACCAAGAAAAGGACTCGTCCTCAGTCCTT
TCGTTTAATCCGTACTTCGCAGGTGCAGCTCCTGTGCGGCttgaaaatct
ttgcaaaaaGATCGGCATGATCGCTTATAAACAAGCAGGTTCGGTAATGG
GTCACGTGTTAACACATGACCAATCAGTGTTGTACACGTGGGATGATCCA
ACCATGGAACAAGAATTGATTTGTTCCATTGTCAATGATGAAGCCAGTGA
AACAAGGATCAAACTCGATGCCAACGATTTCGGACGAATGAGAGTTGGAG
ATGGTGCAATTTATTGGGTTTCCTTTCTGGATGGTCTTCAACGTGTTCTA
TTGTTCACTGATAACTTCAAATCTGCTTACTGCGCATGTCAGgaGCAAAA
TTTACGCCCAACCATGGAAGTTGACTTTGAGATTGAGAGTTTTGGTTTGT
CTCTGGTCAATGTTGATAAGAGAATGGAGATTGGCTACTTAGCTATCCGA
CAAAGCAAGACTGTATGGGAGCAACGCAAGAAAAAGAACCGCTGGAAAGC
TTTACCGCTTGCCATGTGTGAAGCTCTCGAAGAAGGTTATCTCAATTATC
AAAACAGAAAAGGTGCAGTCAAAGAGAAAGTTCTGGATAAGGAGGTGGAT
TACGAGAAGATGTTTATTACGAAACCTGAGAAGATTAAGATCAGAAGAAC
GTACCACAGCGGTCTTGGTTTCAAATACACAATCTCACCCAATGAAATGC
GTGTGCATGCTTCTATCAGCTCAATACAGTTGGATAGCCATGTTCCAGGT
TCGACCTTTCCAACAGTCTTGCATATGGTTGAACCACCAAAATCTGTTGC
TTCAGAAAACGCTCCAAAGCCATTCTttgaattgagtttaatgaCAAGGA
TCGGTGATAAAAATGTGGTCAATGAAGTcagCTATTGTCACGTGTTGATT
CAAGAGATGGATGTGAGGGTTGATATTGGATTTTTATTGGCTCTGATGGA
ACTCTTCAGTCATGCAAGAGCTCGAACAACCGAGAAAGAACAATACGCGC
TTGATATTGGCCAAGCAGCAACAAAGTTTGAAGAAAGCGCTGAATTTCAG
GCAGCCAAACAAGATCGATATTACGTTTTGAACGACTTTCATTTATCACC
GCTAAAGATTCACGTCAGTTTCTCTTTGACGGGTGGTTCCAAAGATGAAA
ATGCTATTGCTTCATTACATGGTAACGTGTTGAACTTGTTGTTACAAAGT
GTCGGACTGGCCTTCACTGAAATACAAGACGTACAATTCAAATTAGCATG
TTACGAAGTGCATAAGTCCATGCAGAGTAATTCGCAGCTCGGTGATGGAA
TAACTAAACATTATCAAACACAGGCTATCAAGCAACTTTATGTGTTGGTA
CTCGGGCTAGACGTTCTTGGTAATCCGTATGGTTTGATATCTGGTGTTGG
AACCGGAGCAAAGAATTTCTTCTACGAACCTTACCAGGGATTAATTCAAG
GACCAGAAGAATTTGCGGAAGGATTGGCGTATGGGGTGAAGAGTCTTGTT
GGTGGAACCGTGGGTGGAGTATCAGGAGCTGTGAGTAAGATTACCGGTAC
CTTCGGTAAAGGTTTGGCTGCATTGACCTTGGATGAAGAATATCAACAAA
AGAGACGTGAAAACATGAGCCAACGCCCAACTAACCTCGGTGAAGGTCTC
GCCAAAGGTGGTAAAGGCCTTGTAAAGGGTATCGTGTCTGGTGTTACAGG
GATCGTTACCAAACCCTATGAAGGTGCCAAGAATGATGGTGCAGGTGGCT
TTTTTAAGGGCGTTGGAAAAGGCCTGATTGGCGTGGTTGCACGCCCTGTT
GGTGGAGTGGTAGATATGGCCAGTAACACGTTTGATGGTTTGAAAAGCAC
GACATCTGGCGTGAAAGCGATCGAGTTGAGCCGTGTTACTCGCGTCTTCC
ACGCAGATAAGGTTTTACGACCTTTCAATCTGTACGAAGCAGATGGAAAC
AAAATTCTTATGCAATGTAACAAAGGAGAATACGCCAAGAAGAATTTTTA
TATCACTCATGTAGTGGACAAGAAGAACTATCTCATCCTCACTCAATCaa
acATTTTGTATGTTGGAAAGAACGAGTTGAAAATGGGTGAATGGGAATCg
gtttgggttatcgagttcaATGAGCTAAAACGTGAACCAGAAGTGAAAGA
GACAAAGATTATTTTCCATATCCATAATACGGACACGCGACGTTCAATTT
TCAAGAAATCGACGAACACACGTGAAGTGATATTGGAGTCTAGTGCTGTT
GCAGACTGGTTTATCTTAAAGCTTAGAGATGCTAAAATGTTATAGatggt
atttgaaTCTTTGGTTGCTGACCTCTTGAACAAGTATCTGGGTCAATATG
TGAAAAATCTTGATGCTTCTCAATTGAAGATTGGCATTTGGGGAGGAAAT
GTTGTCCTGACAGAACTTGAACTGAAAGATACAGCTCTGGATGATCTTGA
CTTACCCATAAAAGTTGTTCGTGGATATTTGGgtAAATTGGTCTTGTCCA
TCCCATGGAAAAATCTTTACACTGAATCAACTGTTGTCGATATTCAAGAT
CTCCACCTTGTCGCTAAGCCTAATTTTGACATCAAATACAATGAAGAACg
cgaagaaaaatcaaaacatgacAAGAAACAACAACAGATTCACAATATCG
AAGAAGCGAGGCAAAGAGAAGAAGACAAAAAGAAAGGCGCCAAGAAAGAA
GAGAGTGACGGTTTTGCTGAGAAACTTGCAACAAACGTCATAAAAAATCT
ACAGGTTACGATCAAGAACATACATGTTCGATATGAAGACTCAATCAGTG
ATGTGAATGGACCCTTTTCAGTCGGTCTTACAATGGAAAGTTTAACAGCA
CAAACCACAGATGAAGATTTTGTTCCAAAGATTATCAAAGAATCTGTCTC
ATTAATTCATAAGatggTGAAATTAGACAATTTGGCTTTATATTGGAATC
CAGGAGACGAACTGATTGATCCTTCACTTGATACCAAGCAATGGTTGgaa
gtTTCAACGAAGCAAATTTCAACACACCAATCGAAGCCAGAGAAAACGAA
ATATATTTTGAGTCCCATGGTTGCAACGAAGAAATTGAAGCTGAACACCA
AACCAGGTTCCAACCTTGACATCCCGAAGatgttTTTGAACTTGGTTTTG
GAAGAACTTGGTATCATCGTGGCAAGAAGTCAATATCATGGCGTGGTGCA
ACTGATTGAATCATTTGAACGAATGAATAGGAACCAACCTTTTCGTAAAT
ACAGACCACATACCTCCGTTCTTGGGAACGAAAGTATTTGGTGGAAGTAC
TGCATGTCCAGCATACTGGAGGTGGATGTCAAAAGACGATCTCAAATGTG
GAGCTGGAAGCATATTCAAAAACATCGAGTTCTTTGCAAAGCTTACAAAG
TGAAGTAcaaggaaaaattgaaacagaaaaATCCATCCAAACAAATTCTC
ACTGAACTAGAGaGCATGGAGGATGAGTTGAATATTGCAAGCATCACCAT
TTTTCGACAGCTTGCAGCTACAGAGGTTTTAACGGAACAAAAGAAGAAAG
GCACTAAAGGAAGTTTCTTCAGTTTCTTCTCCAGATCAAAAGAACCAGAA
AAGTCTGCTGCTAATAAAATTGGAGATTTAATGGGTGATGACCAGGAGAA
GGAAATGCAGAAATTGTATGACGCAATCGGTTATACTGAAAATGAAGTCA
TCACTCCCTTTCCTAAAGAGTACGTGGCGATGTCAGTGGAATCGATTCTC
CAGAAATTATTCATCAGCCTCATCGATGACACAGATAAGGCGAAAGAATT
CAAAGTGTTGGATTTTTCACTCAACAACATCATTGTAGAAGTTTTCCAAA
GACCTTCTGCTCAAGCTCTCAAATTATGTGCAAAGATAGGAGAGATGAAG
TTATTTGGTACAGCTTCTGCTCAATGTACACCTCtcatcatcaaaaacat
gttaCAAGGTCGAGGTATGGAATTTCTGCCGTTGGTGGACTTCATCTTTG
AGACGAATCCTTTGAAGAAACCGGACATTGACCAATGTATCACTGCTATT
TGTCAACCCTTAGAAATCATCTATGATGCTAACACGATCAACCATATCAT
TAGTTTCTTCAAACCTCCTGAACATGTTATCTTGCAAGATTTACAAGACA
AAGCGTATTCTACTTTCGAAGATTTTAAAGTTTCAAGTACGGCTGGTCTT
CTACATGCTATGGAACAAAGAACGGTTATGGACATCGACATTGATGTTGG
AGCATCTCATTTGATCATCCCTGAAAAAGGTTCTTACAATGGTTGTACAG
ATATGCTGGTGATCGACTTTGGTAAAATCACGATGAGCAGCGATCCTAGT
CAAATCAGACACCTTGACCCTAAGGACATTGAGGATGTGAATGAAGTACA
AAGCAAAGCTTATGATCGATTCTTGTTGTCGCTTCAAGCTCTTCAAATAT
TACTCGTTAGAGAAGGTGAAGATTTAAAGAGTGCTAAAAGCAACGTCAGT
AAAGCTTCATCACACATTTTGCATCCCATCAATTTCGATGGCAAACTTGC
CAAAGCTATACTTCCACAAGATCCACGTTTAAAACAGATATGTGTCTCTG
GTGAATTATCTTCGCTGTTTGTTTCTGTATCGGATGATAAAGTCAGTCGT
CTCATCAAGCTAGCAGACTCGATACCACTCCCTCAATCACCTTCTCACGA
TAACATCGACGGAGAAGAAAAACCTGAAGGACTCTTCACCAAGGCGTTGT
CAATGATAAGCTTGACAGGTGACAATGACACAGGGGTGGACATCGGAGGA
TTTTCCATCCCTGTACCGACATCTCCAACATCAGTGACGTCAGATGAAGA
TGAATACGGGACACCACCTGATGGCTCCATATTACAGTTACAACAAGAAG
CTGGTCCGGACTTTTCATCAGGAGTGGCGAACCAAGTCAAAGTGGACTTG
AACTTTAAAATCCATAAAGTGATGATCGCCATTGGTTTGACTGACAAAGC
ATTGAAACAGGAAAAAGAATGTCTGAAATTCATCGTGGACGACATCAATA
CAGAGgtGATACTACGAAGATGGGATTTGTTCGTCAATGCAGAAGTTGGT
CGTCTGGTGTTGAATGAAATGACATGGGGTGTTGATGGAGAACCTTTCGC
CATCATGAGTACacccaaaaacaccaaaatgttGAAATTCAGCTATCGGA
GGTGTGAATTCAACGAAAGTTTGAATCTCGGTCCAAGTTACTTTTATTCC
AAAGAAGCGCAAGTCAGAGCTTTACATTTCAAAGATGAATTTGGCGCCAC
GGATCAGATTTTAGATGTACAAGTGGCTACTTTATTTCTGATGCTTCATC
AAGAAGCACTTTTGAGCATCATGTCATTGATCTACCAAGTACTGGAACCA
CTCAACAAACATGATAAGGAAGCCACACAGAAGATCAAACGGAGTTTGAG
TACGGCAGGTAGTCGTTTGAGTCTCTCCatcgaagaaaaagaaaaggaga
GACAGATACAACGAAAATTAGCCAACCCTAAAGCACTGGAAGCTGCCAAC
GAACTTAAGCAACAGGTTGGcttagaagaagaaaaaaagatgaGAGTGAC
CGCCCACCTGGATGGTGTTGGTATCATGATTTGTTCAGCCAAAGTTGACC
TTGCACAAGCCTTCGTTAAAGGGTTATCTGCTAAAGTACTGATGAAAGAT
GACTTATTAGAAGTGAAAGCCAGCATGAAAGATATGCAAGTACAAGATAA
TGTTGGCGAAACAAAGTACAAAGACATCATTAGCATGCGATCTGATGAAG
TGTTCGATTTAGAGTTGGCTATTTACGAGAATGGATCTTCTGGTAGCAAG
CAATACGATATGTCGTGTGTCGACACCAGTGTCAAACTGAACTTCGGTCA
AATGCGCGTTGTTTTCTTGTATAGATTCATACAAGACTTAATGTCATTCA
CCGAAAACTTCGAAGAAGCACAGAAAGCAGTTGTGGAAGCTGGTAAAGCT
GCCAAGGATAAAGCTCTGGAAACAGCGACCGATTTGAATAGACATTCTTC
TCGTGTCAAACTAAATGTGGTTCTGAAAGCACCGACTATTATCATTCCAG
TTGGATCAAACAATGAATTGGCTTTACTGGTGGATCTGGGTGAATTGCGT
ATTTACAACACATTCAAACTCCTCAACGATGATCAATACCATAAGAAATC
TATCATCACTGATAACATGACCATTAAGTTATCCAATCTGAAATTGTTAA
AAGCACTTATTCAAGATGGTAAAGATTTCTTGCATCAACGAGCCATTATT
GAACCTATGATGCTACAAATAACTATTGTTCGTAATTTAACGAAAGGTAA
CCATTCCATACCGGATGTTTCAGTTCAAGCAAAGATGCCAGCTATTCTGT
TATCAATCAGTGAAGAAGATGTGACCGTAGCTCTAAAGATTGTCCAAGGG
AATCTCGCCGAAGGTGAGTCACATGCGCCGAAGAAGCAAGCCAAGCCTGC
CAAACAAACGTTAAACGTGCCACAAGATCGTTTAGCAGACATTTACGAGG
AGcctgaagatgaagatgagaaTCGACAAGGATATCTTCAAACCAAACTA
TCCTTCGATCTGGCTAAAATTGACATCAAGCTTTACTTGAAACCATCTGA
TATGACATTTGAAGATGAATTTTTAGCGAGGACGGATGATTTGTTGTTAG
CTTTGTTCACTATTGGTAACCTGTGTGTTGATGGAGACATCATGTCCACG
CAAGCTATGAAGATGAGCGTTCGATTGGACACTTTGGTGTTGGATGATAT
GAGACCTATCGAGGAGCATGAAGGTGTTAAACGTATGATCAACTACAGTC
CCGAGCCACTCCTTGAAGAAGTCAAAACCTCTTCTCATAAACGACCAATC
GACAACTCACGAATGATCGAAATCCAAttcgatcaaacttcatcgcaaga
taaaaatatcgacATCAAACTTTGTAACATGCTTTGTATATTCAACGTTG
AGTTTATCATGGTCCTGTTGAAAACGTTGCAAGCTGCCATACCTAAAGAT
GATAGTCTGCAACATGGCCATTCAATGAGTAGTCTAGACTCGGCGGCAGG
GTCTGGCGGCAGCGATGACGAGGACTCTTTAGAAGCCAGCGAGATTGTCC
TCTGCACTGGTGATCAAGAAAGACCTGAGACTAAAGTCTCTATCTTCGTC
CATAACCCGCAAATTGTTTTACTAGCAGATGCAAAGGATGTCAAAACAAA
TGCACTCTTTCTTACAACCGagatcaattttcaatatttcgaaTTGCGAG
ATACTCAAAAAATGATTGGCGCTGTTTCTAACACCGCTATTTTGTCAACT
GCTTTCAAGAATGACCATCGGAGTGATATATCAACAGTGTTGTCATTAGA
TTCCATCAATCTCCACTCGTCATCACCCATCAATGGTAAACCTCATATGA
GTGTCAGCACAACTTTGATCAAACTGAATATCTCACCCAAAACCATCCGA
ACTTTATCAGCGTGTGCTGGTTACATCTCCAATGATCCAACAGATGAAGA
AATCAAAGAAGCTCGAAAAGCCATGCGTGATTTATGGCAAATTCAAACGT
TCACCAATAAGCGACCGTGGTATTTAAACCACCCACCACAACAAGTCTTA
AGTGCTGGCAGCTTCGTCCTTGCGCGAACGAGAACAGGAGAATATAAGCA
TGGTTTCTTAGCTAAAAAGGATGTCTCGTATCAAGTCTATTTTTCAGAGG
AGCGAGGAACAGCCAGTCACCGAGCCATGGATATCTCATCTGTTGTTTTG
GATATCGTACCGCTGATCGGTGATCTATGTGTTGGATGTAATGTTTTAGC
TGTGGAATCGAAAGAACATGGATATCGTACTGGTCGAATTACTCAGGTTT
GGGATTCGAATGTGGATAAAGATTCTTCGGATGGCGCCAAACAATCTGTT
TCTGTCAAGACAACTGCTATTGCTCCAATCAAATACCTTGTCAATTTCTA
TGACAACCAAACGGAGAACTTCTTCCCGCCTGATGAACTTCGTATCATTG
GTAAACCCATCAAGGGGGTTGTCCCTGGACTAGGGGCGTGTGTTTACGCC
CGCTTTAATGATGGTTTTTACTATCGGGGCAAAGTTGATGACATCGAGGA
TTATCGAATCCGAGTGCAATTGGATGAGATCAGTGGAGAAATCGAACACG
ACATCGATGATCCGTCAGCCGTTATTTTGAACCTGACGCCTCAATACCGT
CAAGTCAAAAAGCATTTCAAAGTCATTGCATCCAAAGGAAGCACAACTAA
AGGATATCATCCGGGGAAAGTGACCGCCATCCAAGGTGAAGGAAATAACC
GATTGTATTCGATACGCTTCGAAGACGGTACAATTAACCAAGTACCCATC
acgaaattgattttgatgccAAAAGCACCTTTTGATGCTTTACCTGAAGT
TGGCACATACGTTTATTCCCGAGTGTCACGCGACGCTCCTTTATACGAGA
AGGGTATCGTAGCAGAGAAGAACACAATGATCTGCGTTAAACATTTAAAT
GGACGGAAATTGGCTCACGAAATACAAAACATTCATTTTGTTGTCCGAAA
TATCGTTCCTCTCGTGTCATCAttgaagGTTGGTTTGGACGTCATAGTGC
AACCTGACAATGACGATCAGAAAATGTATTTGGCTGTCATTAGGGAAGTC
ACCAAAAAAGAAGGTGACAAAACGAACCGTTATCTAGTGGAGTTTACGGA
TGGATCCAAGAAGAGAGTGACGCCCAGCCGGATCCGTATACTTTCTCAAT
ACGGAAGTGCAGAAACGAGTGAAGAAAATGCTGACATTATCACAACAAGA
CAGGAGGAACTAGTTCTCGATGTGCAAGGTATCTCATTACGTGTGGAAGG
TTACTTGGGAGGCGTGTTGACACCCATGCTCAAAATGGATTCCAAAATCA
CAGCTAACTTGAAGGATTGGTCAAGCCAAATGAATGCACACGCTACTGTA
TCATTAGAAGCCAGTTATTATAACGAAAACGTTGCCGAATGGGAGCCAGT
TATTGAACCTTTGATGGAGAAACGGAGGGAAAGACCGTGGCAACTCTCTG
TCAATTACACGATGGAAGGTGACGACAATTCTGCTTCATCCACTTCCAAC
GAACTCGTTTTACAAAAACCGGAATCCAACCTGAAAATCAAATCTCAAGA
TAATCTTGAATTGACAATTTCAAAATCATGTCTTGCTTTACTCGGTGAAT
TGGGACAGGTGTTTGGAGATGCAGTAGAATCTGTGGACGTTTTACCACAA
GTCCTGGTCGAAAAAGAACCTTTCATGATCGAAAACTTGCTCTCCAAGAA
GGTGACAGTAACATTGAATGAACTTCTGCAGGGACCAAATGGAGATTCGA
CAATCGAGCTAGCATCTTCTTCGAATCCTGTTGGCATTACTTTTGCTCCC
AagaaatttgagaaacgaaAGACCAACGATCTATACACAATCAATTTAtc
gGTGGACGGTTTTCATGACATTAAAGACATTGTGGTTCAAAGAAAGCGAA
GCGTTATCTATGATCTTGTACCAATAAAACTATTATCAGCACAGTCTTCA
TATTCGATAGTGGTACAAGTGAAGACAACAGACGGACAACGTATCATCGT
ACTCCGATCACCATTGCAGTTGAAAAATCACTTTCCAATGCCGTTGGATG
TCAGCTACATTTCCAAAGAAAACCAACCAGTTAAACTGACAACAGTGGGA
TCGGGAGATATCTATTCCTTCCCTTTGTTGTTAACCTACCACAGTGTTTT
TCATCTCAAACCTGCTGGTTTCGACTACGGTGATTGCACAGAAGCTCTCA
ATTGGAGTGATTTGAAGACGAGCAACGAAAAACAGTTCTCCTGCCCTTCA
CCTGACAAAAGTGCTGACCCTTTCTACATGCAGGTGGTGATGAAAGAGGA
GACGTACTCTTCCGTACACGGCATGTTGGACTGTGTACCACGTTACACGT
TGGAGTGCTTTCCCGTCATCACGCTGCATAATTACCTACCTTGCACTATT
AATTATAAGATCAAGGGTATGGCGAAATCGGAAAGTCTACCAGGCGGACA
CAATTGGCCTTTGTTTACCGTCAACTTCAGTGATAAACCTTCCATCTATA
TCGAGATTGAGTCGTATAACAACCAAAGATGGGAAGGAGGTTTGACATTA
CCAACAAAACCGGTAGATTCTTTGAACAAACCATCATTATCTTTCGTCAT
GATGTCTGGTGAACGCAAAATGGAATTGGGTGTTTATTACCAGTTAGACG
GTTCATTGAACATCACCTTATATTCGCCTTACTGGCTTCTCAATAAAACT
GGAAAACCACTTGTCTATCAGCCAGCGGGGAGCAGCATCCAGCAAGTTCA
CCAAGAGAACGATGTAAATGCTCTTATGATGCTCGTCAAAGGGAAACATA
AAAAGgcgaaagtgaaagtgaaaaataGCGAGTCATGGTCAAATGAATTT
TCATTGGATACTGTTGGCAGTGGTGGTTCCTTGAAATGCAATGGTCCAAG
AGATCGAGTTTATGAGATTGGTTTGAACATCAGTTTGTCATACTTTGGAT
TGACGAAGATTGTGACGTTCACGCCACTCCGAATGTTATCTAACCACACC
AAGTACACCATCAGTATGGCAGAAAGTAATTCTAAATCGTCAGAATGGCA
CACGGTAAACCCTGACGAGaacattccatTCTGGCCGACGAAACTTCCTT
TGGTCAACCTTTACATTAACATCAATGGGCAAGATTCAGTGAAATTCAAC
CCTGAAGTTGGAAAAACTTTACTGTTGAAGTTCCAGAATGAGGTTGGAGG
AGTTTGCGTGGATTACCAAGAAAAGGACTCGTCCTCAGTCCTTTCGTTTA
ATCCGTACTTCGCAGGTGCAGCTCCTGTGCGGCttgaaaatctttgcaaa
aaGATCGGCATGATCGCTTATAAACAAGCAGGTTCGGTAATGGGTCACGT
GTTAACACATGACCAATCAGTGTTGTACACGTGGGATGATCCAACCATGG
AACAAGAATTGATTTGTTCCATTGTCAATGATGAAGCCAGTGAAACAAGG
ATCAAACTCGATGCCAACGATTTCGGACGAATGAGAGTTGGAGATGGTGC
AATTTATTGGGTTTCCTTTCTGGATGGTCTTCAACGTGTTCTATTGTTCA
CTGATAACTTCAAATCTGCTTACTGCGCATGTCAGgaGCAAAATTTACGC
CCAACCATGGAAGTTGACTTTGAGATTGAGAGTTTTGGTTTGTCTCTGGT
CAATGTTGATAAGAGAATGGAGATTGGCTACTTAGCTATCCGACAAAGCA
AGACTGTATGGGAGCAACGCAAGAAAAAGAACCGCTGGAAAGCTTTACCG
CTTGCCATGTGTGAAGCTCTCGAAGAAGGTTATCTCAATTATCAAAACAG
AAAAGGTGCAGTCAAAGAGAAAGTTCTGGATAAGGAGGTGGATTACGAGA
AGATGTTTATTACGAAACCTGAGAAGATTAAGATCAGAAGAACGTACCAC
AGCGGTCTTGGTTTCAAATACACAATCTCACCCAATGAAATGCGTGTGCA
TGCTTCTATCAGCTCAATACAGTTGGATAGCCATGTTCCAGGTTCGACCT
TTCCAACAGTCTTGCATATGGTTGAACCACCAAAATCTGTTGCTTCAGAA
AACGCTCCAAAGCCATTCTttgaattgagtttaatgaCAAGGATCGGTGA
TAAAAATGTGGTCAATGAAGTcagCTATTGTCACGTGTTGATTCAAGAGA
TGGATGTGAGGGTTGATATTGGATTTTTATTGGCTCTGATGGAACTCTTC
AGTCATGCAAGAGCTCGAACAACCGAGAAAGAACAATACGCGCTTGATAT
TGGCCAAGCAGCAACAAAGTTTGAAGAAAGCGCTGAATTTCAGGCAGCCA
AACAAGATCGATATTACGTTTTGAACGACTTTCATTTATCACCGCTAAAG
ATTCACGTCAGTTTCTCTTTGACGGGTGGTTCCAAAGATGAAAATGCTAT
TGCTTCATTACATGGTAACGTGTTGAACTTGTTGTTACAAAGTGTCGGAC
TGGCCTTCACTGAAATACAAGACGTACAATTCAAATTAGCATGTTACGAA
GTGCATAAGTCCATGCAGAGTAATTCGCAGCTCGGTGATGGAATAACTAA
ACATTATCAAACACAGGCTATCAAGCAACTTTATGTGTTGGTACTCGGGC
TAGACGTTCTTGGTAATCCGTATGGTTTGATATCTGGTGTTGGAACCGGA
GCAAAGAATTTCTTCTACGAACCTTACCAGGGATTAATTCAAGGACCAGA
AGAATTTGCGGAAGGATTGGCGTATGGGGTGAAGAGTCTTGTTGGTGGAA
CCGTGGGTGGAGTATCAGGAGCTGTGAGTAAGATTACCGGTACCTTCGGT
AAAGGTTTGGCTGCATTGACCTTGGATGAAGAATATCAACAAAAGAGACG
TGAAAACATGAGCCAACGCCCAACTAACCTCGGTGAAGGTCTCGCCAAAG
GTGGTAAAGGCCTTGTAAAGGGTATCGTGTCTGGTGTTACAGGGATCGTT
ACCAAACCCTATGAAGGTGCCAAGAATGATGGTGCAGGTGGCTTTTTTAA
GGGCGTTGGAAAAGGCCTGATTGGCGTGGTTGCACGCCCTGTTGGTGGAG
TGGTAGATATGGCCAGTAACACGTTTGATGGTTTGAAAAGCACGACATCT
GGCGTGAAAGCGATCGAGTTGAGCCGTGTTACTCGCGTCTTCCACGCAGA
TAAGGTTTTACGACCTTTCAATCTGTACGAAGCAGATGGAAACAAAATTC
TTATGCAATGTAACAAAGGAGAATACGCCAAGAAGAATTTTTATATCACT
CATGTAGTGGACAAGAAGAACTATCTCATCCTCACTCAATCaaacATTTT
GTATGTTGGAAAGAACGAGTTGAAAATGGGTGAATGGGAATCggtttggg
ttatcgagttcaATGAGCTAAAACGTGAACCAGAAGTGAAAGAGACAAAG
ATTATTTTCCATATCCATAATACGGACACGCGACGTTCAATTTTCAAGAA
ATCGACGAACACACGTGAAGTGATATTGGAGTCTAGTGCTGTTGCAGACT
GGTTTATCTTAAAGCTTAGAGATGCTAAAATGTTATAGatggtatttgaa
TCTTTGGTTGCTGACCTCTTGAACAAGTATCTGGGTCAATATGTGAAAAA
TCTTGATGCTTCTCAATTGAAGATTGGCATTTGGGGAGGAAATGTTGTCC
TGACAGAACTTGAACTGAAAGATACAGCTCTGGATGATCTTGACTTACCC
ATAAAAGTTGTTCGTGGATATTTGGgtAAATTGGTCTTGTCCATCCCATG
GAAAAATCTTTACACTGAATCAACTGTTGTCGATATTCAAGATCTCCACC
TTGTCGCTAAGCCTAATTTTGACATCAAATACAATGAAGAACgcgaagaa
aaatcaaaacatgacAAGAAACAACAACAGATTCACAATATCGAAGAAGC
GAGGCAAAGAGAAGAAGACAAAAAGAAAGGCGCCAAGAAAGAAGAGAGTG
ACGGTTTTGCTGAGAAACTTGCAACAAACGTCATAAAAAATCTACAGGTT
ACGATCAAGAACATACATGTTCGATATGAAGACTCAATCAGTGATGTGAA
TGGACCCTTTTCAGTCGGTCTTACAATGGAAAGTTTAACAGCACAAACCA
CAGATGAAGATTTTGTTCCAAAGATTATCAAAGAATCTGTCTCATTAATT
CATAAGatggTGAAATTAGACAATTTGGCTTTATATTGGAATCCAGGAGA
CGAACTGATTGATCCTTCACTTGATACCAAGCAATGGTTGgaagtTTCAA
CGAAGCAAATTTCAACACACCAATCGAAGCCAGAGAAAACGAAATATATT
TTGAGTCCCATGGTTGCAACGAAGAAATTGAAGCTGAACACCAAACCAGG
TTCCAACCTTGACATCCCGAAGatgttTTTGAACTTGGTTTTGGAAGAAC
TTGGTATCATCGTGGCAAGAAGTCAATATCATGGCGTGGTGCAACTGATT
GAATCATTTGAACGAATGAATAGGAACCAACCTTTTCGTAAATACAGACC
ACATACCTCCGTTCTTGGGAACGAAAGTATTTGGTGGAAGTACTGCATGT
CCAGCATACTGGAGGTGGATGTCAAAAGACGATCTCAAATGTGGAGCTGG
AAGCATATTCAAAAACATCGAGTTCTTTGCAAAGCTTACAAAGTGAAGTA
caaggaaaaattgaaacagaaaaATCCATCCAAACAAATTCTCACTGAAC
TAGAGaGCATGGAGGATGAGTTGAATATTGCAAGCATCACCATTTTTCGA
CAGCTTGCAGCTACAGAGGTTTTAACGGAACAAAAGAAGAAAGGCACTAA
AGGAAGTTTCTTCAGTTTCTTCTCCAGATCAAAAGAACCAGAAAAGTCTG
CTGCTAATAAAATTGGAGATTTAATGGGTGATGACCAGGAGAAGGAAATG
CAGAAATTGTATGACGCAATCGGTTATACTGAAAATGAAGTCATCACTCC
CTTTCCTAAAGAGTACGTGGCGATGTCAGTGGAATCGATTCTCCAGAAAT
TATTCATCAGCCTCATCGATGACACAGATAAGGCGAAAGAATTCAAAGTG
TTGGATTTTTCACTCAACAACATCATTGTAGAAGTTTTCCAAAGACCTTC
TGCTCAAGCTCTCAAATTATGTGCAAAGATAGGAGAGATGAAGTTATTTG
GTACAGCTTCTGCTCAATGTACACCTCtcatcatcaaaaacatgttaCAA
GGTCGAGGTATGGAATTTCTGCCGTTGGTGGACTTCATCTTTGAGACGAA
TCCTTTGAAGAAACCGGACATTGACCAATGTATCACTGCTATTTGTCAAC
CCTTAGAAATCATCTATGATGCTAACACGATCAACCATATCATTAGTTTC
TTCAAACCTCCTGAACATGTTATCTTGCAAGATTTACAAGACAAAGCGTA
TTCTACTTTCGAAGATTTTAAAGTTTCAAGTACGGCTGGTCTTCTACATG
CTATGGAACAAAGAACGGTTATGGACATCGACATTGATGTTGGAGCATCT
CATTTGATCATCCCTGAAAAAGGTTCTTACAATGGTTGTACAGATATGCT
GGTGATCGACTTTGGTAAAATCACGATGAGCAGCGATCCTAGTCAAATCA
GACACCTTGACCCTAAGGACATTGAGGATGTGAATGAAGTACAAAGCAAA
GCTTATGATCGATTCTTGTTGTCGCTTCAAGCTCTTCAAATATTACTCGT
TAGAGAAGGTGAAGATTTAAAGAGTGCTAAAAGCAACGTCAGTAAAGCTT
CATCACACATTTTGCATCCCATCAATTTCGATGGCAAACTTGCCAAAGCT
ATACTTCCACAAGATCCACGTTTAAAACAGATATGTGTCTCTGGTGAATT
ATCTTCGCTGTTTGTTTCTGTATCGGATGATAAAGTCAGTCGTCTCATCA
AGCTAGCAGACTCGATACCACTCCCTCAATCACCTTCTCACGATAACATC
GACGGAGAAGAAAAACCTGAAGGACTCTTCACCAAGGCGTTGTCAATGAT
AAGCTTGACAGGTGACAATGACACAGGGGTGGACATCGGAGGATTTTCCA
TCCCTGTACCGACATCTCCAACATCAGTGACGTCAGATGAAGATGAATAC
GGGACACCACCTGATGGCTCCATATTACAGTTACAACAAGAAGCTGGTCC
GGACTTTTCATCAGGAGTGGCGAACCAAGTCAAAGTGGACTTGAACTTTA
AAATCCATAAAGTGATGATCGCCATTGGTTTGACTGACAAAGCATTGAAA
CAGGAAAAAGAATGTCTGAAATTCATCGTGGACGACATCAATACAGAGgt
GATACTACGAAGATGGGATTTGTTCGTCAATGCAGAAGTTGGTCGTCTGG
TGTTGAATGAAATGACATGGGGTGTTGATGGAGAACCTTTCGCCATCATG
AGTACacccaaaaacaccaaaatgttGAAATTCAGCTATCGGAGGTGTGA
ATTCAACGAAAGTTTGAATCTCGGTCCAAGTTACTTTTATTCCAAAGAAG
CGCAAGTCAGAGCTTTACATTTCAAAGATGAATTTGGCGCCACGGATCAG
ATTTTAGATGTACAAGTGGCTACTTTATTTCTGATGCTTCATCAAGAAGC
ACTTTTGAGCATCATGTCATTGATCTACCAAGTACTGGAACCACTCAACA
AACATGATAAGGAAGCCACACAGAAGATCAAACGGAGTTTGAGTACGGCA
GGTAGTCGTTTGAGTCTCTCCatcgaagaaaaagaaaaggagaGACAGAT
ACAACGAAAATTAGCCAACCCTAAAGCACTGGAAGCTGCCAACGAACTTA
AGCAACAGGTTGGcttagaagaagaaaaaaagatgaGAGTGACCGCCCAC
CTGGATGGTGTTGGTATCATGATTTGTTCAGCCAAAGTTGACCTTGCACA
AGCCTTCGTTAAAGGGTTATCTGCTAAAGTACTGATGAAAGATGACTTAT
TAGAAGTGAAAGCCAGCATGAAAGATATGCAAGTACAAGATAATGTTGGC
GAAACAAAGTACAAAGACATCATTAGCATGCGATCTGATGAAGTGTTCGA
TTTAGAGTTGGCTATTTACGAGAATGGATCTTCTGGTAGCAAGCAATACG
ATATGTCGTGTGTCGACACCAGTGTCAAACTGAACTTCGGTCAAATGCGC
GTTGTTTTCTTGTATAGATTCATACAAGACTTAATGTCATTCACCGAAAA
CTTCGAAGAAGCACAGAAAGCAGTTGTGGAAGCTGGTAAAGCTGCCAAGG
ATAAAGCTCTGGAAACAGCGACCGATTTGAATAGACATTCTTCTCGTGTC
AAACTAAATGTGGTTCTGAAAGCACCGACTATTATCATTCCAGTTGGATC
AAACAATGAATTGGCTTTACTGGTGGATCTGGGTGAATTGCGTATTTACA
ACACATTCAAACTCCTCAACGATGATCAATACCATAAGAAATCTATCATC
ACTGATAACATGACCATTAAGTTATCCAATCTGAAATTGTTAAAAGCACT
TATTCAAGATGGTAAAGATTTCTTGCATCAACGAGCCATTATTGAACCTA
TGATGCTACAAATAACTATTGTTCGTAATTTAACGAAAGGTAACCATTCC
ATACCGGATGTTTCAGTTCAAGCAAAGATGCCAGCTATTCTGTTATCAAT
CAGTGAAGAAGATGTGACCGTAGCTCTAAAGATTGTCCAAGGGAATCTCG
CCGAAGGTGAGTCACATGCGCCGAAGAAGCAAGCCAAGCCTGCCAAACAA
ACGTTAAACGTGCCACAAGATCGTTTAGCAGACATTTACGAGGAGcctga
agatgaagatgagaaTCGACAAGGATATCTTCAAACCAAACTATCCTTCG
ATCTGGCTAAAATTGACATCAAGCTTTACTTGAAACCATCTGATATGACA
TTTGAAGATGAATTTTTAGCGAGGACGGATGATTTGTTGTTAGCTTTGTT
CACTATTGGTAACCTGTGTGTTGATGGAGACATCATGTCCACGCAAGCTA
TGAAGATGAGCGTTCGATTGGACACTTTGGTGTTGGATGATATGAGACCT
ATCGAGGAGCATGAAGGTGTTAAACGTATGATCAACTACAGTCCCGAGCC
ACTCCTTGAAGAAGTCAAAACCTCTTCTCATAAACGACCAATCGACAACT
CACGAATGATCGAAATCCAAttcgatcaaacttcatcgcaagataaaaat
atcgacATCAAACTTTGTAACATGCTTTGTATATTCAACGTTGAGTTTAT
CATGGTCCTGTTGAAAACGTTGCAAGCTGCCATACCTAAAGATGATAGTC
TGCAACATGGCCATTCAATGAGTAGTCTAGACTCGGCGGCAGGGTCTGGC
GGCAGCGATGACGAGGACTCTTTAGAAGCCAGCGAGATTGTCCTCTGCAC
TGGTGATCAAGAAAGACCTGAGACTAAAGTCTCTATCTTCGTCCATAACC
CGCAAATTGTTTTACTAGCAGATGCAAAGGATGTCAAAACAAATGCACTC
TTTCTTACAACCGagatcaattttcaatatttcgaaTTGCGAGATACTCA
AAAAATGATTGGCGCTGTTTCTAACACCGCTATTTTGTCAACTGCTTTCA
AGAATGACCATCGGAGTGATATATCAACAGTGTTGTCATTAGATTCCATC
AATCTCCACTCGTCATCACCCATCAATGGTAAACCTCATATGAGTGTCAG
CACAACTTTGATCAAACTGAATATCTCACCCAAAACCATCCGAACTTTAT
CAGCGTGTGCTGGTTACATCTCCAATGATCCAACAGATGAAGAAATCAAA
GAAGCTCGAAAAGCCATGCGTGATTTATGGCAAATTCAAACGTTCACCAA
TAAGCGACCGTGGTATTTAAACCACCCACCACAACAAGTCTTAAGTGCTG
GCAGCTTCGTCCTTGCGCGAACGAGAACAGGAGAATATAAGCATGGTTTC
TTAGCTAAAAAGGATGTCTCGTATCAAGTCTATTTTTCAGAGGAGCGAGG
AACAGCCAGTCACCGAGCCATGGATATCTCATCTGTTGTTTTGGATATCG
TACCGCTGATCGGTGATCTATGTGTTGGATGTAATGTTTTAGCTGTGGAA
TCGAAAGAACATGGATATCGTACTGGTCGAATTACTCAGGTTTGGGATTC
GAATGTGGATAAAGATTCTTCGGATGGCGCCAAACAATCTGTTTCTGTCA
AGACAACTGCTATTGCTCCAATCAAATACCTTGTCAATTTCTATGACAAC
CAAACGGAGAACTTCTTCCCGCCTGATGAACTTCGTATCATTGGTAAACC
CATCAAGGGGGTTGTCCCTGGACTAGGGGCGTGTGTTTACGCCCGCTTTA
ATGATGGTTTTTACTATCGGGGCAAAGTTGATGACATCGAGGATTATCGA
ATCCGAGTGCAATTGGATGAGATCAGTGGAGAAATCGAACACGACATCGA
TGATCCGTCAGCCGTTATTTTGAACCTGACGCCTCAATACCGTCAAGTCA
AAAAGCATTTCAAAGTCATTGCATCCAAAGGAAGCACAACTAAAGGATAT
CATCCGGGGAAAGTGACCGCCATCCAAGGTGAAGGAAATAACCGATTGTA
TTCGATACGCTTCGAAGACGGTACAATTAACCAAGTACCCATCacgaaat
tgattttgatgccAAAAGCACCTTTTGATGCTTTACCTGAAGTTGGCACA
TACGTTTATTCCCGAGTGTCACGCGACGCTCCTTTATACGAGAAGGGTAT
CGTAGCAGAGAAGAACACAATGATCTGCGTTAAACATTTAAATGGACGGA
AATTGGCTCACGAAATACAAAACATTCATTTTGTTGTCCGAAATATCGTT
CCTCTCGTGTCATCAttgaagGTTGGTTTGGACGTCATAGTGCAACCTGA
CAATGACGATCAGAAAATGTATTTGGCTGTCATTAGGGAAGTCACCAAAA
AAGAAGGTGACAAAACGAACCGTTATCTAGTGGAGTTTACGGATGGATCC
AAGAAGAGAGTGACGCCCAGCCGGATCCGTATACTTTCTCAATACGGAAG
TGCAGAAACGAGTGAAGAAAATGCTGACATTATCACAACAAGACAGGAGG
AACTAGTTCTCGATGTGCAAGGTATCTCATTACGTGTGGAAGGTTACTTG
GGAGGCGTGTTGACACCCATGCTCAAAATGGATTCCAAAATCACAGCTAA
CTTGAAGGATTGGTCAAGCCAAATGAATGCACACGCTACTGTATCATTAG
AAGCCAGTTATTATAACGAAAACGTTGCCGAATGGGAGCCAGTTATTGAA
CCTTTGATGGAGAAACGGAGGGAAAGACCGTGGCAACTCTCTGTCAATTA
CACGATGGAAGGTGACGACAATTCTGCTTCATCCACTTCCAACGAACTCG
TTTTACAAAAACCGGAATCCAACCTGAAAATCAAATCTCAAGATAATCTT
GAATTGACAATTTCAAAATCATGTCTTGCTTTACTCGGTGAATTGGGACA
GGTGTTTGGAGATGCAGTAGAATCTGTGGACGTTTTACCACAAGTCCTGG
TCGAAAAAGAACCTTTCATGATCGAAAACTTGCTCTCCAAGAAGGTGACA
GTAACATTGAATGAACTTCTGCAGGGACCAAATGGAGATTCGACAATCGA
GCTAGCATCTTCTTCGAATCCTGTTGGCATTACTTTTGCTCCCAagaaat
ttgagaaacgaaAGACCAACGATCTATACACAATCAATTTAtcgGTGGAC
GGTTTTCATGACATTAAAGACATTGTGGTTCAAAGAAAGCGAAGCGTTAT
CTATGATCTTGTACCAATAAAACTATTATCAGCACAGTCTTCATATTCGA
TAGTGGTACAAGTGAAGACAACAGACGGACAACGTATCATCGTACTCCGA
TCACCATTGCAGTTGAAAAATCACTTTCCAATGCCGTTGGATGTCAGCTA
CATTTCCAAAGAAAACCAACCAGTTAAACTGACAACAGTGGGATCGGGAG
ATATCTATTCCTTCCCTTTGTTGTTAACCTACCACAGTGTTTTTCATCTC
AAACCTGCTGGTTTCGACTACGGTGATTGCACAGAAGCTCTCAATTGGAG
TGATTTGAAGACGAGCAACGAAAAACAGTTCTCCTGCCCTTCACCTGACA
AAAGTGCTGACCCTTTCTACATGCAGGTGGTGATGAAAGAGGAGACGTAC
TCTTCCGTACACGGCATGTTGGACTGTGTACCACGTTACACGTTGGAGTG
CTTTCCCGTCATCACGCTGCATAATTACCTACCTTGCACTATTAATTATA
AGATCAAGGGTATGGCGAAATCGGAAAGTCTACCAGGCGGACACAATTGG
CCTTTGTTTACCGTCAACTTCAGTGATAAACCTTCCATCTATATCGAGAT
TGAGTCGTATAACAACCAAAGATGGGAAGGAGGTTTGACATTACCAACAA
AACCGGTAGATTCTTTGAACAAACCATCATTATCTTTCGTCATGATGTCT
GGTGAACGCAAAATGGAATTGGGTGTTTATTACCAGTTAGACGGTTCATT
GAACATCACCTTATATTCGCCTTACTGGCTTCTCAATAAAACTGGAAAAC
CACTTGTCTATCAGCCAGCGGGGAGCAGCATCCAGCAAGTTCACCAAGAG
AACGATGTAAATGCTCTTATGATGCTCGTCAAAGGGAAACATAAAAAGgc
gaaagtgaaagtgaaaaataGCGAGTCATGGTCAAATGAATTTTCATTGG
ATACTGTTGGCAGTGGTGGTTCCTTGAAATGCAATGGTCCAAGAGATCGA
GTTTATGAGATTGGTTTGAACATCAGTTTGTCATACTTTGGATTGACGAA
GATTGTGACGTTCACGCCACTCCGAATGTTATCTAACCACACCAAGTACA
CCATCAGTATGGCAGAAAGTAATTCTAAATCGTCAGAATGGCACACGGTA
AACCCTGACGAGaacattccatTCTGGCCGACGAAACTTCCTTTGGTCAA
CCTTTACATTAACATCAATGGGCAAGATTCAGTGAAATTCAACCCTGAAG
TTGGAAAAACTTTACTGTTGAAGTTCCAGAATGAGGTTGGAGGAGTTTGC
GTGGATTACCAAGAAAAGGACTCGTCCTCAGTCCTTTCGTTTAATCCGTA
CTTCGCAGGTGCAGCTCCTGTGCGGCttgaaaatctttgcaaaaaGATCG
GCATGATCGCTTATAAACAAGCAGGTTCGGTAATGGGTCACGTGTTAACA
CATGACCAATCAGTGTTGTACACGTGGGATGATCCAACCATGGAACAAGA
ATTGATTTGTTCCATTGTCAATGATGAAGCCAGTGAAACAAGGATCAAAC
TCGATGCCAACGATTTCGGACGAATGAGAGTTGGAGATGGTGCAATTTAT
TGGGTTTCCTTTCTGGATGGTCTTCAACGTGTTCTATTGTTCACTGATAA
CTTCAAATCTGCTTACTGCGCATGTCAGgaGCAAAATTTACGCCCAACCA
TGGAAGTTGACTTTGAGATTGAGAGTTTTGGTTTGTCTCTGGTCAATGTT
GATAAGAGAATGGAGATTGGCTACTTAGCTATCCGACAAAGCAAGACTGT
ATGGGAGCAACGCAAGAAAAAGAACCGCTGGAAAGCTTTACCGCTTGCCA
TGTGTGAAGCTCTCGAAGAAGGTTATCTCAATTATCAAAACAGAAAAGGT
GCAGTCAAAGAGAAAGTTCTGGATAAGGAGGTGGATTACGAGAAGATGTT
TATTACGAAACCTGAGAAGATTAAGATCAGAAGAACGTACCACAGCGGTC
TTGGTTTCAAATACACAATCTCACCCAATGAAATGCGTGTGCATGCTTCT
ATCAGCTCAATACAGTTGGATAGCCATGTTCCAGGTTCGACCTTTCCAAC
AGTCTTGCATATGGTTGAACCACCAAAATCTGTTGCTTCAGAAAACGCTC
CAAAGCCATTCTttgaattgagtttaatgaCAAGGATCGGTGATAAAAAT
GTGGTCAATGAAGTcagCTATTGTCACGTGTTGATTCAAGAGATGGATGT
GAGGGTTGATATTGGATTTTTATTGGCTCTGATGGAACTCTTCAGTCATG
CAAGAGCTCGAACAACCGAGAAAGAACAATACGCGCTTGATATTGGCCAA
GCAGCAACAAAGTTTGAAGAAAGCGCTGAATTTCAGGCAGCCAAACAAGA
TCGATATTACGTTTTGAACGACTTTCATTTATCACCGCTAAAGATTCACG
TCAGTTTCTCTTTGACGGGTGGTTCCAAAGATGAAAATGCTATTGCTTCA
TTACATGGTAACGTGTTGAACTTGTTGTTACAAAGTGTCGGACTGGCCTT
CACTGAAATACAAGACGTACAATTCAAATTAGCATGTTACGAAGTGCATA
AGTCCATGCAGAGTAATTCGCAGCTCGGTGATGGAATAACTAAACATTAT
CAAACACAGGCTATCAAGCAACTTTATGTGTTGGTACTCGGGCTAGACGT
TCTTGGTAATCCGTATGGTTTGATATCTGGTGTTGGAACCGGAGCAAAGA
ATTTCTTCTACGAACCTTACCAGGGATTAATTCAAGGACCAGAAGAATTT
GCGGAAGGATTGGCGTATGGGGTGAAGAGTCTTGTTGGTGGAACCGTGGG
TGGAGTATCAGGAGCTGTGAGTAAGATTACCGGTACCTTCGGTAAAGGTT
TGGCTGCATTGACCTTGGATGAAGAATATCAACAAAAGAGACGTGAAAAC
ATGAGCCAACGCCCAACTAACCTCGGTGAAGGTCTCGCCAAAGGTGGTAA
AGGCCTTGTAAAGGGTATCGTGTCTGGTGTTACAGGGATCGTTACCAAAC
CCTATGAAGGTGCCAAGAATGATGGTGCAGGTGGCTTTTTTAAGGGCGTT
GGAAAAGGCCTGATTGGCGTGGTTGCACGCCCTGTTGGTGGAGTGGTAGA
TATGGCCAGTAACACGTTTGATGGTTTGAAAAGCACGACATCTGGCGTGA
AAGCGATCGAGTTGAGCCGTGTTACTCGCGTCTTCCACGCAGATAAGGTT
TTACGACCTTTCAATCTGTACGAAGCAGATGGAAACAAAATTCTTATGCA
ATGTAACAAAGGAGAATACGCCAAGAAGAATTTTTATATCACTCATGTAG
TGGACAAGAAGAACTATCTCATCCTCACTCAATCaaacATTTTGTATGTT
GGAAAGAACGAGTTGAAAATGGGTGAATGGGAATCggtttgggttatcga
gttcaATGAGCTAAAACGTGAACCAGAAGTGAAAGAGACAAAGATTATTT
TCCATATCCATAATACGGACACGCGACGTTCAATTTTCAAGAAATCGACG
AACACACGTGAAGTGATATTGGAGTCTAGTGCTGTTGCAGACTGGTTTAT
CTTAAAGCTTAGAGATGCTAAAATGTTATAGatggtatttgaaTCTTTGG
TTGCTGACCTCTTGAACAAGTATCTGGGTCAATATGTGAAAAATCTTGAT
GCTTCTCAATTGAAGATTGGCATTTGGGGAGGAAATGTTGTCCTGACAGA
ACTTGAACTGAAAGATACAGCTCTGGATGATCTTGACTTACCCATAAAAG
TTGTTCGTGGATATTTGGgtAAATTGGTCTTGTCCATCCCATGGAAAAAT
CTTTACACTGAATCAACTGTTGTCGATATTCAAGATCTCCACCTTGTCGC
TAAGCCTAATTTTGACATCAAATACAATGAAGAACgcgaagaaaaatcaa
aacatgacAAGAAACAACAACAGATTCACAATATCGAAGAAGCGAGGCAA
AGAGAAGAAGACAAAAAGAAAGGCGCCAAGAAAGAAGAGAGTGACGGTTT
TGCTGAGAAACTTGCAACAAACGTCATAAAAAATCTACAGGTTACGATCA
AGAACATACATGTTCGATATGAAGACTCAATCAGTGATGTGAATGGACCC
TTTTCAGTCGGTCTTACAATGGAAAGTTTAACAGCACAAACCACAGATGA
AGATTTTGTTCCAAAGATTATCAAAGAATCTGTCTCATTAATTCATAAGa
tggTGAAATTAGACAATTTGGCTTTATATTGGAATCCAGGAGACGAACTG
ATTGATCCTTCACTTGATACCAAGCAATGGTTGgaagtTTCAACGAAGCA
AATTTCAACACACCAATCGAAGCCAGAGAAAACGAAATATATTTTGAGTC
CCATGGTTGCAACGAAGAAATTGAAGCTGAACACCAAACCAGGTTCCAAC
CTTGACATCCCGAAGatgttTTTGAACTTGGTTTTGGAAGAACTTGGTAT
CATCGTGGCAAGAAGTCAATATCATGGCGTGGTGCAACTGATTGAATCAT
TTGAACGAATGAATAGGAACCAACCTTTTCGTAAATACAGACCACATACC
TCCGTTCTTGGGAACGAAAGTATTTGGTGGAAGTACTGCATGTCCAGCAT
ACTGGAGGTGGATGTCAAAAGACGATCTCAAATGTGGAGCTGGAAGCATA
TTCAAAAACATCGAGTTCTTTGCAAAGCTTACAAAGTGAAGTAcaaggaa
aaattgaaacagaaaaATCCATCCAAACAAATTCTCACTGAACTAGAGaG
CATGGAGGATGAGTTGAATATTGCAAGCATCACCATTTTTCGACAGCTTG
CAGCTACAGAGGTTTTAACGGAACAAAAGAAGAAAGGCACTAAAGGAAGT
TTCTTCAGTTTCTTCTCCAGATCAAAAGAACCAGAAAAGTCTGCTGCTAA
TAAAATTGGAGATTTAATGGGTGATGACCAGGAGAAGGAAATGCAGAAAT
TGTATGACGCAATCGGTTATACTGAAAATGAAGTCATCACTCCCTTTCCT
AAAGAGTACGTGGCGATGTCAGTGGAATCGATTCTCCAGAAATTATTCAT
CAGCCTCATCGATGACACAGATAAGGCGAAAGAATTCAAAGTGTTGGATT
TTTCACTCAACAACATCATTGTAGAAGTTTTCCAAAGACCTTCTGCTCAA
GCTCTCAAATTATGTGCAAAGATAGGAGAGATGAAGTTATTTGGTACAGC
TTCTGCTCAATGTACACCTCtcatcatcaaaaacatgttaCAAGGTCGAG
GTATGGAATTTCTGCCGTTGGTGGACTTCATCTTTGAGACGAATCCTTTG
AAGAAACCGGACATTGACCAATGTATCACTGCTATTTGTCAACCCTTAGA
AATCATCTATGATGCTAACACGATCAACCATATCATTAGTTTCTTCAAAC
CTCCTGAACATGTTATCTTGCAAGATTTACAAGACAAAGCGTATTCTACT
TTCGAAGATTTTAAAGTTTCAAGTACGGCTGGTCTTCTACATGCTATGGA
ACAAAGAACGGTTATGGACATCGACATTGATGTTGGAGCATCTCATTTGA
TCATCCCTGAAAAAGGTTCTTACAATGGTTGTACAGATATGCTGGTGATC
GACTTTGGTAAAATCACGATGAGCAGCGATCCTAGTCAAATCAGACACCT
TGACCCTAAGGACATTGAGGATGTGAATGAAGTACAAAGCAAAGCTTATG
ATCGATTCTTGTTGTCGCTTCAAGCTCTTCAAATATTACTCGTTAGAGAA
GGTGAAGATTTAAAGAGTGCTAAAAGCAACGTCAGTAAAGCTTCATCACA
CATTTTGCATCCCATCAATTTCGATGGCAAACTTGCCAAAGCTATACTTC
CACAAGATCCACGTTTAAAACAGATATGTGTCTCTGGTGAATTATCTTCG
CTGTTTGTTTCTGTATCGGATGATAAAGTCAGTCGTCTCATCAAGCTAGC
AGACTCGATACCACTCCCTCAATCACCTTCTCACGATAACATCGACGGAG
AAGAAAAACCTGAAGGACTCTTCACCAAGGCGTTGTCAATGATAAGCTTG
ACAGGTGACAATGACACAGGGGTGGACATCGGAGGATTTTCCATCCCTGT
ACCGACATCTCCAACATCAGTGACGTCAGATGAAGATGAATACGGGACAC
CACCTGATGGCTCCATATTACAGTTACAACAAGAAGCTGGTCCGGACTTT
TCATCAGGAGTGGCGAACCAAGTCAAAGTGGACTTGAACTTTAAAATCCA
TAAAGTGATGATCGCCATTGGTTTGACTGACAAAGCATTGAAACAGGAAA
AAGAATGTCTGAAATTCATCGTGGACGACATCAATACAGAGgtGATACTA
CGAAGATGGGATTTGTTCGTCAATGCAGAAGTTGGTCGTCTGGTGTTGAA
TGAAATGACATGGGGTGTTGATGGAGAACCTTTCGCCATCATGAGTACac
ccaaaaacaccaaaatgttGAAATTCAGCTATCGGAGGTGTGAATTCAAC
GAAAGTTTGAATCTCGGTCCAAGTTACTTTTATTCCAAAGAAGCGCAAGT
CAGAGCTTTACATTTCAAAGATGAATTTGGCGCCACGGATCAGATTTTAG
ATGTACAAGTGGCTACTTTATTTCTGATGCTTCATCAAGAAGCACTTTTG
AGCATCATGTCATTGATCTACCAAGTACTGGAACCACTCAACAAACATGA
TAAGGAAGCCACACAGAAGATCAAACGGAGTTTGAGTACGGCAGGTAGTC
GTTTGAGTCTCTCCatcgaagaaaaagaaaaggagaGACAGATACAACGA
AAATTAGCCAACCCTAAAGCACTGGAAGCTGCCAACGAACTTAAGCAACA
GGTTGGcttagaagaagaaaaaaagatgaGAGTGACCGCCCACCTGGATG
GTGTTGGTATCATGATTTGTTCAGCCAAAGTTGACCTTGCACAAGCCTTC
GTTAAAGGGTTATCTGCTAAAGTACTGATGAAAGATGACTTATTAGAAGT
GAAAGCCAGCATGAAAGATATGCAAGTACAAGATAATGTTGGCGAAACAA
AGTACAAAGACATCATTAGCATGCGATCTGATGAAGTGTTCGATTTAGAG
TTGGCTATTTACGAGAATGGATCTTCTGGTAGCAAGCAATACGATATGTC
GTGTGTCGACACCAGTGTCAAACTGAACTTCGGTCAAATGCGCGTTGTTT
TCTTGTATAGATTCATACAAGACTTAATGTCATTCACCGAAAACTTCGAA
GAAGCACAGAAAGCAGTTGTGGAAGCTGGTAAAGCTGCCAAGGATAAAGC
TCTGGAAACAGCGACCGATTTGAATAGACATTCTTCTCGTGTCAAACTAA
ATGTGGTTCTGAAAGCACCGACTATTATCATTCCAGTTGGATCAAACAAT
GAATTGGCTTTACTGGTGGATCTGGGTGAATTGCGTATTTACAACACATT
CAAACTCCTCAACGATGATCAATACCATAAGAAATCTATCATCACTGATA
ACATGACCATTAAGTTATCCAATCTGAAATTGTTAAAAGCACTTATTCAA
GATGGTAAAGATTTCTTGCATCAACGAGCCATTATTGAACCTATGATGCT
ACAAATAACTATTGTTCGTAATTTAACGAAAGGTAACCATTCCATACCGG
ATGTTTCAGTTCAAGCAAAGATGCCAGCTATTCTGTTATCAATCAGTGAA
GAAGATGTGACCGTAGCTCTAAAGATTGTCCAAGGGAATCTCGCCGAAGG
TGAGTCACATGCGCCGAAGAAGCAAGCCAAGCCTGCCAAACAAACGTTAA
ACGTGCCACAAGATCGTTTAGCAGACATTTACGAGGAGcctgaagatgaa
gatgagaaTCGACAAGGATATCTTCAAACCAAACTATCCTTCGATCTGGC
TAAAATTGACATCAAGCTTTACTTGAAACCATCTGATATGACATTTGAAG
ATGAATTTTTAGCGAGGACGGATGATTTGTTGTTAGCTTTGTTCACTATT
GGTAACCTGTGTGTTGATGGAGACATCATGTCCACGCAAGCTATGAAGAT
GAGCGTTCGATTGGACACTTTGGTGTTGGATGATATGAGACCTATCGAGG
AGCATGAAGGTGTTAAACGTATGATCAACTACAGTCCCGAGCCACTCCTT
GAAGAAGTCAAAACCTCTTCTCATAAACGACCAATCGACAACTCACGAAT
GATCGAAATCCAAttcgatcaaacttcatcgcaagataaaaatatcgacA
TCAAACTTTGTAACATGCTTTGTATATTCAACGTTGAGTTTATCATGGTC
CTGTTGAAAACGTTGCAAGCTGCCATACCTAAAGATGATAGTCTGCAACA
TGGCCATTCAATGAGTAGTCTAGACTCGGCGGCAGGGTCTGGCGGCAGCG
ATGACGAGGACTCTTTAGAAGCCAGCGAGATTGTCCTCTGCACTGGTGAT
CAAGAAAGACCTGAGACTAAAGTCTCTATCTTCGTCCATAACCCGCAAAT
TGTTTTACTAGCAGATGCAAAGGATGTCAAAACAAATGCACTCTTTCTTA
CAACCGagatcaattttcaatatttcgaaTTGCGAGATACTCAAAAAATG
ATTGGCGCTGTTTCTAACACCGCTATTTTGTCAACTGCTTTCAAGAATGA
CCATCGGAGTGATATATCAACAGTGTTGTCATTAGATTCCATCAATCTCC
ACTCGTCATCACCCATCAATGGTAAACCTCATATGAGTGTCAGCACAACT
TTGATCAAACTGAATATCTCACCCAAAACCATCCGAACTTTATCAGCGTG
TGCTGGTTACATCTCCAATGATCCAACAGATGAAGAAATCAAAGAAGCTC
GAAAAGCCATGCGTGATTTATGGCAAATTCAAACGTTCACCAATAAGCGA
CCGTGGTATTTAAACCACCCACCACAACAAGTCTTAAGTGCTGGCAGCTT
CGTCCTTGCGCGAACGAGAACAGGAGAATATAAGCATGGTTTCTTAGCTA
AAAAGGATGTCTCGTATCAAGTCTATTTTTCAGAGGAGCGAGGAACAGCC
AGTCACCGAGCCATGGATATCTCATCTGTTGTTTTGGATATCGTACCGCT
GATCGGTGATCTATGTGTTGGATGTAATGTTTTAGCTGTGGAATCGAAAG
AACATGGATATCGTACTGGTCGAATTACTCAGGTTTGGGATTCGAATGTG
GATAAAGATTCTTCGGATGGCGCCAAACAATCTGTTTCTGTCAAGACAAC
TGCTATTGCTCCAATCAAATACCTTGTCAATTTCTATGACAACCAAACGG
AGAACTTCTTCCCGCCTGATGAACTTCGTATCATTGGTAAACCCATCAAG
GGGGTTGTCCCTGGACTAGGGGCGTGTGTTTACGCCCGCTTTAATGATGG
TTTTTACTATCGGGGCAAAGTTGATGACATCGAGGATTATCGAATCCGAG
TGCAATTGGATGAGATCAGTGGAGAAATCGAACACGACATCGATGATCCG
TCAGCCGTTATTTTGAACCTGACGCCTCAATACCGTCAAGTCAAAAAGCA
TTTCAAAGTCATTGCATCCAAAGGAAGCACAACTAAAGGATATCATCCGG
GGAAAGTGACCGCCATCCAAGGTGAAGGAAATAACCGATTGTATTCGATA
CGCTTCGAAGACGGTACAATTAACCAAGTACCCATCacgaaattgatttt
gatgccAAAAGCACCTTTTGATGCTTTACCTGAAGTTGGCACATACGTTT
ATTCCCGAGTGTCACGCGACGCTCCTTTATACGAGAAGGGTATCGTAGCA
GAGAAGAACACAATGATCTGCGTTAAACATTTAAATGGACGGAAATTGGC
TCACGAAATACAAAACATTCATTTTGTTGTCCGAAATATCGTTCCTCTCG
TGTCATCAttgaagGTTGGTTTGGACGTCATAGTGCAACCTGACAATGAC
GATCAGAAAATGTATTTGGCTGTCATTAGGGAAGTCACCAAAAAAGAAGG
TGACAAAACGAACCGTTATCTAGTGGAGTTTACGGATGGATCCAAGAAGA
GAGTGACGCCCAGCCGGATCCGTATACTTTCTCAATACGGAAGTGCAGAA
ACGAGTGAAGAAAATGCTGACATTATCACAACAAGACAGGAGGAACTAGT
TCTCGATGTGCAAGGTATCTCATTACGTGTGGAAGGTTACTTGGGAGGCG
TGTTGACACCCATGCTCAAAATGGATTCCAAAATCACAGCTAACTTGAAG
GATTGGTCAAGCCAAATGAATGCACACGCTACTGTATCATTAGAAGCCAG
TTATTATAACGAAAACGTTGCCGAATGGGAGCCAGTTATTGAACCTTTGA
TGGAGAAACGGAGGGAAAGACCGTGGCAACTCTCTGTCAATTACACGATG
GAAGGTGACGACAATTCTGCTTCATCCACTTCCAACGAACTCGTTTTACA
AAAACCGGAATCCAACCTGAAAATCAAATCTCAAGATAATCTTGAATTGA
CAATTTCAAAATCATGTCTTGCTTTACTCGGTGAATTGGGACAGGTGTTT
GGAGATGCAGTAGAATCTGTGGACGTTTTACCACAAGTCCTGGTCGAAAA
AGAACCTTTCATGATCGAAAACTTGCTCTCCAAGAAGGTGACAGTAACAT
TGAATGAACTTCTGCAGGGACCAAATGGAGATTCGACAATCGAGCTAGCA
TCTTCTTCGAATCCTGTTGGCATTACTTTTGCTCCCAagaaatttgagaa
acgaaAGACCAACGATCTATACACAATCAATTTAtcgGTGGACGGTTTTC
ATGACATTAAAGACATTGTGGTTCAAAGAAAGCGAAGCGTTATCTATGAT
CTTGTACCAATAAAACTATTATCAGCACAGTCTTCATATTCGATAGTGGT
ACAAGTGAAGACAACAGACGGACAACGTATCATCGTACTCCGATCACCAT
TGCAGTTGAAAAATCACTTTCCAATGCCGTTGGATGTCAGCTACATTTCC
AAAGAAAACCAACCAGTTAAACTGACAACAGTGGGATCGGGAGATATCTA
TTCCTTCCCTTTGTTGTTAACCTACCACAGTGTTTTTCATCTCAAACCTG
CTGGTTTCGACTACGGTGATTGCACAGAAGCTCTCAATTGGAGTGATTTG
AAGACGAGCAACGAAAAACAGTTCTCCTGCCCTTCACCTGACAAAAGTGC
TGACCCTTTCTACATGCAGGTGGTGATGAAAGAGGAGACGTACTCTTCCG
TACACGGCATGTTGGACTGTGTACCACGTTACACGTTGGAGTGCTTTCCC
GTCATCACGCTGCATAATTACCTACCTTGCACTATTAATTATAAGATCAA
GGGTATGGCGAAATCGGAAAGTCTACCAGGCGGACACAATTGGCCTTTGT
TTACCGTCAACTTCAGTGATAAACCTTCCATCTATATCGAGATTGAGTCG
TATAACAACCAAAGATGGGAAGGAGGTTTGACATTACCAACAAAACCGGT
AGATTCTTTGAACAAACCATCATTATCTTTCGTCATGATGTCTGGTGAAC
GCAAAATGGAATTGGGTGTTTATTACCAGTTAGACGGTTCATTGAACATC
ACCTTATATTCGCCTTACTGGCTTCTCAATAAAACTGGAAAACCACTTGT
CTATCAGCCAGCGGGGAGCAGCATCCAGCAAGTTCACCAAGAGAACGATG
TAAATGCTCTTATGATGCTCGTCAAAGGGAAACATAAAAAGgcgaaagtg
aaagtgaaaaataGCGAGTCATGGTCAAATGAATTTTCATTGGATACTGT
TGGCAGTGGTGGTTCCTTGAAATGCAATGGTCCAAGAGATCGAGTTTATG
AGATTGGTTTGAACATCAGTTTGTCATACTTTGGATTGACGAAGATTGTG
ACGTTCACGCCACTCCGAATGTTATCTAACCACACCAAGTACACCATCAG
TATGGCAGAAAGTAATTCTAAATCGTCAGAATGGCACACGGTAAACCCTG
ACGAGaacattccatTCTGGCCGACGAAACTTCCTTTGGTCAACCTTTAC
ATTAACATCAATGGGCAAGATTCAGTGAAATTCAACCCTGAAGTTGGAAA
AACTTTACTGTTGAAGTTCCAGAATGAGGTTGGAGGAGTTTGCGTGGATT
ACCAAGAAAAGGACTCGTCCTCAGTCCTTTCGTTTAATCCGTACTTCGCA
GGTGCAGCTCCTGTGCGGCttgaaaatctttgcaaaaaGATCGGCATGAT
CGCTTATAAACAAGCAGGTTCGGTAATGGGTCACGTGTTAACACATGACC
AATCAGTGTTGTACACGTGGGATGATCCAACCATGGAACAAGAATTGATT
TGTTCCATTGTCAATGATGAAGCCAGTGAAACAAGGATCAAACTCGATGC
CAACGATTTCGGACGAATGAGAGTTGGAGATGGTGCAATTTATTGGGTTT
CCTTTCTGGATGGTCTTCAACGTGTTCTATTGTTCACTGATAACTTCAAA
TCTGCTTACTGCGCATGTCAGgaGCAAAATTTACGCCCAACCATGGAAGT
TGACTTTGAGATTGAGAGTTTTGGTTTGTCTCTGGTCAATGTTGATAAGA
GAATGGAGATTGGCTACTTAGCTATCCGACAAAGCAAGACTGTATGGGAG
CAACGCAAGAAAAAGAACCGCTGGAAAGCTTTACCGCTTGCCATGTGTGA
AGCTCTCGAAGAAGGTTATCTCAATTATCAAAACAGAAAAGGTGCAGTCA
AAGAGAAAGTTCTGGATAAGGAGGTGGATTACGAGAAGATGTTTATTACG
AAACCTGAGAAGATTAAGATCAGAAGAACGTACCACAGCGGTCTTGGTTT
CAAATACACAATCTCACCCAATGAAATGCGTGTGCATGCTTCTATCAGCT
CAATACAGTTGGATAGCCATGTTCCAGGTTCGACCTTTCCAACAGTCTTG
CATATGGTTGAACCACCAAAATCTGTTGCTTCAGAAAACGCTCCAAAGCC
ATTCTttgaattgagtttaatgaCAAGGATCGGTGATAAAAATGTGGTCA
ATGAAGTcagCTATTGTCACGTGTTGATTCAAGAGATGGATGTGAGGGTT
GATATTGGATTTTTATTGGCTCTGATGGAACTCTTCAGTCATGCAAGAGC
TCGAACAACCGAGAAAGAACAATACGCGCTTGATATTGGCCAAGCAGCAA
CAAAGTTTGAAGAAAGCGCTGAATTTCAGGCAGCCAAACAAGATCGATAT
TACGTTTTGAACGACTTTCATTTATCACCGCTAAAGATTCACGTCAGTTT
CTCTTTGACGGGTGGTTCCAAAGATGAAAATGCTATTGCTTCATTACATG
GTAACGTGTTGAACTTGTTGTTACAAAGTGTCGGACTGGCCTTCACTGAA
ATACAAGACGTACAATTCAAATTAGCATGTTACGAAGTGCATAAGTCCAT
GCAGAGTAATTCGCAGCTCGGTGATGGAATAACTAAACATTATCAAACAC
AGGCTATCAAGCAACTTTATGTGTTGGTACTCGGGCTAGACGTTCTTGGT
AATCCGTATGGTTTGATATCTGGTGTTGGAACCGGAGCAAAGAATTTCTT
CTACGAACCTTACCAGGGATTAATTCAAGGACCAGAAGAATTTGCGGAAG
GATTGGCGTATGGGGTGAAGAGTCTTGTTGGTGGAACCGTGGGTGGAGTA
TCAGGAGCTGTGAGTAAGATTACCGGTACCTTCGGTAAAGGTTTGGCTGC
ATTGACCTTGGATGAAGAATATCAACAAAAGAGACGTGAAAACATGAGCC
AACGCCCAACTAACCTCGGTGAAGGTCTCGCCAAAGGTGGTAAAGGCCTT
GTAAAGGGTATCGTGTCTGGTGTTACAGGGATCGTTACCAAACCCTATGA
AGGTGCCAAGAATGATGGTGCAGGTGGCTTTTTTAAGGGCGTTGGAAAAG
GCCTGATTGGCGTGGTTGCACGCCCTGTTGGTGGAGTGGTAGATATGGCC
AGTAACACGTTTGATGGTTTGAAAAGCACGACATCTGGCGTGAAAGCGAT
CGAGTTGAGCCGTGTTACTCGCGTCTTCCACGCAGATAAGGTTTTACGAC
CTTTCAATCTGTACGAAGCAGATGGAAACAAAATTCTTATGCAATGTAAC
AAAGGAGAATACGCCAAGAAGAATTTTTATATCACTCATGTAGTGGACAA
GAAGAACTATCTCATCCTCACTCAATCaaacATTTTGTATGTTGGAAAGA
ACGAGTTGAAAATGGGTGAATGGGAATCggtttgggttatcgagttcaAT
GAGCTAAAACGTGAACCAGAAGTGAAAGAGACAAAGATTATTTTCCATAT
CCATAATACGGACACGCGACGTTCAATTTTCAAGAAATCGACGAACACAC
GTGAAGTGATATTGGAGTCTAGTGCTGTTGCAGACTGGTTTATCTTAAAG
CTTAGAGATGCTAAAATGTTATAGatggtatttgaaTCTTTGGTTGCTGA
CCTCTTGAACAAGTATCTGGGTCAATATGTGAAAAATCTTGATGCTTCTC
AATTGAAGATTGGCATTTGGGGAGGAAATGTTGTCCTGACAGAACTTGAA
CTGAAAGATACAGCTCTGGATGATCTTGACTTACCCATAAAAGTTGTTCG
TGGATATTTGGgtAAATTGGTCTTGTCCATCCCATGGAAAAATCTTTACA
CTGAATCAACTGTTGTCGATATTCAAGATCTCCACCTTGTCGCTAAGCCT
AATTTTGACATCAAATACAATGAAGAACgcgaagaaaaatcaaaacatga
cAAGAAACAACAACAGATTCACAATATCGAAGAAGCGAGGCAAAGAGAAG
AAGACAAAAAGAAAGGCGCCAAGAAAGAAGAGAGTGACGGTTTTGCTGAG
AAACTTGCAACAAACGTCATAAAAAATCTACAGGTTACGATCAAGAACAT
ACATGTTCGATATGAAGACTCAATCAGTGATGTGAATGGACCCTTTTCAG
TCGGTCTTACAATGGAAAGTTTAACAGCACAAACCACAGATGAAGATTTT
GTTCCAAAGATTATCAAAGAATCTGTCTCATTAATTCATAAGatggTGAA
ATTAGACAATTTGGCTTTATATTGGAATCCAGGAGACGAACTGATTGATC
CTTCACTTGATACCAAGCAATGGTTGgaagtTTCAACGAAGCAAATTTCA
ACACACCAATCGAAGCCAGAGAAAACGAAATATATTTTGAGTCCCATGGT
TGCAACGAAGAAATTGAAGCTGAACACCAAACCAGGTTCCAACCTTGACA
TCCCGAAGatgttTTTGAACTTGGTTTTGGAAGAACTTGGTATCATCGTG
GCAAGAAGTCAATATCATGGCGTGGTGCAACTGATTGAATCATTTGAACG
AATGAATAGGAACCAACCTTTTCGTAAATACAGACCACATACCTCCGTTC
TTGGGAACGAAAGTATTTGGTGGAAGTACTGCATGTCCAGCATACTGGAG
GTGGATGTCAAAAGACGATCTCAAATGTGGAGCTGGAAGCATATTCAAAA
ACATCGAGTTCTTTGCAAAGCTTACAAAGTGAAGTAcaaggaaaaattga
aacagaaaaATCCATCCAAACAAATTCTCACTGAACTAGAGaGCATGGAG
GATGAGTTGAATATTGCAAGCATCACCATTTTTCGACAGCTTGCAGCTAC
AGAGGTTTTAACGGAACAAAAGAAGAAAGGCACTAAAGGAAGTTTCTTCA
GTTTCTTCTCCAGATCAAAAGAACCAGAAAAGTCTGCTGCTAATAAAATT
GGAGATTTAATGGGTGATGACCAGGAGAAGGAAATGCAGAAATTGTATGA
CGCAATCGGTTATACTGAAAATGAAGTCATCACTCCCTTTCCTAAAGAGT
ACGTGGCGATGTCAGTGGAATCGATTCTCCAGAAATTATTCATCAGCCTC
ATCGATGACACAGATAAGGCGAAAGAATTCAAAGTGTTGGATTTTTCACT
CAACAACATCATTGTAGAAGTTTTCCAAAGACCTTCTGCTCAAGCTCTCA
AATTATGTGCAAAGATAGGAGAGATGAAGTTATTTGGTACAGCTTCTGCT
CAATGTACACCTCtcatcatcaaaaacatgttaCAAGGTCGAGGTATGGA
ATTTCTGCCGTTGGTGGACTTCATCTTTGAGACGAATCCTTTGAAGAAAC
CGGACATTGACCAATGTATCACTGCTATTTGTCAACCCTTAGAAATCATC
TATGATGCTAACACGATCAACCATATCATTAGTTTCTTCAAACCTCCTGA
ACATGTTATCTTGCAAGATTTACAAGACAAAGCGTATTCTACTTTCGAAG
ATTTTAAAGTTTCAAGTACGGCTGGTCTTCTACATGCTATGGAACAAAGA
ACGGTTATGGACATCGACATTGATGTTGGAGCATCTCATTTGATCATCCC
TGAAAAAGGTTCTTACAATGGTTGTACAGATATGCTGGTGATCGACTTTG
GTAAAATCACGATGAGCAGCGATCCTAGTCAAATCAGACACCTTGACCCT
AAGGACATTGAGGATGTGAATGAAGTACAAAGCAAAGCTTATGATCGATT
CTTGTTGTCGCTTCAAGCTCTTCAAATATTACTCGTTAGAGAAGGTGAAG
ATTTAAAGAGTGCTAAAAGCAACGTCAGTAAAGCTTCATCACACATTTTG
CATCCCATCAATTTCGATGGCAAACTTGCCAAAGCTATACTTCCACAAGA
TCCACGTTTAAAACAGATATGTGTCTCTGGTGAATTATCTTCGCTGTTTG
TTTCTGTATCGGATGATAAAGTCAGTCGTCTCATCAAGCTAGCAGACTCG
ATACCACTCCCTCAATCACCTTCTCACGATAACATCGACGGAGAAGAAAA
ACCTGAAGGACTCTTCACCAAGGCGTTGTCAATGATAAGCTTGACAGGTG
ACAATGACACAGGGGTGGACATCGGAGGATTTTCCATCCCTGTACCGACA
TCTCCAACATCAGTGACGTCAGATGAAGATGAATACGGGACACCACCTGA
TGGCTCCATATTACAGTTACAACAAGAAGCTGGTCCGGACTTTTCATCAG
GAGTGGCGAACCAAGTCAAAGTGGACTTGAACTTTAAAATCCATAAAGTG
ATGATCGCCATTGGTTTGACTGACAAAGCATTGAAACAGGAAAAAGAATG
TCTGAAATTCATCGTGGACGACATCAATACAGAGgtGATACTACGAAGAT
GGGATTTGTTCGTCAATGCAGAAGTTGGTCGTCTGGTGTTGAATGAAATG
ACATGGGGTGTTGATGGAGAACCTTTCGCCATCATGAGTACacccaaaaa
caccaaaatgttGAAATTCAGCTATCGGAGGTGTGAATTCAACGAAAGTT
TGAATCTCGGTCCAAGTTACTTTTATTCCAAAGAAGCGCAAGTCAGAGCT
TTACATTTCAAAGATGAATTTGGCGCCACGGATCAGATTTTAGATGTACA
AGTGGCTACTTTATTTCTGATGCTTCATCAAGAAGCACTTTTGAGCATCA
TGTCATTGATCTACCAAGTACTGGAACCACTCAACAAACATGATAAGGAA
GCCACACAGAAGATCAAACGGAGTTTGAGTACGGCAGGTAGTCGTTTGAG
TCTCTCCatcgaagaaaaagaaaaggagaGACAGATACAACGAAAATTAG
CCAACCCTAAAGCACTGGAAGCTGCCAACGAACTTAAGCAACAGGTTGGc
ttagaagaagaaaaaaagatgaGAGTGACCGCCCACCTGGATGGTGTTGG
TATCATGATTTGTTCAGCCAAAGTTGACCTTGCACAAGCCTTCGTTAAAG
GGTTATCTGCTAAAGTACTGATGAAAGATGACTTATTAGAAGTGAAAGCC
AGCATGAAAGATATGCAAGTACAAGATAATGTTGGCGAAACAAAGTACAA
AGACATCATTAGCATGCGATCTGATGAAGTGTTCGATTTAGAGTTGGCTA
TTTACGAGAATGGATCTTCTGGTAGCAAGCAATACGATATGTCGTGTGTC
GACACCAGTGTCAAACTGAACTTCGGTCAAATGCGCGTTGTTTTCTTGTA
TAGATTCATACAAGACTTAATGTCATTCACCGAAAACTTCGAAGAAGCAC
AGAAAGCAGTTGTGGAAGCTGGTAAAGCTGCCAAGGATAAAGCTCTGGAA
ACAGCGACCGATTTGAATAGACATTCTTCTCGTGTCAAACTAAATGTGGT
TCTGAAAGCACCGACTATTATCATTCCAGTTGGATCAAACAATGAATTGG
CTTTACTGGTGGATCTGGGTGAATTGCGTATTTACAACACATTCAAACTC
CTCAACGATGATCAATACCATAAGAAATCTATCATCACTGATAACATGAC
CATTAAGTTATCCAATCTGAAATTGTTAAAAGCACTTATTCAAGATGGTA
AAGATTTCTTGCATCAACGAGCCATTATTGAACCTATGATGCTACAAATA
ACTATTGTTCGTAATTTAACGAAAGGTAACCATTCCATACCGGATGTTTC
AGTTCAAGCAAAGATGCCAGCTATTCTGTTATCAATCAGTGAAGAAGATG
TGACCGTAGCTCTAAAGATTGTCCAAGGGAATCTCGCCGAAGGTGAGTCA
CATGCGCCGAAGAAGCAAGCCAAGCCTGCCAAACAAACGTTAAACGTGCC
ACAAGATCGTTTAGCAGACATTTACGAGGAGcctgaagatgaagatgaga
aTCGACAAGGATATCTTCAAACCAAACTATCCTTCGATCTGGCTAAAATT
GACATCAAGCTTTACTTGAAACCATCTGATATGACATTTGAAGATGAATT
TTTAGCGAGGACGGATGATTTGTTGTTAGCTTTGTTCACTATTGGTAACC
TGTGTGTTGATGGAGACATCATGTCCACGCAAGCTATGAAGATGAGCGTT
CGATTGGACACTTTGGTGTTGGATGATATGAGACCTATCGAGGAGCATGA
AGGTGTTAAACGTATGATCAACTACAGTCCCGAGCCACTCCTTGAAGAAG
TCAAAACCTCTTCTCATAAACGACCAATCGACAACTCACGAATGATCGAA
ATCCAAttcgatcaaacttcatcgcaagataaaaatatcgacATCAAACT
TTGTAACATGCTTTGTATATTCAACGTTGAGTTTATCATGGTCCTGTTGA
AAACGTTGCAAGCTGCCATACCTAAAGATGATAGTCTGCAACATGGCCAT
TCAATGAGTAGTCTAGACTCGGCGGCAGGGTCTGGCGGCAGCGATGACGA
GGACTCTTTAGAAGCCAGCGAGATTGTCCTCTGCACTGGTGATCAAGAAA
GACCTGAGACTAAAGTCTCTATCTTCGTCCATAACCCGCAAATTGTTTTA
CTAGCAGATGCAAAGGATGTCAAAACAAATGCACTCTTTCTTACAACCGa
gatcaattttcaatatttcgaaTTGCGAGATACTCAAAAAATGATTGGCG
CTGTTTCTAACACCGCTATTTTGTCAACTGCTTTCAAGAATGACCATCGG
AGTGATATATCAACAGTGTTGTCATTAGATTCCATCAATCTCCACTCGTC
ATCACCCATCAATGGTAAACCTCATATGAGTGTCAGCACAACTTTGATCA
AACTGAATATCTCACCCAAAACCATCCGAACTTTATCAGCGTGTGCTGGT
TACATCTCCAATGATCCAACAGATGAAGAAATCAAAGAAGCTCGAAAAGC
CATGCGTGATTTATGGCAAATTCAAACGTTCACCAATAAGCGACCGTGGT
ATTTAAACCACCCACCACAACAAGTCTTAAGTGCTGGCAGCTTCGTCCTT
GCGCGAACGAGAACAGGAGAATATAAGCATGGTTTCTTAGCTAAAAAGGA
TGTCTCGTATCAAGTCTATTTTTCAGAGGAGCGAGGAACAGCCAGTCACC
GAGCCATGGATATCTCATCTGTTGTTTTGGATATCGTACCGCTGATCGGT
GATCTATGTGTTGGATGTAATGTTTTAGCTGTGGAATCGAAAGAACATGG
ATATCGTACTGGTCGAATTACTCAGGTTTGGGATTCGAATGTGGATAAAG
ATTCTTCGGATGGCGCCAAACAATCTGTTTCTGTCAAGACAACTGCTATT
GCTCCAATCAAATACCTTGTCAATTTCTATGACAACCAAACGGAGAACTT
CTTCCCGCCTGATGAACTTCGTATCATTGGTAAACCCATCAAGGGGGTTG
TCCCTGGACTAGGGGCGTGTGTTTACGCCCGCTTTAATGATGGTTTTTAC
TATCGGGGCAAAGTTGATGACATCGAGGATTATCGAATCCGAGTGCAATT
GGATGAGATCAGTGGAGAAATCGAACACGACATCGATGATCCGTCAGCCG
TTATTTTGAACCTGACGCCTCAATACCGTCAAGTCAAAAAGCATTTCAAA
GTCATTGCATCCAAAGGAAGCACAACTAAAGGATATCATCCGGGGAAAGT
GACCGCCATCCAAGGTGAAGGAAATAACCGATTGTATTCGATACGCTTCG
AAGACGGTACAATTAACCAAGTACCCATCacgaaattgattttgatgccA
AAAGCACCTTTTGATGCTTTACCTGAAGTTGGCACATACGTTTATTCCCG
AGTGTCACGCGACGCTCCTTTATACGAGAAGGGTATCGTAGCAGAGAAGA
ACACAATGATCTGCGTTAAACATTTAAATGGACGGAAATTGGCTCACGAA
ATACAAAACATTCATTTTGTTGTCCGAAATATCGTTCCTCTCGTGTCATC
AttgaagGTTGGTTTGGACGTCATAGTGCAACCTGACAATGACGATCAGA
AAATGTATTTGGCTGTCATTAGGGAAGTCACCAAAAAAGAAGGTGACAAA
ACGAACCGTTATCTAGTGGAGTTTACGGATGGATCCAAGAAGAGAGTGAC
GCCCAGCCGGATCCGTATACTTTCTCAATACGGAAGTGCAGAAACGAGTG
AAGAAAATGCTGACATTATCACAACAAGACAGGAGGAACTAGTTCTCGAT
GTGCAAGGTATCTCATTACGTGTGGAAGGTTACTTGGGAGGCGTGTTGAC
ACCCATGCTCAAAATGGATTCCAAAATCACAGCTAACTTGAAGGATTGGT
CAAGCCAAATGAATGCACACGCTACTGTATCATTAGAAGCCAGTTATTAT
AACGAAAACGTTGCCGAATGGGAGCCAGTTATTGAACCTTTGATGGAGAA
ACGGAGGGAAAGACCGTGGCAACTCTCTGTCAATTACACGATGGAAGGTG
ACGACAATTCTGCTTCATCCACTTCCAACGAACTCGTTTTACAAAAACCG
GAATCCAACCTGAAAATCAAATCTCAAGATAATCTTGAATTGACAATTTC
AAAATCATGTCTTGCTTTACTCGGTGAATTGGGACAGGTGTTTGGAGATG
CAGTAGAATCTGTGGACGTTTTACCACAAGTCCTGGTCGAAAAAGAACCT
TTCATGATCGAAAACTTGCTCTCCAAGAAGGTGACAGTAACATTGAATGA
ACTTCTGCAGGGACCAAATGGAGATTCGACAATCGAGCTAGCATCTTCTT
CGAATCCTGTTGGCATTACTTTTGCTCCCAagaaatttgagaaacgaaAG
ACCAACGATCTATACACAATCAATTTAtcgGTGGACGGTTTTCATGACAT
TAAAGACATTGTGGTTCAAAGAAAGCGAAGCGTTATCTATGATCTTGTAC
CAATAAAACTATTATCAGCACAGTCTTCATATTCGATAGTGGTACAAGTG
AAGACAACAGACGGACAACGTATCATCGTACTCCGATCACCATTGCAGTT
GAAAAATCACTTTCCAATGCCGTTGGATGTCAGCTACATTTCCAAAGAAA
ACCAACCAGTTAAACTGACAACAGTGGGATCGGGAGATATCTATTCCTTC
CCTTTGTTGTTAACCTACCACAGTGTTTTTCATCTCAAACCTGCTGGTTT
CGACTACGGTGATTGCACAGAAGCTCTCAATTGGAGTGATTTGAAGACGA
GCAACGAAAAACAGTTCTCCTGCCCTTCACCTGACAAAAGTGCTGACCCT
TTCTACATGCAGGTGGTGATGAAAGAGGAGACGTACTCTTCCGTACACGG
CATGTTGGACTGTGTACCACGTTACACGTTGGAGTGCTTTCCCGTCATCA
CGCTGCATAATTACCTACCTTGCACTATTAATTATAAGATCAAGGGTATG
GCGAAATCGGAAAGTCTACCAGGCGGACACAATTGGCCTTTGTTTACCGT
CAACTTCAGTGATAAACCTTCCATCTATATCGAGATTGAGTCGTATAACA
ACCAAAGATGGGAAGGAGGTTTGACATTACCAACAAAACCGGTAGATTCT
TTGAACAAACCATCATTATCTTTCGTCATGATGTCTGGTGAACGCAAAAT
GGAATTGGGTGTTTATTACCAGTTAGACGGTTCATTGAACATCACCTTAT
ATTCGCCTTACTGGCTTCTCAATAAAACTGGAAAACCACTTGTCTATCAG
CCAGCGGGGAGCAGCATCCAGCAAGTTCACCAAGAGAACGATGTAAATGC
TCTTATGATGCTCGTCAAAGGGAAACATAAAAAGgcgaaagtgaaagtga
aaaataGCGAGTCATGGTCAAATGAATTTTCATTGGATACTGTTGGCAGT
GGTGGTTCCTTGAAATGCAATGGTCCAAGAGATCGAGTTTATGAGATTGG
TTTGAACATCAGTTTGTCATACTTTGGATTGACGAAGATTGTGACGTTCA
CGCCACTCCGAATGTTATCTAACCACACCAAGTACACCATCAGTATGGCA
GAAAGTAATTCTAAATCGTCAGAATGGCACACGGTAAACCCTGACGAGaa
cattccatTCTGGCCGACGAAACTTCCTTTGGTCAACCTTTACATTAACA
TCAATGGGCAAGATTCAGTGAAATTCAACCCTGAAGTTGGAAAAACTTTA
CTGTTGAAGTTCCAGAATGAGGTTGGAGGAGTTTGCGTGGATTACCAAGA
AAAGGACTCGTCCTCAGTCCTTTCGTTTAATCCGTACTTCGCAGGTGCAG
CTCCTGTGCGGCttgaaaatctttgcaaaaaGATCGGCATGATCGCTTAT
AAACAAGCAGGTTCGGTAATGGGTCACGTGTTAACACATGACCAATCAGT
GTTGTACACGTGGGATGATCCAACCATGGAACAAGAATTGATTTGTTCCA
TTGTCAATGATGAAGCCAGTGAAACAAGGATCAAACTCGATGCCAACGAT
TTCGGACGAATGAGAGTTGGAGATGGTGCAATTTATTGGGTTTCCTTTCT
GGATGGTCTTCAACGTGTTCTATTGTTCACTGATAACTTCAAATCTGCTT
ACTGCGCATGTCAGgaGCAAAATTTACGCCCAACCATGGAAGTTGACTTT
GAGATTGAGAGTTTTGGTTTGTCTCTGGTCAATGTTGATAAGAGAATGGA
GATTGGCTACTTAGCTATCCGACAAAGCAAGACTGTATGGGAGCAACGCA
AGAAAAAGAACCGCTGGAAAGCTTTACCGCTTGCCATGTGTGAAGCTCTC
GAAGAAGGTTATCTCAATTATCAAAACAGAAAAGGTGCAGTCAAAGAGAA
AGTTCTGGATAAGGAGGTGGATTACGAGAAGATGTTTATTACGAAACCTG
AGAAGATTAAGATCAGAAGAACGTACCACAGCGGTCTTGGTTTCAAATAC
ACAATCTCACCCAATGAAATGCGTGTGCATGCTTCTATCAGCTCAATACA
GTTGGATAGCCATGTTCCAGGTTCGACCTTTCCAACAGTCTTGCATATGG
TTGAACCACCAAAATCTGTTGCTTCAGAAAACGCTCCAAAGCCATTCTtt
gaattgagtttaatgaCAAGGATCGGTGATAAAAATGTGGTCAATGAAGT
cagCTATTGTCACGTGTTGATTCAAGAGATGGATGTGAGGGTTGATATTG
GATTTTTATTGGCTCTGATGGAACTCTTCAGTCATGCAAGAGCTCGAACA
ACCGAGAAAGAACAATACGCGCTTGATATTGGCCAAGCAGCAACAAAGTT
TGAAGAAAGCGCTGAATTTCAGGCAGCCAAACAAGATCGATATTACGTTT
TGAACGACTTTCATTTATCACCGCTAAAGATTCACGTCAGTTTCTCTTTG
ACGGGTGGTTCCAAAGATGAAAATGCTATTGCTTCATTACATGGTAACGT
GTTGAACTTGTTGTTACAAAGTGTCGGACTGGCCTTCACTGAAATACAAG
ACGTACAATTCAAATTAGCATGTTACGAAGTGCATAAGTCCATGCAGAGT
AATTCGCAGCTCGGTGATGGAATAACTAAACATTATCAAACACAGGCTAT
CAAGCAACTTTATGTGTTGGTACTCGGGCTAGACGTTCTTGGTAATCCGT
ATGGTTTGATATCTGGTGTTGGAACCGGAGCAAAGAATTTCTTCTACGAA
CCTTACCAGGGATTAATTCAAGGACCAGAAGAATTTGCGGAAGGATTGGC
GTATGGGGTGAAGAGTCTTGTTGGTGGAACCGTGGGTGGAGTATCAGGAG
CTGTGAGTAAGATTACCGGTACCTTCGGTAAAGGTTTGGCTGCATTGACC
TTGGATGAAGAATATCAACAAAAGAGACGTGAAAACATGAGCCAACGCCC
AACTAACCTCGGTGAAGGTCTCGCCAAAGGTGGTAAAGGCCTTGTAAAGG
GTATCGTGTCTGGTGTTACAGGGATCGTTACCAAACCCTATGAAGGTGCC
AAGAATGATGGTGCAGGTGGCTTTTTTAAGGGCGTTGGAAAAGGCCTGAT
TGGCGTGGTTGCACGCCCTGTTGGTGGAGTGGTAGATATGGCCAGTAACA
CGTTTGATGGTTTGAAAAGCACGACATCTGGCGTGAAAGCGATCGAGTTG
AGCCGTGTTACTCGCGTCTTCCACGCAGATAAGGTTTTACGACCTTTCAA
TCTGTACGAAGCAGATGGAAACAAAATTCTTATGCAATGTAACAAAGGAG
AATACGCCAAGAAGAATTTTTATATCACTCATGTAGTGGACAAGAAGAAC
TATCTCATCCTCACTCAATCaaacATTTTGTATGTTGGAAAGAACGAGTT
GAAAATGGGTGAATGGGAATCggtttgggttatcgagttcaATGAGCTAA
AACGTGAACCAGAAGTGAAAGAGACAAAGATTATTTTCCATATCCATAAT
ACGGACACGCGACGTTCAATTTTCAAGAAATCGACGAACACACGTGAAGT
GATATTGGAGTCTAGTGCTGTTGCAGACTGGTTTATCTTAAAGCTTAGAG
ATGCTAAAATGTTATAGatggtatttgaaTCTTTGGTTGCTGACCTCTTG
AACAAGTATCTGGGTCAATATGTGAAAAATCTTGATGCTTCTCAATTGAA
GATTGGCATTTGGGGAGGAAATGTTGTCCTGACAGAACTTGAACTGAAAG
ATACAGCTCTGGATGATCTTGACTTACCCATAAAAGTTGTTCGTGGATAT
TTGGgtAAATTGGTCTTGTCCATCCCATGGAAAAATCTTTACACTGAATC
AACTGTTGTCGATATTCAAGATCTCCACCTTGTCGCTAAGCCTAATTTTG
ACATCAAATACAATGAAGAACgcgaagaaaaatcaaaacatgacAAGAAA
CAACAACAGATTCACAATATCGAAGAAGCGAGGCAAAGAGAAGAAGACAA
AAAGAAAGGCGCCAAGAAAGAAGAGAGTGACGGTTTTGCTGAGAAACTTG
CAACAAACGTCATAAAAAATCTACAGGTTACGATCAAGAACATACATGTT
CGATATGAAGACTCAATCAGTGATGTGAATGGACCCTTTTCAGTCGGTCT
TACAATGGAAAGTTTAACAGCACAAACCACAGATGAAGATTTTGTTCCAA
AGATTATCAAAGAATCTGTCTCATTAATTCATAAGatggTGAAATTAGAC
AATTTGGCTTTATATTGGAATCCAGGAGACGAACTGATTGATCCTTCACT
TGATACCAAGCAATGGTTGgaagtTTCAACGAAGCAAATTTCAACACACC
AATCGAAGCCAGAGAAAACGAAATATATTTTGAGTCCCATGGTTGCAACG
AAGAAATTGAAGCTGAACACCAAACCAGGTTCCAACCTTGACATCCCGAA
GatgttTTTGAACTTGGTTTTGGAAGAACTTGGTATCATCGTGGCAAGAA
GTCAATATCATGGCGTGGTGCAACTGATTGAATCATTTGAACGAATGAAT
AGGAACCAACCTTTTCGTAAATACAGACCACATACCTCCGTTCTTGGGAA
CGAAAGTATTTGGTGGAAGTACTGCATGTCCAGCATACTGGAGGTGGATG
TCAAAAGACGATCTCAAATGTGGAGCTGGAAGCATATTCAAAAACATCGA
GTTCTTTGCAAAGCTTACAAAGTGAAGTAcaaggaaaaattgaaacagaa
aaATCCATCCAAACAAATTCTCACTGAACTAGAGaGCATGGAGGATGAGT
TGAATATTGCAAGCATCACCATTTTTCGACAGCTTGCAGCTACAGAGGTT
TTAACGGAACAAAAGAAGAAAGGCACTAAAGGAAGTTTCTTCAGTTTCTT
CTCCAGATCAAAAGAACCAGAAAAGTCTGCTGCTAATAAAATTGGAGATT
TAATGGGTGATGACCAGGAGAAGGAAATGCAGAAATTGTATGACGCAATC
GGTTATACTGAAAATGAAGTCATCACTCCCTTTCCTAAAGAGTACGTGGC
GATGTCAGTGGAATCGATTCTCCAGAAATTATTCATCAGCCTCATCGATG
ACACAGATAAGGCGAAAGAATTCAAAGTGTTGGATTTTTCACTCAACAAC
ATCATTGTAGAAGTTTTCCAAAGACCTTCTGCTCAAGCTCTCAAATTATG
TGCAAAGATAGGAGAGATGAAGTTATTTGGTACAGCTTCTGCTCAATGTA
CACCTCtcatcatcaaaaacatgttaCAAGGTCGAGGTATGGAATTTCTG
CCGTTGGTGGACTTCATCTTTGAGACGAATCCTTTGAAGAAACCGGACAT
TGACCAATGTATCACTGCTATTTGTCAACCCTTAGAAATCATCTATGATG
CTAACACGATCAACCATATCATTAGTTTCTTCAAACCTCCTGAACATGTT
ATCTTGCAAGATTTACAAGACAAAGCGTATTCTACTTTCGAAGATTTTAA
AGTTTCAAGTACGGCTGGTCTTCTACATGCTATGGAACAAAGAACGGTTA
TGGACATCGACATTGATGTTGGAGCATCTCATTTGATCATCCCTGAAAAA
GGTTCTTACAATGGTTGTACAGATATGCTGGTGATCGACTTTGGTAAAAT
CACGATGAGCAGCGATCCTAGTCAAATCAGACACCTTGACCCTAAGGACA
TTGAGGATGTGAATGAAGTACAAAGCAAAGCTTATGATCGATTCTTGTTG
TCGCTTCAAGCTCTTCAAATATTACTCGTTAGAGAAGGTGAAGATTTAAA
GAGTGCTAAAAGCAACGTCAGTAAAGCTTCATCACACATTTTGCATCCCA
TCAATTTCGATGGCAAACTTGCCAAAGCTATACTTCCACAAGATCCACGT
TTAAAACAGATATGTGTCTCTGGTGAATTATCTTCGCTGTTTGTTTCTGT
ATCGGATGATAAAGTCAGTCGTCTCATCAAGCTAGCAGACTCGATACCAC
TCCCTCAATCACCTTCTCACGATAACATCGACGGAGAAGAAAAACCTGAA
GGACTCTTCACCAAGGCGTTGTCAATGATAAGCTTGACAGGTGACAATGA
CACAGGGGTGGACATCGGAGGATTTTCCATCCCTGTACCGACATCTCCAA
CATCAGTGACGTCAGATGAAGATGAATACGGGACACCACCTGATGGCTCC
ATATTACAGTTACAACAAGAAGCTGGTCCGGACTTTTCATCAGGAGTGGC
GAACCAAGTCAAAGTGGACTTGAACTTTAAAATCCATAAAGTGATGATCG
CCATTGGTTTGACTGACAAAGCATTGAAACAGGAAAAAGAATGTCTGAAA
TTCATCGTGGACGACATCAATACAGAGgtGATACTACGAAGATGGGATTT
GTTCGTCAATGCAGAAGTTGGTCGTCTGGTGTTGAATGAAATGACATGGG
GTGTTGATGGAGAACCTTTCGCCATCATGAGTACacccaaaaacaccaaa
atgttGAAATTCAGCTATCGGAGGTGTGAATTCAACGAAAGTTTGAATCT
CGGTCCAAGTTACTTTTATTCCAAAGAAGCGCAAGTCAGAGCTTTACATT
TCAAAGATGAATTTGGCGCCACGGATCAGATTTTAGATGTACAAGTGGCT
ACTTTATTTCTGATGCTTCATCAAGAAGCACTTTTGAGCATCATGTCATT
GATCTACCAAGTACTGGAACCACTCAACAAACATGATAAGGAAGCCACAC
AGAAGATCAAACGGAGTTTGAGTACGGCAGGTAGTCGTTTGAGTCTCTCC
atcgaagaaaaagaaaaggagaGACAGATACAACGAAAATTAGCCAACCC
TAAAGCACTGGAAGCTGCCAACGAACTTAAGCAACAGGTTGGcttagaag
aagaaaaaaagatgaGAGTGACCGCCCACCTGGATGGTGTTGGTATCATG
ATTTGTTCAGCCAAAGTTGACCTTGCACAAGCCTTCGTTAAAGGGTTATC
TGCTAAAGTACTGATGAAAGATGACTTATTAGAAGTGAAAGCCAGCATGA
AAGATATGCAAGTACAAGATAATGTTGGCGAAACAAAGTACAAAGACATC
ATTAGCATGCGATCTGATGAAGTGTTCGATTTAGAGTTGGCTATTTACGA
GAATGGATCTTCTGGTAGCAAGCAATACGATATGTCGTGTGTCGACACCA
GTGTCAAACTGAACTTCGGTCAAATGCGCGTTGTTTTCTTGTATAGATTC
ATACAAGACTTAATGTCATTCACCGAAAACTTCGAAGAAGCACAGAAAGC
AGTTGTGGAAGCTGGTAAAGCTGCCAAGGATAAAGCTCTGGAAACAGCGA
CCGATTTGAATAGACATTCTTCTCGTGTCAAACTAAATGTGGTTCTGAAA
GCACCGACTATTATCATTCCAGTTGGATCAAACAATGAATTGGCTTTACT
GGTGGATCTGGGTGAATTGCGTATTTACAACACATTCAAACTCCTCAACG
ATGATCAATACCATAAGAAATCTATCATCACTGATAACATGACCATTAAG
TTATCCAATCTGAAATTGTTAAAAGCACTTATTCAAGATGGTAAAGATTT
CTTGCATCAACGAGCCATTATTGAACCTATGATGCTACAAATAACTATTG
TTCGTAATTTAACGAAAGGTAACCATTCCATACCGGATGTTTCAGTTCAA
GCAAAGATGCCAGCTATTCTGTTATCAATCAGTGAAGAAGATGTGACCGT
AGCTCTAAAGATTGTCCAAGGGAATCTCGCCGAAGGTGAGTCACATGCGC
CGAAGAAGCAAGCCAAGCCTGCCAAACAAACGTTAAACGTGCCACAAGAT
CGTTTAGCAGACATTTACGAGGAGcctgaagatgaagatgagaaTCGACA
AGGATATCTTCAAACCAAACTATCCTTCGATCTGGCTAAAATTGACATCA
AGCTTTACTTGAAACCATCTGATATGACATTTGAAGATGAATTTTTAGCG
AGGACGGATGATTTGTTGTTAGCTTTGTTCACTATTGGTAACCTGTGTGT
TGATGGAGACATCATGTCCACGCAAGCTATGAAGATGAGCGTTCGATTGG
ACACTTTGGTGTTGGATGATATGAGACCTATCGAGGAGCATGAAGGTGTT
AAACGTATGATCAACTACAGTCCCGAGCCACTCCTTGAAGAAGTCAAAAC
CTCTTCTCATAAACGACCAATCGACAACTCACGAATGATCGAAATCCAAt
tcgatcaaacttcatcgcaagataaaaatatcgacATCAAACTTTGTAAC
ATGCTTTGTATATTCAACGTTGAGTTTATCATGGTCCTGTTGAAAACGTT
GCAAGCTGCCATACCTAAAGATGATAGTCTGCAACATGGCCATTCAATGA
GTAGTCTAGACTCGGCGGCAGGGTCTGGCGGCAGCGATGACGAGGACTCT
TTAGAAGCCAGCGAGATTGTCCTCTGCACTGGTGATCAAGAAAGACCTGA
GACTAAAGTCTCTATCTTCGTCCATAACCCGCAAATTGTTTTACTAGCAG
ATGCAAAGGATGTCAAAACAAATGCACTCTTTCTTACAACCGagatcaat
tttcaatatttcgaaTTGCGAGATACTCAAAAAATGATTGGCGCTGTTTC
TAACACCGCTATTTTGTCAACTGCTTTCAAGAATGACCATCGGAGTGATA
TATCAACAGTGTTGTCATTAGATTCCATCAATCTCCACTCGTCATCACCC
ATCAATGGTAAACCTCATATGAGTGTCAGCACAACTTTGATCAAACTGAA
TATCTCACCCAAAACCATCCGAACTTTATCAGCGTGTGCTGGTTACATCT
CCAATGATCCAACAGATGAAGAAATCAAAGAAGCTCGAAAAGCCATGCGT
GATTTATGGCAAATTCAAACGTTCACCAATAAGCGACCGTGGTATTTAAA
CCACCCACCACAACAAGTCTTAAGTGCTGGCAGCTTCGTCCTTGCGCGAA
CGAGAACAGGAGAATATAAGCATGGTTTCTTAGCTAAAAAGGATGTCTCG
TATCAAGTCTATTTTTCAGAGGAGCGAGGAACAGCCAGTCACCGAGCCAT
GGATATCTCATCTGTTGTTTTGGATATCGTACCGCTGATCGGTGATCTAT
GTGTTGGATGTAATGTTTTAGCTGTGGAATCGAAAGAACATGGATATCGT
ACTGGTCGAATTACTCAGGTTTGGGATTCGAATGTGGATAAAGATTCTTC
GGATGGCGCCAAACAATCTGTTTCTGTCAAGACAACTGCTATTGCTCCAA
TCAAATACCTTGTCAATTTCTATGACAACCAAACGGAGAACTTCTTCCCG
CCTGATGAACTTCGTATCATTGGTAAACCCATCAAGGGGGTTGTCCCTGG
ACTAGGGGCGTGTGTTTACGCCCGCTTTAATGATGGTTTTTACTATCGGG
GCAAAGTTGATGACATCGAGGATTATCGAATCCGAGTGCAATTGGATGAG
ATCAGTGGAGAAATCGAACACGACATCGATGATCCGTCAGCCGTTATTTT
GAACCTGACGCCTCAATACCGTCAAGTCAAAAAGCATTTCAAAGTCATTG
CATCCAAAGGAAGCACAACTAAAGGATATCATCCGGGGAAAGTGACCGCC
ATCCAAGGTGAAGGAAATAACCGATTGTATTCGATACGCTTCGAAGACGG
TACAATTAACCAAGTACCCATCacgaaattgattttgatgccAAAAGCAC
CTTTTGATGCTTTACCTGAAGTTGGCACATACGTTTATTCCCGAGTGTCA
CGCGACGCTCCTTTATACGAGAAGGGTATCGTAGCAGAGAAGAACACAAT
GATCTGCGTTAAACATTTAAATGGACGGAAATTGGCTCACGAAATACAAA
ACATTCATTTTGTTGTCCGAAATATCGTTCCTCTCGTGTCATCAttgaag
GTTGGTTTGGACGTCATAGTGCAACCTGACAATGACGATCAGAAAATGTA
TTTGGCTGTCATTAGGGAAGTCACCAAAAAAGAAGGTGACAAAACGAACC
GTTATCTAGTGGAGTTTACGGATGGATCCAAGAAGAGAGTGACGCCCAGC
CGGATCCGTATACTTTCTCAATACGGAAGTGCAGAAACGAGTGAAGAAAA
TGCTGACATTATCACAACAAGACAGGAGGAACTAGTTCTCGATGTGCAAG
GTATCTCATTACGTGTGGAAGGTTACTTGGGAGGCGTGTTGACACCCATG
CTCAAAATGGATTCCAAAATCACAGCTAACTTGAAGGATTGGTCAAGCCA
AATGAATGCACACGCTACTGTATCATTAGAAGCCAGTTATTATAACGAAA
ACGTTGCCGAATGGGAGCCAGTTATTGAACCTTTGATGGAGAAACGGAGG
GAAAGACCGTGGCAACTCTCTGTCAATTACACGATGGAAGGTGACGACAA
TTCTGCTTCATCCACTTCCAACGAACTCGTTTTACAAAAACCGGAATCCA
ACCTGAAAATCAAATCTCAAGATAATCTTGAATTGACAATTTCAAAATCA
TGTCTTGCTTTACTCGGTGAATTGGGACAGGTGTTTGGAGATGCAGTAGA
ATCTGTGGACGTTTTACCACAAGTCCTGGTCGAAAAAGAACCTTTCATGA
TCGAAAACTTGCTCTCCAAGAAGGTGACAGTAACATTGAATGAACTTCTG
CAGGGACCAAATGGAGATTCGACAATCGAGCTAGCATCTTCTTCGAATCC
TGTTGGCATTACTTTTGCTCCCAagaaatttgagaaacgaaAGACCAACG
ATCTATACACAATCAATTTAtcgGTGGACGGTTTTCATGACATTAAAGAC
ATTGTGGTTCAAAGAAAGCGAAGCGTTATCTATGATCTTGTACCAATAAA
ACTATTATCAGCACAGTCTTCATATTCGATAGTGGTACAAGTGAAGACAA
CAGACGGACAACGTATCATCGTACTCCGATCACCATTGCAGTTGAAAAAT
CACTTTCCAATGCCGTTGGATGTCAGCTACATTTCCAAAGAAAACCAACC
AGTTAAACTGACAACAGTGGGATCGGGAGATATCTATTCCTTCCCTTTGT
TGTTAACCTACCACAGTGTTTTTCATCTCAAACCTGCTGGTTTCGACTAC
GGTGATTGCACAGAAGCTCTCAATTGGAGTGATTTGAAGACGAGCAACGA
AAAACAGTTCTCCTGCCCTTCACCTGACAAAAGTGCTGACCCTTTCTACA
TGCAGGTGGTGATGAAAGAGGAGACGTACTCTTCCGTACACGGCATGTTG
GACTGTGTACCACGTTACACGTTGGAGTGCTTTCCCGTCATCACGCTGCA
TAATTACCTACCTTGCACTATTAATTATAAGATCAAGGGTATGGCGAAAT
CGGAAAGTCTACCAGGCGGACACAATTGGCCTTTGTTTACCGTCAACTTC
AGTGATAAACCTTCCATCTATATCGAGATTGAGTCGTATAACAACCAAAG
ATGGGAAGGAGGTTTGACATTACCAACAAAACCGGTAGATTCTTTGAACA
AACCATCATTATCTTTCGTCATGATGTCTGGTGAACGCAAAATGGAATTG
GGTGTTTATTACCAGTTAGACGGTTCATTGAACATCACCTTATATTCGCC
TTACTGGCTTCTCAATAAAACTGGAAAACCACTTGTCTATCAGCCAGCGG
GGAGCAGCATCCAGCAAGTTCACCAAGAGAACGATGTAAATGCTCTTATG
ATGCTCGTCAAAGGGAAACATAAAAAGgcgaaagtgaaagtgaaaaataG
CGAGTCATGGTCAAATGAATTTTCATTGGATACTGTTGGCAGTGGTGGTT
CCTTGAAATGCAATGGTCCAAGAGATCGAGTTTATGAGATTGGTTTGAAC
ATCAGTTTGTCATACTTTGGATTGACGAAGATTGTGACGTTCACGCCACT
CCGAATGTTATCTAACCACACCAAGTACACCATCAGTATGGCAGAAAGTA
ATTCTAAATCGTCAGAATGGCACACGGTAAACCCTGACGAGaacattcca
tTCTGGCCGACGAAACTTCCTTTGGTCAACCTTTACATTAACATCAATGG
GCAAGATTCAGTGAAATTCAACCCTGAAGTTGGAAAAACTTTACTGTTGA
AGTTCCAGAATGAGGTTGGAGGAGTTTGCGTGGATTACCAAGAAAAGGAC
TCGTCCTCAGTCCTTTCGTTTAATCCGTACTTCGCAGGTGCAGCTCCTGT
GCGGCttgaaaatctttgcaaaaaGATCGGCATGATCGCTTATAAACAAG
CAGGTTCGGTAATGGGTCACGTGTTAACACATGACCAATCAGTGTTGTAC
ACGTGGGATGATCCAACCATGGAACAAGAATTGATTTGTTCCATTGTCAA
TGATGAAGCCAGTGAAACAAGGATCAAACTCGATGCCAACGATTTCGGAC
GAATGAGAGTTGGAGATGGTGCAATTTATTGGGTTTCCTTTCTGGATGGT
CTTCAACGTGTTCTATTGTTCACTGATAACTTCAAATCTGCTTACTGCGC
ATGTCAGgaGCAAAATTTACGCCCAACCATGGAAGTTGACTTTGAGATTG
AGAGTTTTGGTTTGTCTCTGGTCAATGTTGATAAGAGAATGGAGATTGGC
TACTTAGCTATCCGACAAAGCAAGACTGTATGGGAGCAACGCAAGAAAAA
GAACCGCTGGAAAGCTTTACCGCTTGCCATGTGTGAAGCTCTCGAAGAAG
GTTATCTCAATTATCAAAACAGAAAAGGTGCAGTCAAAGAGAAAGTTCTG
GATAAGGAGGTGGATTACGAGAAGATGTTTATTACGAAACCTGAGAAGAT
TAAGATCAGAAGAACGTACCACAGCGGTCTTGGTTTCAAATACACAATCT
CACCCAATGAAATGCGTGTGCATGCTTCTATCAGCTCAATACAGTTGGAT
AGCCATGTTCCAGGTTCGACCTTTCCAACAGTCTTGCATATGGTTGAACC
ACCAAAATCTGTTGCTTCAGAAAACGCTCCAAAGCCATTCTttgaattga
gtttaatgaCAAGGATCGGTGATAAAAATGTGGTCAATGAAGTcagCTAT
TGTCACGTGTTGATTCAAGAGATGGATGTGAGGGTTGATATTGGATTTTT
ATTGGCTCTGATGGAACTCTTCAGTCATGCAAGAGCTCGAACAACCGAGA
AAGAACAATACGCGCTTGATATTGGCCAAGCAGCAACAAAGTTTGAAGAA
AGCGCTGAATTTCAGGCAGCCAAACAAGATCGATATTACGTTTTGAACGA
CTTTCATTTATCACCGCTAAAGATTCACGTCAGTTTCTCTTTGACGGGTG
GTTCCAAAGATGAAAATGCTATTGCTTCATTACATGGTAACGTGTTGAAC
TTGTTGTTACAAAGTGTCGGACTGGCCTTCACTGAAATACAAGACGTACA
ATTCAAATTAGCATGTTACGAAGTGCATAAGTCCATGCAGAGTAATTCGC
AGCTCGGTGATGGAATAACTAAACATTATCAAACACAGGCTATCAAGCAA
CTTTATGTGTTGGTACTCGGGCTAGACGTTCTTGGTAATCCGTATGGTTT
GATATCTGGTGTTGGAACCGGAGCAAAGAATTTCTTCTACGAACCTTACC
AGGGATTAATTCAAGGACCAGAAGAATTTGCGGAAGGATTGGCGTATGGG
GTGAAGAGTCTTGTTGGTGGAACCGTGGGTGGAGTATCAGGAGCTGTGAG
TAAGATTACCGGTACCTTCGGTAAAGGTTTGGCTGCATTGACCTTGGATG
AAGAATATCAACAAAAGAGACGTGAAAACATGAGCCAACGCCCAACTAAC
CTCGGTGAAGGTCTCGCCAAAGGTGGTAAAGGCCTTGTAAAGGGTATCGT
GTCTGGTGTTACAGGGATCGTTACCAAACCCTATGAAGGTGCCAAGAATG
ATGGTGCAGGTGGCTTTTTTAAGGGCGTTGGAAAAGGCCTGATTGGCGTG
GTTGCACGCCCTGTTGGTGGAGTGGTAGATATGGCCAGTAACACGTTTGA
TGGTTTGAAAAGCACGACATCTGGCGTGAAAGCGATCGAGTTGAGCCGTG
TTACTCGCGTCTTCCACGCAGATAAGGTTTTACGACCTTTCAATCTGTAC
GAAGCAGATGGAAACAAAATTCTTATGCAATGTAACAAAGGAGAATACGC
CAAGAAGAATTTTTATATCACTCATGTAGTGGACAAGAAGAACTATCTCA
TCCTCACTCAATCaaacATTTTGTATGTTGGAAAGAACGAGTTGAAAATG
GGTGAATGGGAATCggtttgggttatcgagttcaATGAGCTAAAACGTGA
ACCAGAAGTGAAAGAGACAAAGATTATTTTCCATATCCATAATACGGACA
CGCGACGTTCAATTTTCAAGAAATCGACGAACACACGTGAAGTGATATTG
GAGTCTAGTGCTGTTGCAGACTGGTTTATCTTAAAGCTTAGAGATGCTAA
AATGTTATAGatggtatttgaaTCTTTGGTTGCTGACCTCTTGAACAAGT
ATCTGGGTCAATATGTGAAAAATCTTGATGCTTCTCAATTGAAGATTGGC
ATTTGGGGAGGAAATGTTGTCCTGACAGAACTTGAACTGAAAGATACAGC
TCTGGATGATCTTGACTTACCCATAAAAGTTGTTCGTGGATATTTGGgtA
AATTGGTCTTGTCCATCCCATGGAAAAATCTTTACACTGAATCAACTGTT
GTCGATATTCAAGATCTCCACCTTGTCGCTAAGCCTAATTTTGACATCAA
ATACAATGAAGAACgcgaagaaaaatcaaaacatgacAAGAAACAACAAC
AGATTCACAATATCGAAGAAGCGAGGCAAAGAGAAGAAGACAAAAAGAAA
GGCGCCAAGAAAGAAGAGAGTGACGGTTTTGCTGAGAAACTTGCAACAAA
CGTCATAAAAAATCTACAGGTTACGATCAAGAACATACATGTTCGATATG
AAGACTCAATCAGTGATGTGAATGGACCCTTTTCAGTCGGTCTTACAATG
GAAAGTTTAACAGCACAAACCACAGATGAAGATTTTGTTCCAAAGATTAT
CAAAGAATCTGTCTCATTAATTCATAAGatggTGAAATTAGACAATTTGG
CTTTATATTGGAATCCAGGAGACGAACTGATTGATCCTTCACTTGATACC
AAGCAATGGTTGgaagtTTCAACGAAGCAAATTTCAACACACCAATCGAA
GCCAGAGAAAACGAAATATATTTTGAGTCCCATGGTTGCAACGAAGAAAT
TGAAGCTGAACACCAAACCAGGTTCCAACCTTGACATCCCGAAGatgttT
TTGAACTTGGTTTTGGAAGAACTTGGTATCATCGTGGCAAGAAGTCAATA
TCATGGCGTGGTGCAACTGATTGAATCATTTGAACGAATGAATAGGAACC
AACCTTTTCGTAAATACAGACCACATACCTCCGTTCTTGGGAACGAAAGT
ATTTGGTGGAAGTACTGCATGTCCAGCATACTGGAGGTGGATGTCAAAAG
ACGATCTCAAATGTGGAGCTGGAAGCATATTCAAAAACATCGAGTTCTTT
GCAAAGCTTACAAAGTGAAGTAcaaggaaaaattgaaacagaaaaATCCA
TCCAAACAAATTCTCACTGAACTAGAGaGCATGGAGGATGAGTTGAATAT
TGCAAGCATCACCATTTTTCGACAGCTTGCAGCTACAGAGGTTTTAACGG
AACAAAAGAAGAAAGGCACTAAAGGAAGTTTCTTCAGTTTCTTCTCCAGA
TCAAAAGAACCAGAAAAGTCTGCTGCTAATAAAATTGGAGATTTAATGGG
TGATGACCAGGAGAAGGAAATGCAGAAATTGTATGACGCAATCGGTTATA
CTGAAAATGAAGTCATCACTCCCTTTCCTAAAGAGTACGTGGCGATGTCA
GTGGAATCGATTCTCCAGAAATTATTCATCAGCCTCATCGATGACACAGA
TAAGGCGAAAGAATTCAAAGTGTTGGATTTTTCACTCAACAACATCATTG
TAGAAGTTTTCCAAAGACCTTCTGCTCAAGCTCTCAAATTATGTGCAAAG
ATAGGAGAGATGAAGTTATTTGGTACAGCTTCTGCTCAATGTACACCTCt
catcatcaaaaacatgttaCAAGGTCGAGGTATGGAATTTCTGCCGTTGG
TGGACTTCATCTTTGAGACGAATCCTTTGAAGAAACCGGACATTGACCAA
TGTATCACTGCTATTTGTCAACCCTTAGAAATCATCTATGATGCTAACAC
GATCAACCATATCATTAGTTTCTTCAAACCTCCTGAACATGTTATCTTGC
AAGATTTACAAGACAAAGCGTATTCTACTTTCGAAGATTTTAAAGTTTCA
AGTACGGCTGGTCTTCTACATGCTATGGAACAAAGAACGGTTATGGACAT
CGACATTGATGTTGGAGCATCTCATTTGATCATCCCTGAAAAAGGTTCTT
ACAATGGTTGTACAGATATGCTGGTGATCGACTTTGGTAAAATCACGATG
AGCAGCGATCCTAGTCAAATCAGACACCTTGACCCTAAGGACATTGAGGA
TGTGAATGAAGTACAAAGCAAAGCTTATGATCGATTCTTGTTGTCGCTTC
AAGCTCTTCAAATATTACTCGTTAGAGAAGGTGAAGATTTAAAGAGTGCT
AAAAGCAACGTCAGTAAAGCTTCATCACACATTTTGCATCCCATCAATTT
CGATGGCAAACTTGCCAAAGCTATACTTCCACAAGATCCACGTTTAAAAC
AGATATGTGTCTCTGGTGAATTATCTTCGCTGTTTGTTTCTGTATCGGAT
GATAAAGTCAGTCGTCTCATCAAGCTAGCAGACTCGATACCACTCCCTCA
ATCACCTTCTCACGATAACATCGACGGAGAAGAAAAACCTGAAGGACTCT
TCACCAAGGCGTTGTCAATGATAAGCTTGACAGGTGACAATGACACAGGG
GTGGACATCGGAGGATTTTCCATCCCTGTACCGACATCTCCAACATCAGT
GACGTCAGATGAAGATGAATACGGGACACCACCTGATGGCTCCATATTAC
AGTTACAACAAGAAGCTGGTCCGGACTTTTCATCAGGAGTGGCGAACCAA
GTCAAAGTGGACTTGAACTTTAAAATCCATAAAGTGATGATCGCCATTGG
TTTGACTGACAAAGCATTGAAACAGGAAAAAGAATGTCTGAAATTCATCG
TGGACGACATCAATACAGAGgtGATACTACGAAGATGGGATTTGTTCGTC
AATGCAGAAGTTGGTCGTCTGGTGTTGAATGAAATGACATGGGGTGTTGA
TGGAGAACCTTTCGCCATCATGAGTACacccaaaaacaccaaaatgttGA
AATTCAGCTATCGGAGGTGTGAATTCAACGAAAGTTTGAATCTCGGTCCA
AGTTACTTTTATTCCAAAGAAGCGCAAGTCAGAGCTTTACATTTCAAAGA
TGAATTTGGCGCCACGGATCAGATTTTAGATGTACAAGTGGCTACTTTAT
TTCTGATGCTTCATCAAGAAGCACTTTTGAGCATCATGTCATTGATCTAC
CAAGTACTGGAACCACTCAACAAACATGATAAGGAAGCCACACAGAAGAT
CAAACGGAGTTTGAGTACGGCAGGTAGTCGTTTGAGTCTCTCCatcgaag
aaaaagaaaaggagaGACAGATACAACGAAAATTAGCCAACCCTAAAGCA
CTGGAAGCTGCCAACGAACTTAAGCAACAGGTTGGcttagaagaagaaaa
aaagatgaGAGTGACCGCCCACCTGGATGGTGTTGGTATCATGATTTGTT
CAGCCAAAGTTGACCTTGCACAAGCCTTCGTTAAAGGGTTATCTGCTAAA
GTACTGATGAAAGATGACTTATTAGAAGTGAAAGCCAGCATGAAAGATAT
GCAAGTACAAGATAATGTTGGCGAAACAAAGTACAAAGACATCATTAGCA
TGCGATCTGATGAAGTGTTCGATTTAGAGTTGGCTATTTACGAGAATGGA
TCTTCTGGTAGCAAGCAATACGATATGTCGTGTGTCGACACCAGTGTCAA
ACTGAACTTCGGTCAAATGCGCGTTGTTTTCTTGTATAGATTCATACAAG
ACTTAATGTCATTCACCGAAAACTTCGAAGAAGCACAGAAAGCAGTTGTG
GAAGCTGGTAAAGCTGCCAAGGATAAAGCTCTGGAAACAGCGACCGATTT
GAATAGACATTCTTCTCGTGTCAAACTAAATGTGGTTCTGAAAGCACCGA
CTATTATCATTCCAGTTGGATCAAACAATGAATTGGCTTTACTGGTGGAT
CTGGGTGAATTGCGTATTTACAACACATTCAAACTCCTCAACGATGATCA
ATACCATAAGAAATCTATCATCACTGATAACATGACCATTAAGTTATCCA
ATCTGAAATTGTTAAAAGCACTTATTCAAGATGGTAAAGATTTCTTGCAT
CAACGAGCCATTATTGAACCTATGATGCTACAAATAACTATTGTTCGTAA
TTTAACGAAAGGTAACCATTCCATACCGGATGTTTCAGTTCAAGCAAAGA
TGCCAGCTATTCTGTTATCAATCAGTGAAGAAGATGTGACCGTAGCTCTA
AAGATTGTCCAAGGGAATCTCGCCGAAGGTGAGTCACATGCGCCGAAGAA
GCAAGCCAAGCCTGCCAAACAAACGTTAAACGTGCCACAAGATCGTTTAG
CAGACATTTACGAGGAGcctgaagatgaagatgagaaTCGACAAGGATAT
CTTCAAACCAAACTATCCTTCGATCTGGCTAAAATTGACATCAAGCTTTA
CTTGAAACCATCTGATATGACATTTGAAGATGAATTTTTAGCGAGGACGG
ATGATTTGTTGTTAGCTTTGTTCACTATTGGTAACCTGTGTGTTGATGGA
GACATCATGTCCACGCAAGCTATGAAGATGAGCGTTCGATTGGACACTTT
GGTGTTGGATGATATGAGACCTATCGAGGAGCATGAAGGTGTTAAACGTA
TGATCAACTACAGTCCCGAGCCACTCCTTGAAGAAGTCAAAACCTCTTCT
CATAAACGACCAATCGACAACTCACGAATGATCGAAATCCAAttcgatca
aacttcatcgcaagataaaaatatcgacATCAAACTTTGTAACATGCTTT
GTATATTCAACGTTGAGTTTATCATGGTCCTGTTGAAAACGTTGCAAGCT
GCCATACCTAAAGATGATAGTCTGCAACATGGCCATTCAATGAGTAGTCT
AGACTCGGCGGCAGGGTCTGGCGGCAGCGATGACGAGGACTCTTTAGAAG
CCAGCGAGATTGTCCTCTGCACTGGTGATCAAGAAAGACCTGAGACTAAA
GTCTCTATCTTCGTCCATAACCCGCAAATTGTTTTACTAGCAGATGCAAA
GGATGTCAAAACAAATGCACTCTTTCTTACAACCGagatcaattttcaat
atttcgaaTTGCGAGATACTCAAAAAATGATTGGCGCTGTTTCTAACACC
GCTATTTTGTCAACTGCTTTCAAGAATGACCATCGGAGTGATATATCAAC
AGTGTTGTCATTAGATTCCATCAATCTCCACTCGTCATCACCCATCAATG
GTAAACCTCATATGAGTGTCAGCACAACTTTGATCAAACTGAATATCTCA
CCCAAAACCATCCGAACTTTATCAGCGTGTGCTGGTTACATCTCCAATGA
TCCAACAGATGAAGAAATCAAAGAAGCTCGAAAAGCCATGCGTGATTTAT
GGCAAATTCAAACGTTCACCAATAAGCGACCGTGGTATTTAAACCACCCA
CCACAACAAGTCTTAAGTGCTGGCAGCTTCGTCCTTGCGCGAACGAGAAC
AGGAGAATATAAGCATGGTTTCTTAGCTAAAAAGGATGTCTCGTATCAAG
TCTATTTTTCAGAGGAGCGAGGAACAGCCAGTCACCGAGCCATGGATATC
TCATCTGTTGTTTTGGATATCGTACCGCTGATCGGTGATCTATGTGTTGG
ATGTAATGTTTTAGCTGTGGAATCGAAAGAACATGGATATCGTACTGGTC
GAATTACTCAGGTTTGGGATTCGAATGTGGATAAAGATTCTTCGGATGGC
GCCAAACAATCTGTTTCTGTCAAGACAACTGCTATTGCTCCAATCAAATA
CCTTGTCAATTTCTATGACAACCAAACGGAGAACTTCTTCCCGCCTGATG
AACTTCGTATCATTGGTAAACCCATCAAGGGGGTTGTCCCTGGACTAGGG
GCGTGTGTTTACGCCCGCTTTAATGATGGTTTTTACTATCGGGGCAAAGT
TGATGACATCGAGGATTATCGAATCCGAGTGCAATTGGATGAGATCAGTG
GAGAAATCGAACACGACATCGATGATCCGTCAGCCGTTATTTTGAACCTG
ACGCCTCAATACCGTCAAGTCAAAAAGCATTTCAAAGTCATTGCATCCAA
AGGAAGCACAACTAAAGGATATCATCCGGGGAAAGTGACCGCCATCCAAG
GTGAAGGAAATAACCGATTGTATTCGATACGCTTCGAAGACGGTACAATT
AACCAAGTACCCATCacgaaattgattttgatgccAAAAGCACCTTTTGA
TGCTTTACCTGAAGTTGGCACATACGTTTATTCCCGAGTGTCACGCGACG
CTCCTTTATACGAGAAGGGTATCGTAGCAGAGAAGAACACAATGATCTGC
GTTAAACATTTAAATGGACGGAAATTGGCTCACGAAATACAAAACATTCA
TTTTGTTGTCCGAAATATCGTTCCTCTCGTGTCATCAttgaagGTTGGTT
TGGACGTCATAGTGCAACCTGACAATGACGATCAGAAAATGTATTTGGCT
GTCATTAGGGAAGTCACCAAAAAAGAAGGTGACAAAACGAACCGTTATCT
AGTGGAGTTTACGGATGGATCCAAGAAGAGAGTGACGCCCAGCCGGATCC
GTATACTTTCTCAATACGGAAGTGCAGAAACGAGTGAAGAAAATGCTGAC
ATTATCACAACAAGACAGGAGGAACTAGTTCTCGATGTGCAAGGTATCTC
ATTACGTGTGGAAGGTTACTTGGGAGGCGTGTTGACACCCATGCTCAAAA
TGGATTCCAAAATCACAGCTAACTTGAAGGATTGGTCAAGCCAAATGAAT
GCACACGCTACTGTATCATTAGAAGCCAGTTATTATAACGAAAACGTTGC
CGAATGGGAGCCAGTTATTGAACCTTTGATGGAGAAACGGAGGGAAAGAC
CGTGGCAACTCTCTGTCAATTACACGATGGAAGGTGACGACAATTCTGCT
TCATCCACTTCCAACGAACTCGTTTTACAAAAACCGGAATCCAACCTGAA
AATCAAATCTCAAGATAATCTTGAATTGACAATTTCAAAATCATGTCTTG
CTTTACTCGGTGAATTGGGACAGGTGTTTGGAGATGCAGTAGAATCTGTG
GACGTTTTACCACAAGTCCTGGTCGAAAAAGAACCTTTCATGATCGAAAA
CTTGCTCTCCAAGAAGGTGACAGTAACATTGAATGAACTTCTGCAGGGAC
CAAATGGAGATTCGACAATCGAGCTAGCATCTTCTTCGAATCCTGTTGGC
ATTACTTTTGCTCCCAagaaatttgagaaacgaaAGACCAACGATCTATA
CACAATCAATTTAtcgGTGGACGGTTTTCATGACATTAAAGACATTGTGG
TTCAAAGAAAGCGAAGCGTTATCTATGATCTTGTACCAATAAAACTATTA
TCAGCACAGTCTTCATATTCGATAGTGGTACAAGTGAAGACAACAGACGG
ACAACGTATCATCGTACTCCGATCACCATTGCAGTTGAAAAATCACTTTC
CAATGCCGTTGGATGTCAGCTACATTTCCAAAGAAAACCAACCAGTTAAA
CTGACAACAGTGGGATCGGGAGATATCTATTCCTTCCCTTTGTTGTTAAC
CTACCACAGTGTTTTTCATCTCAAACCTGCTGGTTTCGACTACGGTGATT
GCACAGAAGCTCTCAATTGGAGTGATTTGAAGACGAGCAACGAAAAACAG
TTCTCCTGCCCTTCACCTGACAAAAGTGCTGACCCTTTCTACATGCAGGT
GGTGATGAAAGAGGAGACGTACTCTTCCGTACACGGCATGTTGGACTGTG
TACCACGTTACACGTTGGAGTGCTTTCCCGTCATCACGCTGCATAATTAC
CTACCTTGCACTATTAATTATAAGATCAAGGGTATGGCGAAATCGGAAAG
TCTACCAGGCGGACACAATTGGCCTTTGTTTACCGTCAACTTCAGTGATA
AACCTTCCATCTATATCGAGATTGAGTCGTATAACAACCAAAGATGGGAA
GGAGGTTTGACATTACCAACAAAACCGGTAGATTCTTTGAACAAACCATC
ATTATCTTTCGTCATGATGTCTGGTGAACGCAAAATGGAATTGGGTGTTT
ATTACCAGTTAGACGGTTCATTGAACATCACCTTATATTCGCCTTACTGG
CTTCTCAATAAAACTGGAAAACCACTTGTCTATCAGCCAGCGGGGAGCAG
CATCCAGCAAGTTCACCAAGAGAACGATGTAAATGCTCTTATGATGCTCG
TCAAAGGGAAACATAAAAAGgcgaaagtgaaagtgaaaaataGCGAGTCA
TGGTCAAATGAATTTTCATTGGATACTGTTGGCAGTGGTGGTTCCTTGAA
ATGCAATGGTCCAAGAGATCGAGTTTATGAGATTGGTTTGAACATCAGTT
TGTCATACTTTGGATTGACGAAGATTGTGACGTTCACGCCACTCCGAATG
TTATCTAACCACACCAAGTACACCATCAGTATGGCAGAAAGTAATTCTAA
ATCGTCAGAATGGCACACGGTAAACCCTGACGAGaacattccatTCTGGC
CGACGAAACTTCCTTTGGTCAACCTTTACATTAACATCAATGGGCAAGAT
TCAGTGAAATTCAACCCTGAAGTTGGAAAAACTTTACTGTTGAAGTTCCA
GAATGAGGTTGGAGGAGTTTGCGTGGATTACCAAGAAAAGGACTCGTCCT
CAGTCCTTTCGTTTAATCCGTACTTCGCAGGTGCAGCTCCTGTGCGGCtt
gaaaatctttgcaaaaaGATCGGCATGATCGCTTATAAACAAGCAGGTTC
GGTAATGGGTCACGTGTTAACACATGACCAATCAGTGTTGTACACGTGGG
ATGATCCAACCATGGAACAAGAATTGATTTGTTCCATTGTCAATGATGAA
GCCAGTGAAACAAGGATCAAACTCGATGCCAACGATTTCGGACGAATGAG
AGTTGGAGATGGTGCAATTTATTGGGTTTCCTTTCTGGATGGTCTTCAAC
GTGTTCTATTGTTCACTGATAACTTCAAATCTGCTTACTGCGCATGTCAG
gaGCAAAATTTACGCCCAACCATGGAAGTTGACTTTGAGATTGAGAGTTT
TGGTTTGTCTCTGGTCAATGTTGATAAGAGAATGGAGATTGGCTACTTAG
CTATCCGACAAAGCAAGACTGTATGGGAGCAACGCAAGAAAAAGAACCGC
TGGAAAGCTTTACCGCTTGCCATGTGTGAAGCTCTCGAAGAAGGTTATCT
CAATTATCAAAACAGAAAAGGTGCAGTCAAAGAGAAAGTTCTGGATAAGG
AGGTGGATTACGAGAAGATGTTTATTACGAAACCTGAGAAGATTAAGATC
AGAAGAACGTACCACAGCGGTCTTGGTTTCAAATACACAATCTCACCCAA
TGAAATGCGTGTGCATGCTTCTATCAGCTCAATACAGTTGGATAGCCATG
TTCCAGGTTCGACCTTTCCAACAGTCTTGCATATGGTTGAACCACCAAAA
TCTGTTGCTTCAGAAAACGCTCCAAAGCCATTCTttgaattgagtttaat
gaCAAGGATCGGTGATAAAAATGTGGTCAATGAAGTcagCTATTGTCACG
TGTTGATTCAAGAGATGGATGTGAGGGTTGATATTGGATTTTTATTGGCT
CTGATGGAACTCTTCAGTCATGCAAGAGCTCGAACAACCGAGAAAGAACA
ATACGCGCTTGATATTGGCCAAGCAGCAACAAAGTTTGAAGAAAGCGCTG
AATTTCAGGCAGCCAAACAAGATCGATATTACGTTTTGAACGACTTTCAT
TTATCACCGCTAAAGATTCACGTCAGTTTCTCTTTGACGGGTGGTTCCAA
AGATGAAAATGCTATTGCTTCATTACATGGTAACGTGTTGAACTTGTTGT
TACAAAGTGTCGGACTGGCCTTCACTGAAATACAAGACGTACAATTCAAA
TTAGCATGTTACGAAGTGCATAAGTCCATGCAGAGTAATTCGCAGCTCGG
TGATGGAATAACTAAACATTATCAAACACAGGCTATCAAGCAACTTTATG
TGTTGGTACTCGGGCTAGACGTTCTTGGTAATCCGTATGGTTTGATATCT
GGTGTTGGAACCGGAGCAAAGAATTTCTTCTACGAACCTTACCAGGGATT
AATTCAAGGACCAGAAGAATTTGCGGAAGGATTGGCGTATGGGGTGAAGA
GTCTTGTTGGTGGAACCGTGGGTGGAGTATCAGGAGCTGTGAGTAAGATT
ACCGGTACCTTCGGTAAAGGTTTGGCTGCATTGACCTTGGATGAAGAATA
TCAACAAAAGAGACGTGAAAACATGAGCCAACGCCCAACTAACCTCGGTG
AAGGTCTCGCCAAAGGTGGTAAAGGCCTTGTAAAGGGTATCGTGTCTGGT
GTTACAGGGATCGTTACCAAACCCTATGAAGGTGCCAAGAATGATGGTGC
AGGTGGCTTTTTTAAGGGCGTTGGAAAAGGCCTGATTGGCGTGGTTGCAC
GCCCTGTTGGTGGAGTGGTAGATATGGCCAGTAACACGTTTGATGGTTTG
AAAAGCACGACATCTGGCGTGAAAGCGATCGAGTTGAGCCGTGTTACTCG
CGTCTTCCACGCAGATAAGGTTTTACGACCTTTCAATCTGTACGAAGCAG
ATGGAAACAAAATTCTTATGCAATGTAACAAAGGAGAATACGCCAAGAAG
AATTTTTATATCACTCATGTAGTGGACAAGAAGAACTATCTCATCCTCAC
TCAATCaaacATTTTGTATGTTGGAAAGAACGAGTTGAAAATGGGTGAAT
GGGAATCggtttgggttatcgagttcaATGAGCTAAAACGTGAACCAGAA
GTGAAAGAGACAAAGATTATTTTCCATATCCATAATACGGACACGCGACG
TTCAATTTTCAAGAAATCGACGAACACACGTGAAGTGATATTGGAGTCTA
GTGCTGTTGCAGACTGGTTTATCTTAAAGCTTAGAGATGCTAAAATGTTA
TAGatggtatttgaaTCTTTGGTTGCTGACCTCTTGAACAAGTATCTGGG
TCAATATGTGAAAAATCTTGATGCTTCTCAATTGAAGATTGGCATTTGGG
GAGGAAATGTTGTCCTGACAGAACTTGAACTGAAAGATACAGCTCTGGAT
GATCTTGACTTACCCATAAAAGTTGTTCGTGGATATTTGGgtAAATTGGT
CTTGTCCATCCCATGGAAAAATCTTTACACTGAATCAACTGTTGTCGATA
TTCAAGATCTCCACCTTGTCGCTAAGCCTAATTTTGACATCAAATACAAT
GAAGAACgcgaagaaaaatcaaaacatgacAAGAAACAACAACAGATTCA
CAATATCGAAGAAGCGAGGCAAAGAGAAGAAGACAAAAAGAAAGGCGCCA
AGAAAGAAGAGAGTGACGGTTTTGCTGAGAAACTTGCAACAAACGTCATA
AAAAATCTACAGGTTACGATCAAGAACATACATGTTCGATATGAAGACTC
AATCAGTGATGTGAATGGACCCTTTTCAGTCGGTCTTACAATGGAAAGTT
TAACAGCACAAACCACAGATGAAGATTTTGTTCCAAAGATTATCAAAGAA
TCTGTCTCATTAATTCATAAGatggTGAAATTAGACAATTTGGCTTTATA
TTGGAATCCAGGAGACGAACTGATTGATCCTTCACTTGATACCAAGCAAT
GGTTGgaagtTTCAACGAAGCAAATTTCAACACACCAATCGAAGCCAGAG
AAAACGAAATATATTTTGAGTCCCATGGTTGCAACGAAGAAATTGAAGCT
GAACACCAAACCAGGTTCCAACCTTGACATCCCGAAGatgttTTTGAACT
TGGTTTTGGAAGAACTTGGTATCATCGTGGCAAGAAGTCAATATCATGGC
GTGGTGCAACTGATTGAATCATTTGAACGAATGAATAGGAACCAACCTTT
TCGTAAATACAGACCACATACCTCCGTTCTTGGGAACGAAAGTATTTGGT
GGAAGTACTGCATGTCCAGCATACTGGAGGTGGATGTCAAAAGACGATCT
CAAATGTGGAGCTGGAAGCATATTCAAAAACATCGAGTTCTTTGCAAAGC
TTACAAAGTGAAGTAcaaggaaaaattgaaacagaaaaATCCATCCAAAC
AAATTCTCACTGAACTAGAGaGCATGGAGGATGAGTTGAATATTGCAAGC
ATCACCATTTTTCGACAGCTTGCAGCTACAGAGGTTTTAACGGAACAAAA
GAAGAAAGGCACTAAAGGAAGTTTCTTCAGTTTCTTCTCCAGATCAAAAG
AACCAGAAAAGTCTGCTGCTAATAAAATTGGAGATTTAATGGGTGATGAC
CAGGAGAAGGAAATGCAGAAATTGTATGACGCAATCGGTTATACTGAAAA
TGAAGTCATCACTCCCTTTCCTAAAGAGTACGTGGCGATGTCAGTGGAAT
CGATTCTCCAGAAATTATTCATCAGCCTCATCGATGACACAGATAAGGCG
AAAGAATTCAAAGTGTTGGATTTTTCACTCAACAACATCATTGTAGAAGT
TTTCCAAAGACCTTCTGCTCAAGCTCTCAAATTATGTGCAAAGATAGGAG
AGATGAAGTTATTTGGTACAGCTTCTGCTCAATGTACACCTCtcatcatc
aaaaacatgttaCAAGGTCGAGGTATGGAATTTCTGCCGTTGGTGGACTT
CATCTTTGAGACGAATCCTTTGAAGAAACCGGACATTGACCAATGTATCA
CTGCTATTTGTCAACCCTTAGAAATCATCTATGATGCTAACACGATCAAC
CATATCATTAGTTTCTTCAAACCTCCTGAACATGTTATCTTGCAAGATTT
ACAAGACAAAGCGTATTCTACTTTCGAAGATTTTAAAGTTTCAAGTACGG
CTGGTCTTCTACATGCTATGGAACAAAGAACGGTTATGGACATCGACATT
GATGTTGGAGCATCTCATTTGATCATCCCTGAAAAAGGTTCTTACAATGG
TTGTACAGATATGCTGGTGATCGACTTTGGTAAAATCACGATGAGCAGCG
ATCCTAGTCAAATCAGACACCTTGACCCTAAGGACATTGAGGATGTGAAT
GAAGTACAAAGCAAAGCTTATGATCGATTCTTGTTGTCGCTTCAAGCTCT
TCAAATATTACTCGTTAGAGAAGGTGAAGATTTAAAGAGTGCTAAAAGCA
ACGTCAGTAAAGCTTCATCACACATTTTGCATCCCATCAATTTCGATGGC
AAACTTGCCAAAGCTATACTTCCACAAGATCCACGTTTAAAACAGATATG
TGTCTCTGGTGAATTATCTTCGCTGTTTGTTTCTGTATCGGATGATAAAG
TCAGTCGTCTCATCAAGCTAGCAGACTCGATACCACTCCCTCAATCACCT
TCTCACGATAACATCGACGGAGAAGAAAAACCTGAAGGACTCTTCACCAA
GGCGTTGTCAATGATAAGCTTGACAGGTGACAATGACACAGGGGTGGACA
TCGGAGGATTTTCCATCCCTGTACCGACATCTCCAACATCAGTGACGTCA
GATGAAGATGAATACGGGACACCACCTGATGGCTCCATATTACAGTTACA
ACAAGAAGCTGGTCCGGACTTTTCATCAGGAGTGGCGAACCAAGTCAAAG
TGGACTTGAACTTTAAAATCCATAAAGTGATGATCGCCATTGGTTTGACT
GACAAAGCATTGAAACAGGAAAAAGAATGTCTGAAATTCATCGTGGACGA
CATCAATACAGAGgtGATACTACGAAGATGGGATTTGTTCGTCAATGCAG
AAGTTGGTCGTCTGGTGTTGAATGAAATGACATGGGGTGTTGATGGAGAA
CCTTTCGCCATCATGAGTACacccaaaaacaccaaaatgttGAAATTCAG
CTATCGGAGGTGTGAATTCAACGAAAGTTTGAATCTCGGTCCAAGTTACT
TTTATTCCAAAGAAGCGCAAGTCAGAGCTTTACATTTCAAAGATGAATTT
GGCGCCACGGATCAGATTTTAGATGTACAAGTGGCTACTTTATTTCTGAT
GCTTCATCAAGAAGCACTTTTGAGCATCATGTCATTGATCTACCAAGTAC
TGGAACCACTCAACAAACATGATAAGGAAGCCACACAGAAGATCAAACGG
AGTTTGAGTACGGCAGGTAGTCGTTTGAGTCTCTCCatcgaagaaaaaga
aaaggagaGACAGATACAACGAAAATTAGCCAACCCTAAAGCACTGGAAG
CTGCCAACGAACTTAAGCAACAGGTTGGcttagaagaagaaaaaaagatg
aGAGTGACCGCCCACCTGGATGGTGTTGGTATCATGATTTGTTCAGCCAA
AGTTGACCTTGCACAAGCCTTCGTTAAAGGGTTATCTGCTAAAGTACTGA
TGAAAGATGACTTATTAGAAGTGAAAGCCAGCATGAAAGATATGCAAGTA
CAAGATAATGTTGGCGAAACAAAGTACAAAGACATCATTAGCATGCGATC
TGATGAAGTGTTCGATTTAGAGTTGGCTATTTACGAGAATGGATCTTCTG
GTAGCAAGCAATACGATATGTCGTGTGTCGACACCAGTGTCAAACTGAAC
TTCGGTCAAATGCGCGTTGTTTTCTTGTATAGATTCATACAAGACTTAAT
GTCATTCACCGAAAACTTCGAAGAAGCACAGAAAGCAGTTGTGGAAGCTG
GTAAAGCTGCCAAGGATAAAGCTCTGGAAACAGCGACCGATTTGAATAGA
CATTCTTCTCGTGTCAAACTAAATGTGGTTCTGAAAGCACCGACTATTAT
CATTCCAGTTGGATCAAACAATGAATTGGCTTTACTGGTGGATCTGGGTG
AATTGCGTATTTACAACACATTCAAACTCCTCAACGATGATCAATACCAT
AAGAAATCTATCATCACTGATAACATGACCATTAAGTTATCCAATCTGAA
ATTGTTAAAAGCACTTATTCAAGATGGTAAAGATTTCTTGCATCAACGAG
CCATTATTGAACCTATGATGCTACAAATAACTATTGTTCGTAATTTAACG
AAAGGTAACCATTCCATACCGGATGTTTCAGTTCAAGCAAAGATGCCAGC
TATTCTGTTATCAATCAGTGAAGAAGATGTGACCGTAGCTCTAAAGATTG
TCCAAGGGAATCTCGCCGAAGGTGAGTCACATGCGCCGAAGAAGCAAGCC
AAGCCTGCCAAACAAACGTTAAACGTGCCACAAGATCGTTTAGCAGACAT
TTACGAGGAGcctgaagatgaagatgagaaTCGACAAGGATATCTTCAAA
CCAAACTATCCTTCGATCTGGCTAAAATTGACATCAAGCTTTACTTGAAA
CCATCTGATATGACATTTGAAGATGAATTTTTAGCGAGGACGGATGATTT
GTTGTTAGCTTTGTTCACTATTGGTAACCTGTGTGTTGATGGAGACATCA
TGTCCACGCAAGCTATGAAGATGAGCGTTCGATTGGACACTTTGGTGTTG
GATGATATGAGACCTATCGAGGAGCATGAAGGTGTTAAACGTATGATCAA
CTACAGTCCCGAGCCACTCCTTGAAGAAGTCAAAACCTCTTCTCATAAAC
GACCAATCGACAACTCACGAATGATCGAAATCCAAttcgatcaaacttca
tcgcaagataaaaatatcgacATCAAACTTTGTAACATGCTTTGTATATT
CAACGTTGAGTTTATCATGGTCCTGTTGAAAACGTTGCAAGCTGCCATAC
CTAAAGATGATAGTCTGCAACATGGCCATTCAATGAGTAGTCTAGACTCG
GCGGCAGGGTCTGGCGGCAGCGATGACGAGGACTCTTTAGAAGCCAGCGA
GATTGTCCTCTGCACTGGTGATCAAGAAAGACCTGAGACTAAAGTCTCTA
TCTTCGTCCATAACCCGCAAATTGTTTTACTAGCAGATGCAAAGGATGTC
AAAACAAATGCACTCTTTCTTACAACCGagatcaattttcaatatttcga
aTTGCGAGATACTCAAAAAATGATTGGCGCTGTTTCTAACACCGCTATTT
TGTCAACTGCTTTCAAGAATGACCATCGGAGTGATATATCAACAGTGTTG
TCATTAGATTCCATCAATCTCCACTCGTCATCACCCATCAATGGTAAACC
TCATATGAGTGTCAGCACAACTTTGATCAAACTGAATATCTCACCCAAAA
CCATCCGAACTTTATCAGCGTGTGCTGGTTACATCTCCAATGATCCAACA
GATGAAGAAATCAAAGAAGCTCGAAAAGCCATGCGTGATTTATGGCAAAT
TCAAACGTTCACCAATAAGCGACCGTGGTATTTAAACCACCCACCACAAC
AAGTCTTAAGTGCTGGCAGCTTCGTCCTTGCGCGAACGAGAACAGGAGAA
TATAAGCATGGTTTCTTAGCTAAAAAGGATGTCTCGTATCAAGTCTATTT
TTCAGAGGAGCGAGGAACAGCCAGTCACCGAGCCATGGATATCTCATCTG
TTGTTTTGGATATCGTACCGCTGATCGGTGATCTATGTGTTGGATGTAAT
GTTTTAGCTGTGGAATCGAAAGAACATGGATATCGTACTGGTCGAATTAC
TCAGGTTTGGGATTCGAATGTGGATAAAGATTCTTCGGATGGCGCCAAAC
AATCTGTTTCTGTCAAGACAACTGCTATTGCTCCAATCAAATACCTTGTC
AATTTCTATGACAACCAAACGGAGAACTTCTTCCCGCCTGATGAACTTCG
TATCATTGGTAAACCCATCAAGGGGGTTGTCCCTGGACTAGGGGCGTGTG
TTTACGCCCGCTTTAATGATGGTTTTTACTATCGGGGCAAAGTTGATGAC
ATCGAGGATTATCGAATCCGAGTGCAATTGGATGAGATCAGTGGAGAAAT
CGAACACGACATCGATGATCCGTCAGCCGTTATTTTGAACCTGACGCCTC
AATACCGTCAAGTCAAAAAGCATTTCAAAGTCATTGCATCCAAAGGAAGC
ACAACTAAAGGATATCATCCGGGGAAAGTGACCGCCATCCAAGGTGAAGG
AAATAACCGATTGTATTCGATACGCTTCGAAGACGGTACAATTAACCAAG
TACCCATCacgaaattgattttgatgccAAAAGCACCTTTTGATGCTTTA
CCTGAAGTTGGCACATACGTTTATTCCCGAGTGTCACGCGACGCTCCTTT
ATACGAGAAGGGTATCGTAGCAGAGAAGAACACAATGATCTGCGTTAAAC
ATTTAAATGGACGGAAATTGGCTCACGAAATACAAAACATTCATTTTGTT
GTCCGAAATATCGTTCCTCTCGTGTCATCAttgaagGTTGGTTTGGACGT
CATAGTGCAACCTGACAATGACGATCAGAAAATGTATTTGGCTGTCATTA
GGGAAGTCACCAAAAAAGAAGGTGACAAAACGAACCGTTATCTAGTGGAG
TTTACGGATGGATCCAAGAAGAGAGTGACGCCCAGCCGGATCCGTATACT
TTCTCAATACGGAAGTGCAGAAACGAGTGAAGAAAATGCTGACATTATCA
CAACAAGACAGGAGGAACTAGTTCTCGATGTGCAAGGTATCTCATTACGT
GTGGAAGGTTACTTGGGAGGCGTGTTGACACCCATGCTCAAAATGGATTC
CAAAATCACAGCTAACTTGAAGGATTGGTCAAGCCAAATGAATGCACACG
CTACTGTATCATTAGAAGCCAGTTATTATAACGAAAACGTTGCCGAATGG
GAGCCAGTTATTGAACCTTTGATGGAGAAACGGAGGGAAAGACCGTGGCA
ACTCTCTGTCAATTACACGATGGAAGGTGACGACAATTCTGCTTCATCCA
CTTCCAACGAACTCGTTTTACAAAAACCGGAATCCAACCTGAAAATCAAA
TCTCAAGATAATCTTGAATTGACAATTTCAAAATCATGTCTTGCTTTACT
CGGTGAATTGGGACAGGTGTTTGGAGATGCAGTAGAATCTGTGGACGTTT
TACCACAAGTCCTGGTCGAAAAAGAACCTTTCATGATCGAAAACTTGCTC
TCCAAGAAGGTGACAGTAACATTGAATGAACTTCTGCAGGGACCAAATGG
AGATTCGACAATCGAGCTAGCATCTTCTTCGAATCCTGTTGGCATTACTT
TTGCTCCCAagaaatttgagaaacgaaAGACCAACGATCTATACACAATC
AATTTAtcgGTGGACGGTTTTCATGACATTAAAGACATTGTGGTTCAAAG
AAAGCGAAGCGTTATCTATGATCTTGTACCAATAAAACTATTATCAGCAC
AGTCTTCATATTCGATAGTGGTACAAGTGAAGACAACAGACGGACAACGT
ATCATCGTACTCCGATCACCATTGCAGTTGAAAAATCACTTTCCAATGCC
GTTGGATGTCAGCTACATTTCCAAAGAAAACCAACCAGTTAAACTGACAA
CAGTGGGATCGGGAGATATCTATTCCTTCCCTTTGTTGTTAACCTACCAC
AGTGTTTTTCATCTCAAACCTGCTGGTTTCGACTACGGTGATTGCACAGA
AGCTCTCAATTGGAGTGATTTGAAGACGAGCAACGAAAAACAGTTCTCCT
GCCCTTCACCTGACAAAAGTGCTGACCCTTTCTACATGCAGGTGGTGATG
AAAGAGGAGACGTACTCTTCCGTACACGGCATGTTGGACTGTGTACCACG
TTACACGTTGGAGTGCTTTCCCGTCATCACGCTGCATAATTACCTACCTT
GCACTATTAATTATAAGATCAAGGGTATGGCGAAATCGGAAAGTCTACCA
GGCGGACACAATTGGCCTTTGTTTACCGTCAACTTCAGTGATAAACCTTC
CATCTATATCGAGATTGAGTCGTATAACAACCAAAGATGGGAAGGAGGTT
TGACATTACCAACAAAACCGGTAGATTCTTTGAACAAACCATCATTATCT
TTCGTCATGATGTCTGGTGAACGCAAAATGGAATTGGGTGTTTATTACCA
GTTAGACGGTTCATTGAACATCACCTTATATTCGCCTTACTGGCTTCTCA
ATAAAACTGGAAAACCACTTGTCTATCAGCCAGCGGGGAGCAGCATCCAG
CAAGTTCACCAAGAGAACGATGTAAATGCTCTTATGATGCTCGTCAAAGG
GAAACATAAAAAGgcgaaagtgaaagtgaaaaataGCGAGTCATGGTCAA
ATGAATTTTCATTGGATACTGTTGGCAGTGGTGGTTCCTTGAAATGCAAT
GGTCCAAGAGATCGAGTTTATGAGATTGGTTTGAACATCAGTTTGTCATA
CTTTGGATTGACGAAGATTGTGACGTTCACGCCACTCCGAATGTTATCTA
ACCACACCAAGTACACCATCAGTATGGCAGAAAGTAATTCTAAATCGTCA
GAATGGCACACGGTAAACCCTGACGAGaacattccatTCTGGCCGACGAA
ACTTCCTTTGGTCAACCTTTACATTAACATCAATGGGCAAGATTCAGTGA
AATTCAACCCTGAAGTTGGAAAAACTTTACTGTTGAAGTTCCAGAATGAG
GTTGGAGGAGTTTGCGTGGATTACCAAGAAAAGGACTCGTCCTCAGTCCT
TTCGTTTAATCCGTACTTCGCAGGTGCAGCTCCTGTGCGGCttgaaaatc
tttgcaaaaaGATCGGCATGATCGCTTATAAACAAGCAGGTTCGGTAATG
GGTCACGTGTTAACACATGACCAATCAGTGTTGTACACGTGGGATGATCC
AACCATGGAACAAGAATTGATTTGTTCCATTGTCAATGATGAAGCCAGTG
AAACAAGGATCAAACTCGATGCCAACGATTTCGGACGAATGAGAGTTGGA
GATGGTGCAATTTATTGGGTTTCCTTTCTGGATGGTCTTCAACGTGTTCT
ATTGTTCACTGATAACTTCAAATCTGCTTACTGCGCATGTCAGgaGCAAA
ATTTACGCCCAACCATGGAAGTTGACTTTGAGATTGAGAGTTTTGGTTTG
TCTCTGGTCAATGTTGATAAGAGAATGGAGATTGGCTACTTAGCTATCCG
ACAAAGCAAGACTGTATGGGAGCAACGCAAGAAAAAGAACCGCTGGAAAG
CTTTACCGCTTGCCATGTGTGAAGCTCTCGAAGAAGGTTATCTCAATTAT
CAAAACAGAAAAGGTGCAGTCAAAGAGAAAGTTCTGGATAAGGAGGTGGA
TTACGAGAAGATGTTTATTACGAAACCTGAGAAGATTAAGATCAGAAGAA
CGTACCACAGCGGTCTTGGTTTCAAATACACAATCTCACCCAATGAAATG
CGTGTGCATGCTTCTATCAGCTCAATACAGTTGGATAGCCATGTTCCAGG
TTCGACCTTTCCAACAGTCTTGCATATGGTTGAACCACCAAAATCTGTTG
CTTCAGAAAACGCTCCAAAGCCATTCTttgaattgagtttaatgaCAAGG
ATCGGTGATAAAAATGTGGTCAATGAAGTcagCTATTGTCACGTGTTGAT
TCAAGAGATGGATGTGAGGGTTGATATTGGATTTTTATTGGCTCTGATGG
AACTCTTCAGTCATGCAAGAGCTCGAACAACCGAGAAAGAACAATACGCG
CTTGATATTGGCCAAGCAGCAACAAAGTTTGAAGAAAGCGCTGAATTTCA
GGCAGCCAAACAAGATCGATATTACGTTTTGAACGACTTTCATTTATCAC
CGCTAAAGATTCACGTCAGTTTCTCTTTGACGGGTGGTTCCAAAGATGAA
AATGCTATTGCTTCATTACATGGTAACGTGTTGAACTTGTTGTTACAAAG
TGTCGGACTGGCCTTCACTGAAATACAAGACGTACAATTCAAATTAGCAT
GTTACGAAGTGCATAAGTCCATGCAGAGTAATTCGCAGCTCGGTGATGGA
ATAACTAAACATTATCAAACACAGGCTATCAAGCAACTTTATGTGTTGGT
ACTCGGGCTAGACGTTCTTGGTAATCCGTATGGTTTGATATCTGGTGTTG
GAACCGGAGCAAAGAATTTCTTCTACGAACCTTACCAGGGATTAATTCAA
GGACCAGAAGAATTTGCGGAAGGATTGGCGTATGGGGTGAAGAGTCTTGT
TGGTGGAACCGTGGGTGGAGTATCAGGAGCTGTGAGTAAGATTACCGGTA
CCTTCGGTAAAGGTTTGGCTGCATTGACCTTGGATGAAGAATATCAACAA
AAGAGACGTGAAAACATGAGCCAACGCCCAACTAACCTCGGTGAAGGTCT
CGCCAAAGGTGGTAAAGGCCTTGTAAAGGGTATCGTGTCTGGTGTTACAG
GGATCGTTACCAAACCCTATGAAGGTGCCAAGAATGATGGTGCAGGTGGC
TTTTTTAAGGGCGTTGGAAAAGGCCTGATTGGCGTGGTTGCACGCCCTGT
TGGTGGAGTGGTAGATATGGCCAGTAACACGTTTGATGGTTTGAAAAGCA
CGACATCTGGCGTGAAAGCGATCGAGTTGAGCCGTGTTACTCGCGTCTTC
CACGCAGATAAGGTTTTACGACCTTTCAATCTGTACGAAGCAGATGGAAA
CAAAATTCTTATGCAATGTAACAAAGGAGAATACGCCAAGAAGAATTTTT
ATATCACTCATGTAGTGGACAAGAAGAACTATCTCATCCTCACTCAATCa
aacATTTTGTATGTTGGAAAGAACGAGTTGAAAATGGGTGAATGGGAATC
ggtttgggttatcgagttcaATGAGCTAAAACGTGAACCAGAAGTGAAAG
AGACAAAGATTATTTTCCATATCCATAATACGGACACGCGACGTTCAATT
TTCAAGAAATCGACGAACACACGTGAAGTGATATTGGAGTCTAGTGCTGT
TGCAGACTGGTTTATCTTAAAGCTTAGAGATGCTAAAATGTTATAGatgg
tatttgaaTCTTTGGTTGCTGACCTCTTGAACAAGTATCTGGGTCAATAT
GTGAAAAATCTTGATGCTTCTCAATTGAAGATTGGCATTTGGGGAGGAAA
TGTTGTCCTGACAGAACTTGAACTGAAAGATACAGCTCTGGATGATCTTG
ACTTACCCATAAAAGTTGTTCGTGGATATTTGGgtAAATTGGTCTTGTCC
ATCCCATGGAAAAATCTTTACACTGAATCAACTGTTGTCGATATTCAAGA
TCTCCACCTTGTCGCTAAGCCTAATTTTGACATCAAATACAATGAAGAAC
gcgaagaaaaatcaaaacatgacAAGAAACAACAACAGATTCACAATATC
GAAGAAGCGAGGCAAAGAGAAGAAGACAAAAAGAAAGGCGCCAAGAAAGA
AGAGAGTGACGGTTTTGCTGAGAAACTTGCAACAAACGTCATAAAAAATC
TACAGGTTACGATCAAGAACATACATGTTCGATATGAAGACTCAATCAGT
GATGTGAATGGACCCTTTTCAGTCGGTCTTACAATGGAAAGTTTAACAGC
ACAAACCACAGATGAAGATTTTGTTCCAAAGATTATCAAAGAATCTGTCT
CATTAATTCATAAGatggTGAAATTAGACAATTTGGCTTTATATTGGAAT
CCAGGAGACGAACTGATTGATCCTTCACTTGATACCAAGCAATGGTTGga
agtTTCAACGAAGCAAATTTCAACACACCAATCGAAGCCAGAGAAAACGA
AATATATTTTGAGTCCCATGGTTGCAACGAAGAAATTGAAGCTGAACACC
AAACCAGGTTCCAACCTTGACATCCCGAAGatgttTTTGAACTTGGTTTT
GGAAGAACTTGGTATCATCGTGGCAAGAAGTCAATATCATGGCGTGGTGC
AACTGATTGAATCATTTGAACGAATGAATAGGAACCAACCTTTTCGTAAA
TACAGACCACATACCTCCGTTCTTGGGAACGAAAGTATTTGGTGGAAGTA
CTGCATGTCCAGCATACTGGAGGTGGATGTCAAAAGACGATCTCAAATGT
GGAGCTGGAAGCATATTCAAAAACATCGAGTTCTTTGCAAAGCTTACAAA
GTGAAGTAcaaggaaaaattgaaacagaaaaATCCATCCAAACAAATTCT
CACTGAACTAGAGaGCATGGAGGATGAGTTGAATATTGCAAGCATCACCA
TTTTTCGACAGCTTGCAGCTACAGAGGTTTTAACGGAACAAAAGAAGAAA
GGCACTAAAGGAAGTTTCTTCAGTTTCTTCTCCAGATCAAAAGAACCAGA
AAAGTCTGCTGCTAATAAAATTGGAGATTTAATGGGTGATGACCAGGAGA
AGGAAATGCAGAAATTGTATGACGCAATCGGTTATACTGAAAATGAAGTC
ATCACTCCCTTTCCTAAAGAGTACGTGGCGATGTCAGTGGAATCGATTCT
CCAGAAATTATTCATCAGCCTCATCGATGACACAGATAAGGCGAAAGAAT
TCAAAGTGTTGGATTTTTCACTCAACAACATCATTGTAGAAGTTTTCCAA
AGACCTTCTGCTCAAGCTCTCAAATTATGTGCAAAGATAGGAGAGATGAA
GTTATTTGGTACAGCTTCTGCTCAATGTACACCTCtcatcatcaaaaaca
tgttaCAAGGTCGAGGTATGGAATTTCTGCCGTTGGTGGACTTCATCTTT
GAGACGAATCCTTTGAAGAAACCGGACATTGACCAATGTATCACTGCTAT
TTGTCAACCCTTAGAAATCATCTATGATGCTAACACGATCAACCATATCA
TTAGTTTCTTCAAACCTCCTGAACATGTTATCTTGCAAGATTTACAAGAC
AAAGCGTATTCTACTTTCGAAGATTTTAAAGTTTCAAGTACGGCTGGTCT
TCTACATGCTATGGAACAAAGAACGGTTATGGACATCGACATTGATGTTG
GAGCATCTCATTTGATCATCCCTGAAAAAGGTTCTTACAATGGTTGTACA
GATATGCTGGTGATCGACTTTGGTAAAATCACGATGAGCAGCGATCCTAG
TCAAATCAGACACCTTGACCCTAAGGACATTGAGGATGTGAATGAAGTAC
AAAGCAAAGCTTATGATCGATTCTTGTTGTCGCTTCAAGCTCTTCAAATA
TTACTCGTTAGAGAAGGTGAAGATTTAAAGAGTGCTAAAAGCAACGTCAG
TAAAGCTTCATCACACATTTTGCATCCCATCAATTTCGATGGCAAACTTG
CCAAAGCTATACTTCCACAAGATCCACGTTTAAAACAGATATGTGTCTCT
GGTGAATTATCTTCGCTGTTTGTTTCTGTATCGGATGATAAAGTCAGTCG
TCTCATCAAGCTAGCAGACTCGATACCACTCCCTCAATCACCTTCTCACG
ATAACATCGACGGAGAAGAAAAACCTGAAGGACTCTTCACCAAGGCGTTG
TCAATGATAAGCTTGACAGGTGACAATGACACAGGGGTGGACATCGGAGG
ATTTTCCATCCCTGTACCGACATCTCCAACATCAGTGACGTCAGATGAAG
ATGAATACGGGACACCACCTGATGGCTCCATATTACAGTTACAACAAGAA
GCTGGTCCGGACTTTTCATCAGGAGTGGCGAACCAAGTCAAAGTGGACTT
GAACTTTAAAATCCATAAAGTGATGATCGCCATTGGTTTGACTGACAAAG
CATTGAAACAGGAAAAAGAATGTCTGAAATTCATCGTGGACGACATCAAT
ACAGAGgtGATACTACGAAGATGGGATTTGTTCGTCAATGCAGAAGTTGG
TCGTCTGGTGTTGAATGAAATGACATGGGGTGTTGATGGAGAACCTTTCG
CCATCATGAGTACacccaaaaacaccaaaatgttGAAATTCAGCTATCGG
AGGTGTGAATTCAACGAAAGTTTGAATCTCGGTCCAAGTTACTTTTATTC
CAAAGAAGCGCAAGTCAGAGCTTTACATTTCAAAGATGAATTTGGCGCCA
CGGATCAGATTTTAGATGTACAAGTGGCTACTTTATTTCTGATGCTTCAT
CAAGAAGCACTTTTGAGCATCATGTCATTGATCTACCAAGTACTGGAACC
ACTCAACAAACATGATAAGGAAGCCACACAGAAGATCAAACGGAGTTTGA
GTACGGCAGGTAGTCGTTTGAGTCTCTCCatcgaagaaaaagaaaaggag
aGACAGATACAACGAAAATTAGCCAACCCTAAAGCACTGGAAGCTGCCAA
CGAACTTAAGCAACAGGTTGGcttagaagaagaaaaaaagatgaGAGTGA
CCGCCCACCTGGATGGTGTTGGTATCATGATTTGTTCAGCCAAAGTTGAC
CTTGCACAAGCCTTCGTTAAAGGGTTATCTGCTAAAGTACTGATGAAAGA
TGACTTATTAGAAGTGAAAGCCAGCATGAAAGATATGCAAGTACAAGATA
ATGTTGGCGAAACAAAGTACAAAGACATCATTAGCATGCGATCTGATGAA
GTGTTCGATTTAGAGTTGGCTATTTACGAGAATGGATCTTCTGGTAGCAA
GCAATACGATATGTCGTGTGTCGACACCAGTGTCAAACTGAACTTCGGTC
AAATGCGCGTTGTTTTCTTGTATAGATTCATACAAGACTTAATGTCATTC
ACCGAAAACTTCGAAGAAGCACAGAAAGCAGTTGTGGAAGCTGGTAAAGC
TGCCAAGGATAAAGCTCTGGAAACAGCGACCGATTTGAATAGACATTCTT
CTCGTGTCAAACTAAATGTGGTTCTGAAAGCACCGACTATTATCATTCCA
GTTGGATCAAACAATGAATTGGCTTTACTGGTGGATCTGGGTGAATTGCG
TATTTACAACACATTCAAACTCCTCAACGATGATCAATACCATAAGAAAT
CTATCATCACTGATAACATGACCATTAAGTTATCCAATCTGAAATTGTTA
AAAGCACTTATTCAAGATGGTAAAGATTTCTTGCATCAACGAGCCATTAT
TGAACCTATGATGCTACAAATAACTATTGTTCGTAATTTAACGAAAGGTA
ACCATTCCATACCGGATGTTTCAGTTCAAGCAAAGATGCCAGCTATTCTG
TTATCAATCAGTGAAGAAGATGTGACCGTAGCTCTAAAGATTGTCCAAGG
GAATCTCGCCGAAGGTGAGTCACATGCGCCGAAGAAGCAAGCCAAGCCTG
CCAAACAAACGTTAAACGTGCCACAAGATCGTTTAGCAGACATTTACGAG
GAGcctgaagatgaagatgagaaTCGACAAGGATATCTTCAAACCAAACT
ATCCTTCGATCTGGCTAAAATTGACATCAAGCTTTACTTGAAACCATCTG
ATATGACATTTGAAGATGAATTTTTAGCGAGGACGGATGATTTGTTGTTA
GCTTTGTTCACTATTGGTAACCTGTGTGTTGATGGAGACATCATGTCCAC
GCAAGCTATGAAGATGAGCGTTCGATTGGACACTTTGGTGTTGGATGATA
TGAGACCTATCGAGGAGCATGAAGGTGTTAAACGTATGATCAACTACAGT
CCCGAGCCACTCCTTGAAGAAGTCAAAACCTCTTCTCATAAACGACCAAT
CGACAACTCACGAATGATCGAAATCCAAttcgatcaaacttcatcgcaag
ataaaaatatcgacATCAAACTTTGTAACATGCTTTGTATATTCAACGTT
GAGTTTATCATGGTCCTGTTGAAAACGTTGCAAGCTGCCATACCTAAAGA
TGATAGTCTGCAACATGGCCATTCAATGAGTAGTCTAGACTCGGCGGCAG
GGTCTGGCGGCAGCGATGACGAGGACTCTTTAGAAGCCAGCGAGATTGTC
CTCTGCACTGGTGATCAAGAAAGACCTGAGACTAAAGTCTCTATCTTCGT
CCATAACCCGCAAATTGTTTTACTAGCAGATGCAAAGGATGTCAAAACAA
ATGCACTCTTTCTTACAACCGagatcaattttcaatatttcgaaTTGCGA
GATACTCAAAAAATGATTGGCGCTGTTTCTAACACCGCTATTTTGTCAAC
TGCTTTCAAGAATGACCATCGGAGTGATATATCAACAGTGTTGTCATTAG
ATTCCATCAATCTCCACTCGTCATCACCCATCAATGGTAAACCTCATATG
AGTGTCAGCACAACTTTGATCAAACTGAATATCTCACCCAAAACCATCCG
AACTTTATCAGCGTGTGCTGGTTACATCTCCAATGATCCAACAGATGAAG
AAATCAAAGAAGCTCGAAAAGCCATGCGTGATTTATGGCAAATTCAAACG
TTCACCAATAAGCGACCGTGGTATTTAAACCACCCACCACAACAAGTCTT
AAGTGCTGGCAGCTTCGTCCTTGCGCGAACGAGAACAGGAGAATATAAGC
ATGGTTTCTTAGCTAAAAAGGATGTCTCGTATCAAGTCTATTTTTCAGAG
GAGCGAGGAACAGCCAGTCACCGAGCCATGGATATCTCATCTGTTGTTTT
GGATATCGTACCGCTGATCGGTGATCTATGTGTTGGATGTAATGTTTTAG
CTGTGGAATCGAAAGAACATGGATATCGTACTGGTCGAATTACTCAGGTT
TGGGATTCGAATGTGGATAAAGATTCTTCGGATGGCGCCAAACAATCTGT
TTCTGTCAAGACAACTGCTATTGCTCCAATCAAATACCTTGTCAATTTCT
ATGACAACCAAACGGAGAACTTCTTCCCGCCTGATGAACTTCGTATCATT
GGTAAACCCATCAAGGGGGTTGTCCCTGGACTAGGGGCGTGTGTTTACGC
CCGCTTTAATGATGGTTTTTACTATCGGGGCAAAGTTGATGACATCGAGG
ATTATCGAATCCGAGTGCAATTGGATGAGATCAGTGGAGAAATCGAACAC
GACATCGATGATCCGTCAGCCGTTATTTTGAACCTGACGCCTCAATACCG
TCAAGTCAAAAAGCATTTCAAAGTCATTGCATCCAAAGGAAGCACAACTA
AAGGATATCATCCGGGGAAAGTGACCGCCATCCAAGGTGAAGGAAATAAC
CGATTGTATTCGATACGCTTCGAAGACGGTACAATTAACCAAGTACCCAT
CacgaaattgattttgatgccAAAAGCACCTTTTGATGCTTTACCTGAAG
TTGGCACATACGTTTATTCCCGAGTGTCACGCGACGCTCCTTTATACGAG
AAGGGTATCGTAGCAGAGAAGAACACAATGATCTGCGTTAAACATTTAAA
TGGACGGAAATTGGCTCACGAAATACAAAACATTCATTTTGTTGTCCGAA
ATATCGTTCCTCTCGTGTCATCAttgaagGTTGGTTTGGACGTCATAGTG
CAACCTGACAATGACGATCAGAAAATGTATTTGGCTGTCATTAGGGAAGT
CACCAAAAAAGAAGGTGACAAAACGAACCGTTATCTAGTGGAGTTTACGG
ATGGATCCAAGAAGAGAGTGACGCCCAGCCGGATCCGTATACTTTCTCAA
TACGGAAGTGCAGAAACGAGTGAAGAAAATGCTGACATTATCACAACAAG
ACAGGAGGAACTAGTTCTCGATGTGCAAGGTATCTCATTACGTGTGGAAG
GTTACTTGGGAGGCGTGTTGACACCCATGCTCAAAATGGATTCCAAAATC
ACAGCTAACTTGAAGGATTGGTCAAGCCAAATGAATGCACACGCTACTGT
ATCATTAGAAGCCAGTTATTATAACGAAAACGTTGCCGAATGGGAGCCAG
TTATTGAACCTTTGATGGAGAAACGGAGGGAAAGACCGTGGCAACTCTCT
GTCAATTACACGATGGAAGGTGACGACAATTCTGCTTCATCCACTTCCAA
CGAACTCGTTTTACAAAAACCGGAATCCAACCTGAAAATCAAATCTCAAG
ATAATCTTGAATTGACAATTTCAAAATCATGTCTTGCTTTACTCGGTGAA
TTGGGACAGGTGTTTGGAGATGCAGTAGAATCTGTGGACGTTTTACCACA
AGTCCTGGTCGAAAAAGAACCTTTCATGATCGAAAACTTGCTCTCCAAGA
AGGTGACAGTAACATTGAATGAACTTCTGCAGGGACCAAATGGAGATTCG
ACAATCGAGCTAGCATCTTCTTCGAATCCTGTTGGCATTACTTTTGCTCC
CAagaaatttgagaaacgaaAGACCAACGATCTATACACAATCAATTTAt
cgGTGGACGGTTTTCATGACATTAAAGACATTGTGGTTCAAAGAAAGCGA
AGCGTTATCTATGATCTTGTACCAATAAAACTATTATCAGCACAGTCTTC
ATATTCGATAGTGGTACAAGTGAAGACAACAGACGGACAACGTATCATCG
TACTCCGATCACCATTGCAGTTGAAAAATCACTTTCCAATGCCGTTGGAT
GTCAGCTACATTTCCAAAGAAAACCAACCAGTTAAACTGACAACAGTGGG
ATCGGGAGATATCTATTCCTTCCCTTTGTTGTTAACCTACCACAGTGTTT
TTCATCTCAAACCTGCTGGTTTCGACTACGGTGATTGCACAGAAGCTCTC
AATTGGAGTGATTTGAAGACGAGCAACGAAAAACAGTTCTCCTGCCCTTC
ACCTGACAAAAGTGCTGACCCTTTCTACATGCAGGTGGTGATGAAAGAGG
AGACGTACTCTTCCGTACACGGCATGTTGGACTGTGTACCACGTTACACG
TTGGAGTGCTTTCCCGTCATCACGCTGCATAATTACCTACCTTGCACTAT
TAATTATAAGATCAAGGGTATGGCGAAATCGGAAAGTCTACCAGGCGGAC
ACAATTGGCCTTTGTTTACCGTCAACTTCAGTGATAAACCTTCCATCTAT
ATCGAGATTGAGTCGTATAACAACCAAAGATGGGAAGGAGGTTTGACATT
ACCAACAAAACCGGTAGATTCTTTGAACAAACCATCATTATCTTTCGTCA
TGATGTCTGGTGAACGCAAAATGGAATTGGGTGTTTATTACCAGTTAGAC
GGTTCATTGAACATCACCTTATATTCGCCTTACTGGCTTCTCAATAAAAC
TGGAAAACCACTTGTCTATCAGCCAGCGGGGAGCAGCATCCAGCAAGTTC
ACCAAGAGAACGATGTAAATGCTCTTATGATGCTCGTCAAAGGGAAACAT
AAAAAGgcgaaagtgaaagtgaaaaataGCGAGTCATGGTCAAATGAATT
TTCATTGGATACTGTTGGCAGTGGTGGTTCCTTGAAATGCAATGGTCCAA
GAGATCGAGTTTATGAGATTGGTTTGAACATCAGTTTGTCATACTTTGGA
TTGACGAAGATTGTGACGTTCACGCCACTCCGAATGTTATCTAACCACAC
CAAGTACACCATCAGTATGGCAGAAAGTAATTCTAAATCGTCAGAATGGC
ACACGGTAAACCCTGACGAGaacattccatTCTGGCCGACGAAACTTCCT
TTGGTCAACCTTTACATTAACATCAATGGGCAAGATTCAGTGAAATTCAA
CCCTGAAGTTGGAAAAACTTTACTGTTGAAGTTCCAGAATGAGGTTGGAG
GAGTTTGCGTGGATTACCAAGAAAAGGACTCGTCCTCAGTCCTTTCGTTT
AATCCGTACTTCGCAGGTGCAGCTCCTGTGCGGCttgaaaatctttgcaa
aaaGATCGGCATGATCGCTTATAAACAAGCAGGTTCGGTAATGGGTCACG
TGTTAACACATGACCAATCAGTGTTGTACACGTGGGATGATCCAACCATG
GAACAAGAATTGATTTGTTCCATTGTCAATGATGAAGCCAGTGAAACAAG
GATCAAACTCGATGCCAACGATTTCGGACGAATGAGAGTTGGAGATGGTG
CAATTTATTGGGTTTCCTTTCTGGATGGTCTTCAACGTGTTCTATTGTTC
ACTGATAACTTCAAATCTGCTTACTGCGCATGTCAGgaGCAAAATTTACG
CCCAACCATGGAAGTTGACTTTGAGATTGAGAGTTTTGGTTTGTCTCTGG
TCAATGTTGATAAGAGAATGGAGATTGGCTACTTAGCTATCCGACAAAGC
AAGACTGTATGGGAGCAACGCAAGAAAAAGAACCGCTGGAAAGCTTTACC
GCTTGCCATGTGTGAAGCTCTCGAAGAAGGTTATCTCAATTATCAAAACA
GAAAAGGTGCAGTCAAAGAGAAAGTTCTGGATAAGGAGGTGGATTACGAG
AAGATGTTTATTACGAAACCTGAGAAGATTAAGATCAGAAGAACGTACCA
CAGCGGTCTTGGTTTCAAATACACAATCTCACCCAATGAAATGCGTGTGC
ATGCTTCTATCAGCTCAATACAGTTGGATAGCCATGTTCCAGGTTCGACC
TTTCCAACAGTCTTGCATATGGTTGAACCACCAAAATCTGTTGCTTCAGA
AAACGCTCCAAAGCCATTCTttgaattgagtttaatgaCAAGGATCGGTG
ATAAAAATGTGGTCAATGAAGTcagCTATTGTCACGTGTTGATTCAAGAG
ATGGATGTGAGGGTTGATATTGGATTTTTATTGGCTCTGATGGAACTCTT
CAGTCATGCAAGAGCTCGAACAACCGAGAAAGAACAATACGCGCTTGATA
TTGGCCAAGCAGCAACAAAGTTTGAAGAAAGCGCTGAATTTCAGGCAGCC
AAACAAGATCGATATTACGTTTTGAACGACTTTCATTTATCACCGCTAAA
GATTCACGTCAGTTTCTCTTTGACGGGTGGTTCCAAAGATGAAAATGCTA
TTGCTTCATTACATGGTAACGTGTTGAACTTGTTGTTACAAAGTGTCGGA
CTGGCCTTCACTGAAATACAAGACGTACAATTCAAATTAGCATGTTACGA
AGTGCATAAGTCCATGCAGAGTAATTCGCAGCTCGGTGATGGAATAACTA
AACATTATCAAACACAGGCTATCAAGCAACTTTATGTGTTGGTACTCGGG
CTAGACGTTCTTGGTAATCCGTATGGTTTGATATCTGGTGTTGGAACCGG
AGCAAAGAATTTCTTCTACGAACCTTACCAGGGATTAATTCAAGGACCAG
AAGAATTTGCGGAAGGATTGGCGTATGGGGTGAAGAGTCTTGTTGGTGGA
ACCGTGGGTGGAGTATCAGGAGCTGTGAGTAAGATTACCGGTACCTTCGG
TAAAGGTTTGGCTGCATTGACCTTGGATGAAGAATATCAACAAAAGAGAC
GTGAAAACATGAGCCAACGCCCAACTAACCTCGGTGAAGGTCTCGCCAAA
GGTGGTAAAGGCCTTGTAAAGGGTATCGTGTCTGGTGTTACAGGGATCGT
TACCAAACCCTATGAAGGTGCCAAGAATGATGGTGCAGGTGGCTTTTTTA
AGGGCGTTGGAAAAGGCCTGATTGGCGTGGTTGCACGCCCTGTTGGTGGA
GTGGTAGATATGGCCAGTAACACGTTTGATGGTTTGAAAAGCACGACATC
TGGCGTGAAAGCGATCGAGTTGAGCCGTGTTACTCGCGTCTTCCACGCAG
ATAAGGTTTTACGACCTTTCAATCTGTACGAAGCAGATGGAAACAAAATT
CTTATGCAATGTAACAAAGGAGAATACGCCAAGAAGAATTTTTATATCAC
TCATGTAGTGGACAAGAAGAACTATCTCATCCTCACTCAATCaaacATTT
TGTATGTTGGAAAGAACGAGTTGAAAATGGGTGAATGGGAATCggtttgg
gttatcgagttcaATGAGCTAAAACGTGAACCAGAAGTGAAAGAGACAAA
GATTATTTTCCATATCCATAATACGGACACGCGACGTTCAATTTTCAAGA
AATCGACGAACACACGTGAAGTGATATTGGAGTCTAGTGCTGTTGCAGAC
TGGTTTATCTTAAAGCTTAGAGATGCTAAAATGTTATAGatggtatttga
aTCTTTGGTTGCTGACCTCTTGAACAAGTATCTGGGTCAATATGTGAAAA
ATCTTGATGCTTCTCAATTGAAGATTGGCATTTGGGGAGGAAATGTTGTC
CTGACAGAACTTGAACTGAAAGATACAGCTCTGGATGATCTTGACTTACC
CATAAAAGTTGTTCGTGGATATTTGGgtAAATTGGTCTTGTCCATCCCAT
GGAAAAATCTTTACACTGAATCAACTGTTGTCGATATTCAAGATCTCCAC
CTTGTCGCTAAGCCTAATTTTGACATCAAATACAATGAAGAACgcgaaga
aaaatcaaaacatgacAAGAAACAACAACAGATTCACAATATCGAAGAAG
CGAGGCAAAGAGAAGAAGACAAAAAGAAAGGCGCCAAGAAAGAAGAGAGT
GACGGTTTTGCTGAGAAACTTGCAACAAACGTCATAAAAAATCTACAGGT
TACGATCAAGAACATACATGTTCGATATGAAGACTCAATCAGTGATGTGA
ATGGACCCTTTTCAGTCGGTCTTACAATGGAAAGTTTAACAGCACAAACC
ACAGATGAAGATTTTGTTCCAAAGATTATCAAAGAATCTGTCTCATTAAT
TCATAAGatggTGAAATTAGACAATTTGGCTTTATATTGGAATCCAGGAG
ACGAACTGATTGATCCTTCACTTGATACCAAGCAATGGTTGgaagtTTCA
ACGAAGCAAATTTCAACACACCAATCGAAGCCAGAGAAAACGAAATATAT
TTTGAGTCCCATGGTTGCAACGAAGAAATTGAAGCTGAACACCAAACCAG
GTTCCAACCTTGACATCCCGAAGatgttTTTGAACTTGGTTTTGGAAGAA
CTTGGTATCATCGTGGCAAGAAGTCAATATCATGGCGTGGTGCAACTGAT
TGAATCATTTGAACGAATGAATAGGAACCAACCTTTTCGTAAATACAGAC
CACATACCTCCGTTCTTGGGAACGAAAGTATTTGGTGGAAGTACTGCATG
TCCAGCATACTGGAGGTGGATGTCAAAAGACGATCTCAAATGTGGAGCTG
GAAGCATATTCAAAAACATCGAGTTCTTTGCAAAGCTTACAAAGTGAAGT
AcaaggaaaaattgaaacagaaaaATCCATCCAAACAAATTCTCACTGAA
CTAGAGaGCATGGAGGATGAGTTGAATATTGCAAGCATCACCATTTTTCG
ACAGCTTGCAGCTACAGAGGTTTTAACGGAACAAAAGAAGAAAGGCACTA
AAGGAAGTTTCTTCAGTTTCTTCTCCAGATCAAAAGAACCAGAAAAGTCT
GCTGCTAATAAAATTGGAGATTTAATGGGTGATGACCAGGAGAAGGAAAT
GCAGAAATTGTATGACGCAATCGGTTATACTGAAAATGAAGTCATCACTC
CCTTTCCTAAAGAGTACGTGGCGATGTCAGTGGAATCGATTCTCCAGAAA
TTATTCATCAGCCTCATCGATGACACAGATAAGGCGAAAGAATTCAAAGT
GTTGGATTTTTCACTCAACAACATCATTGTAGAAGTTTTCCAAAGACCTT
CTGCTCAAGCTCTCAAATTATGTGCAAAGATAGGAGAGATGAAGTTATTT
GGTACAGCTTCTGCTCAATGTACACCTCtcatcatcaaaaacatgttaCA
AGGTCGAGGTATGGAATTTCTGCCGTTGGTGGACTTCATCTTTGAGACGA
ATCCTTTGAAGAAACCGGACATTGACCAATGTATCACTGCTATTTGTCAA
CCCTTAGAAATCATCTATGATGCTAACACGATCAACCATATCATTAGTTT
CTTCAAACCTCCTGAACATGTTATCTTGCAAGATTTACAAGACAAAGCGT
ATTCTACTTTCGAAGATTTTAAAGTTTCAAGTACGGCTGGTCTTCTACAT
GCTATGGAACAAAGAACGGTTATGGACATCGACATTGATGTTGGAGCATC
TCATTTGATCATCCCTGAAAAAGGTTCTTACAATGGTTGTACAGATATGC
TGGTGATCGACTTTGGTAAAATCACGATGAGCAGCGATCCTAGTCAAATC
AGACACCTTGACCCTAAGGACATTGAGGATGTGAATGAAGTACAAAGCAA
AGCTTATGATCGATTCTTGTTGTCGCTTCAAGCTCTTCAAATATTACTCG
TTAGAGAAGGTGAAGATTTAAAGAGTGCTAAAAGCAACGTCAGTAAAGCT
TCATCACACATTTTGCATCCCATCAATTTCGATGGCAAACTTGCCAAAGC
TATACTTCCACAAGATCCACGTTTAAAACAGATATGTGTCTCTGGTGAAT
TATCTTCGCTGTTTGTTTCTGTATCGGATGATAAAGTCAGTCGTCTCATC
AAGCTAGCAGACTCGATACCACTCCCTCAATCACCTTCTCACGATAACAT
CGACGGAGAAGAAAAACCTGAAGGACTCTTCACCAAGGCGTTGTCAATGA
TAAGCTTGACAGGTGACAATGACACAGGGGTGGACATCGGAGGATTTTCC
ATCCCTGTACCGACATCTCCAACATCAGTGACGTCAGATGAAGATGAATA
CGGGACACCACCTGATGGCTCCATATTACAGTTACAACAAGAAGCTGGTC
CGGACTTTTCATCAGGAGTGGCGAACCAAGTCAAAGTGGACTTGAACTTT
AAAATCCATAAAGTGATGATCGCCATTGGTTTGACTGACAAAGCATTGAA
ACAGGAAAAAGAATGTCTGAAATTCATCGTGGACGACATCAATACAGAGg
tGATACTACGAAGATGGGATTTGTTCGTCAATGCAGAAGTTGGTCGTCTG
GTGTTGAATGAAATGACATGGGGTGTTGATGGAGAACCTTTCGCCATCAT
GAGTACacccaaaaacaccaaaatgttGAAATTCAGCTATCGGAGGTGTG
AATTCAACGAAAGTTTGAATCTCGGTCCAAGTTACTTTTATTCCAAAGAA
GCGCAAGTCAGAGCTTTACATTTCAAAGATGAATTTGGCGCCACGGATCA
GATTTTAGATGTACAAGTGGCTACTTTATTTCTGATGCTTCATCAAGAAG
CACTTTTGAGCATCATGTCATTGATCTACCAAGTACTGGAACCACTCAAC
AAACATGATAAGGAAGCCACACAGAAGATCAAACGGAGTTTGAGTACGGC
AGGTAGTCGTTTGAGTCTCTCCatcgaagaaaaagaaaaggagaGACAGA
TACAACGAAAATTAGCCAACCCTAAAGCACTGGAAGCTGCCAACGAACTT
AAGCAACAGGTTGGcttagaagaagaaaaaaagatgaGAGTGACCGCCCA
CCTGGATGGTGTTGGTATCATGATTTGTTCAGCCAAAGTTGACCTTGCAC
AAGCCTTCGTTAAAGGGTTATCTGCTAAAGTACTGATGAAAGATGACTTA
TTAGAAGTGAAAGCCAGCATGAAAGATATGCAAGTACAAGATAATGTTGG
CGAAACAAAGTACAAAGACATCATTAGCATGCGATCTGATGAAGTGTTCG
ATTTAGAGTTGGCTATTTACGAGAATGGATCTTCTGGTAGCAAGCAATAC
GATATGTCGTGTGTCGACACCAGTGTCAAACTGAACTTCGGTCAAATGCG
CGTTGTTTTCTTGTATAGATTCATACAAGACTTAATGTCATTCACCGAAA
ACTTCGAAGAAGCACAGAAAGCAGTTGTGGAAGCTGGTAAAGCTGCCAAG
GATAAAGCTCTGGAAACAGCGACCGATTTGAATAGACATTCTTCTCGTGT
CAAACTAAATGTGGTTCTGAAAGCACCGACTATTATCATTCCAGTTGGAT
CAAACAATGAATTGGCTTTACTGGTGGATCTGGGTGAATTGCGTATTTAC
AACACATTCAAACTCCTCAACGATGATCAATACCATAAGAAATCTATCAT
CACTGATAACATGACCATTAAGTTATCCAATCTGAAATTGTTAAAAGCAC
TTATTCAAGATGGTAAAGATTTCTTGCATCAACGAGCCATTATTGAACCT
ATGATGCTACAAATAACTATTGTTCGTAATTTAACGAAAGGTAACCATTC
CATACCGGATGTTTCAGTTCAAGCAAAGATGCCAGCTATTCTGTTATCAA
TCAGTGAAGAAGATGTGACCGTAGCTCTAAAGATTGTCCAAGGGAATCTC
GCCGAAGGTGAGTCACATGCGCCGAAGAAGCAAGCCAAGCCTGCCAAACA
AACGTTAAACGTGCCACAAGATCGTTTAGCAGACATTTACGAGGAGcctg
aagatgaagatgagaaTCGACAAGGATATCTTCAAACCAAACTATCCTTC
GATCTGGCTAAAATTGACATCAAGCTTTACTTGAAACCATCTGATATGAC
ATTTGAAGATGAATTTTTAGCGAGGACGGATGATTTGTTGTTAGCTTTGT
TCACTATTGGTAACCTGTGTGTTGATGGAGACATCATGTCCACGCAAGCT
ATGAAGATGAGCGTTCGATTGGACACTTTGGTGTTGGATGATATGAGACC
TATCGAGGAGCATGAAGGTGTTAAACGTATGATCAACTACAGTCCCGAGC
CACTCCTTGAAGAAGTCAAAACCTCTTCTCATAAACGACCAATCGACAAC
TCACGAATGATCGAAATCCAAttcgatcaaacttcatcgcaagataaaaa
tatcgacATCAAACTTTGTAACATGCTTTGTATATTCAACGTTGAGTTTA
TCATGGTCCTGTTGAAAACGTTGCAAGCTGCCATACCTAAAGATGATAGT
CTGCAACATGGCCATTCAATGAGTAGTCTAGACTCGGCGGCAGGGTCTGG
CGGCAGCGATGACGAGGACTCTTTAGAAGCCAGCGAGATTGTCCTCTGCA
CTGGTGATCAAGAAAGACCTGAGACTAAAGTCTCTATCTTCGTCCATAAC
CCGCAAATTGTTTTACTAGCAGATGCAAAGGATGTCAAAACAAATGCACT
CTTTCTTACAACCGagatcaattttcaatatttcgaaTTGCGAGATACTC
AAAAAATGATTGGCGCTGTTTCTAACACCGCTATTTTGTCAACTGCTTTC
AAGAATGACCATCGGAGTGATATATCAACAGTGTTGTCATTAGATTCCAT
CAATCTCCACTCGTCATCACCCATCAATGGTAAACCTCATATGAGTGTCA
GCACAACTTTGATCAAACTGAATATCTCACCCAAAACCATCCGAACTTTA
TCAGCGTGTGCTGGTTACATCTCCAATGATCCAACAGATGAAGAAATCAA
AGAAGCTCGAAAAGCCATGCGTGATTTATGGCAAATTCAAACGTTCACCA
ATAAGCGACCGTGGTATTTAAACCACCCACCACAACAAGTCTTAAGTGCT
GGCAGCTTCGTCCTTGCGCGAACGAGAACAGGAGAATATAAGCATGGTTT
CTTAGCTAAAAAGGATGTCTCGTATCAAGTCTATTTTTCAGAGGAGCGAG
GAACAGCCAGTCACCGAGCCATGGATATCTCATCTGTTGTTTTGGATATC
GTACCGCTGATCGGTGATCTATGTGTTGGATGTAATGTTTTAGCTGTGGA
ATCGAAAGAACATGGATATCGTACTGGTCGAATTACTCAGGTTTGGGATT
CGAATGTGGATAAAGATTCTTCGGATGGCGCCAAACAATCTGTTTCTGTC
AAGACAACTGCTATTGCTCCAATCAAATACCTTGTCAATTTCTATGACAA
CCAAACGGAGAACTTCTTCCCGCCTGATGAACTTCGTATCATTGGTAAAC
CCATCAAGGGGGTTGTCCCTGGACTAGGGGCGTGTGTTTACGCCCGCTTT
AATGATGGTTTTTACTATCGGGGCAAAGTTGATGACATCGAGGATTATCG
AATCCGAGTGCAATTGGATGAGATCAGTGGAGAAATCGAACACGACATCG
ATGATCCGTCAGCCGTTATTTTGAACCTGACGCCTCAATACCGTCAAGTC
AAAAAGCATTTCAAAGTCATTGCATCCAAAGGAAGCACAACTAAAGGATA
TCATCCGGGGAAAGTGACCGCCATCCAAGGTGAAGGAAATAACCGATTGT
ATTCGATACGCTTCGAAGACGGTACAATTAACCAAGTACCCATCacgaaa
ttgattttgatgccAAAAGCACCTTTTGATGCTTTACCTGAAGTTGGCAC
ATACGTTTATTCCCGAGTGTCACGCGACGCTCCTTTATACGAGAAGGGTA
TCGTAGCAGAGAAGAACACAATGATCTGCGTTAAACATTTAAATGGACGG
AAATTGGCTCACGAAATACAAAACATTCATTTTGTTGTCCGAAATATCGT
TCCTCTCGTGTCATCAttgaagGTTGGTTTGGACGTCATAGTGCAACCTG
ACAATGACGATCAGAAAATGTATTTGGCTGTCATTAGGGAAGTCACCAAA
AAAGAAGGTGACAAAACGAACCGTTATCTAGTGGAGTTTACGGATGGATC
CAAGAAGAGAGTGACGCCCAGCCGGATCCGTATACTTTCTCAATACGGAA
GTGCAGAAACGAGTGAAGAAAATGCTGACATTATCACAACAAGACAGGAG
GAACTAGTTCTCGATGTGCAAGGTATCTCATTACGTGTGGAAGGTTACTT
GGGAGGCGTGTTGACACCCATGCTCAAAATGGATTCCAAAATCACAGCTA
ACTTGAAGGATTGGTCAAGCCAAATGAATGCACACGCTACTGTATCATTA
GAAGCCAGTTATTATAACGAAAACGTTGCCGAATGGGAGCCAGTTATTGA
ACCTTTGATGGAGAAACGGAGGGAAAGACCGTGGCAACTCTCTGTCAATT
ACACGATGGAAGGTGACGACAATTCTGCTTCATCCACTTCCAACGAACTC
GTTTTACAAAAACCGGAATCCAACCTGAAAATCAAATCTCAAGATAATCT
TGAATTGACAATTTCAAAATCATGTCTTGCTTTACTCGGTGAATTGGGAC
AGGTGTTTGGAGATGCAGTAGAATCTGTGGACGTTTTACCACAAGTCCTG
GTCGAAAAAGAACCTTTCATGATCGAAAACTTGCTCTCCAAGAAGGTGAC
AGTAACATTGAATGAACTTCTGCAGGGACCAAATGGAGATTCGACAATCG
AGCTAGCATCTTCTTCGAATCCTGTTGGCATTACTTTTGCTCCCAagaaa
tttgagaaacgaaAGACCAACGATCTATACACAATCAATTTAtcgGTGGA
CGGTTTTCATGACATTAAAGACATTGTGGTTCAAAGAAAGCGAAGCGTTA
TCTATGATCTTGTACCAATAAAACTATTATCAGCACAGTCTTCATATTCG
ATAGTGGTACAAGTGAAGACAACAGACGGACAACGTATCATCGTACTCCG
ATCACCATTGCAGTTGAAAAATCACTTTCCAATGCCGTTGGATGTCAGCT
ACATTTCCAAAGAAAACCAACCAGTTAAACTGACAACAGTGGGATCGGGA
GATATCTATTCCTTCCCTTTGTTGTTAACCTACCACAGTGTTTTTCATCT
CAAACCTGCTGGTTTCGACTACGGTGATTGCACAGAAGCTCTCAATTGGA
GTGATTTGAAGACGAGCAACGAAAAACAGTTCTCCTGCCCTTCACCTGAC
AAAAGTGCTGACCCTTTCTACATGCAGGTGGTGATGAAAGAGGAGACGTA
CTCTTCCGTACACGGCATGTTGGACTGTGTACCACGTTACACGTTGGAGT
GCTTTCCCGTCATCACGCTGCATAATTACCTACCTTGCACTATTAATTAT
AAGATCAAGGGTATGGCGAAATCGGAAAGTCTACCAGGCGGACACAATTG
GCCTTTGTTTACCGTCAACTTCAGTGATAAACCTTCCATCTATATCGAGA
TTGAGTCGTATAACAACCAAAGATGGGAAGGAGGTTTGACATTACCAACA
AAACCGGTAGATTCTTTGAACAAACCATCATTATCTTTCGTCATGATGTC
TGGTGAACGCAAAATGGAATTGGGTGTTTATTACCAGTTAGACGGTTCAT
TGAACATCACCTTATATTCGCCTTACTGGCTTCTCAATAAAACTGGAAAA
CCACTTGTCTATCAGCCAGCGGGGAGCAGCATCCAGCAAGTTCACCAAGA
GAACGATGTAAATGCTCTTATGATGCTCGTCAAAGGGAAACATAAAAAGg
cgaaagtgaaagtgaaaaataGCGAGTCATGGTCAAATGAATTTTCATTG
GATACTGTTGGCAGTGGTGGTTCCTTGAAATGCAATGGTCCAAGAGATCG
AGTTTATGAGATTGGTTTGAACATCAGTTTGTCATACTTTGGATTGACGA
AGATTGTGACGTTCACGCCACTCCGAATGTTATCTAACCACACCAAGTAC
ACCATCAGTATGGCAGAAAGTAATTCTAAATCGTCAGAATGGCACACGGT
AAACCCTGACGAGaacattccatTCTGGCCGACGAAACTTCCTTTGGTCA
ACCTTTACATTAACATCAATGGGCAAGATTCAGTGAAATTCAACCCTGAA
GTTGGAAAAACTTTACTGTTGAAGTTCCAGAATGAGGTTGGAGGAGTTTG
CGTGGATTACCAAGAAAAGGACTCGTCCTCAGTCCTTTCGTTTAATCCGT
ACTTCGCAGGTGCAGCTCCTGTGCGGCttgaaaatctttgcaaaaaGATC
GGCATGATCGCTTATAAACAAGCAGGTTCGGTAATGGGTCACGTGTTAAC
ACATGACCAATCAGTGTTGTACACGTGGGATGATCCAACCATGGAACAAG
AATTGATTTGTTCCATTGTCAATGATGAAGCCAGTGAAACAAGGATCAAA
CTCGATGCCAACGATTTCGGACGAATGAGAGTTGGAGATGGTGCAATTTA
TTGGGTTTCCTTTCTGGATGGTCTTCAACGTGTTCTATTGTTCACTGATA
ACTTCAAATCTGCTTACTGCGCATGTCAGgaGCAAAATTTACGCCCAACC
ATGGAAGTTGACTTTGAGATTGAGAGTTTTGGTTTGTCTCTGGTCAATGT
TGATAAGAGAATGGAGATTGGCTACTTAGCTATCCGACAAAGCAAGACTG
TATGGGAGCAACGCAAGAAAAAGAACCGCTGGAAAGCTTTACCGCTTGCC
ATGTGTGAAGCTCTCGAAGAAGGTTATCTCAATTATCAAAACAGAAAAGG
TGCAGTCAAAGAGAAAGTTCTGGATAAGGAGGTGGATTACGAGAAGATGT
TTATTACGAAACCTGAGAAGATTAAGATCAGAAGAACGTACCACAGCGGT
CTTGGTTTCAAATACACAATCTCACCCAATGAAATGCGTGTGCATGCTTC
TATCAGCTCAATACAGTTGGATAGCCATGTTCCAGGTTCGACCTTTCCAA
CAGTCTTGCATATGGTTGAACCACCAAAATCTGTTGCTTCAGAAAACGCT
CCAAAGCCATTCTttgaattgagtttaatgaCAAGGATCGGTGATAAAAA
TGTGGTCAATGAAGTcagCTATTGTCACGTGTTGATTCAAGAGATGGATG
TGAGGGTTGATATTGGATTTTTATTGGCTCTGATGGAACTCTTCAGTCAT
GCAAGAGCTCGAACAACCGAGAAAGAACAATACGCGCTTGATATTGGCCA
AGCAGCAACAAAGTTTGAAGAAAGCGCTGAATTTCAGGCAGCCAAACAAG
ATCGATATTACGTTTTGAACGACTTTCATTTATCACCGCTAAAGATTCAC
GTCAGTTTCTCTTTGACGGGTGGTTCCAAAGATGAAAATGCTATTGCTTC
ATTACATGGTAACGTGTTGAACTTGTTGTTACAAAGTGTCGGACTGGCCT
TCACTGAAATACAAGACGTACAATTCAAATTAGCATGTTACGAAGTGCAT
AAGTCCATGCAGAGTAATTCGCAGCTCGGTGATGGAATAACTAAACATTA
TCAAACACAGGCTATCAAGCAACTTTATGTGTTGGTACTCGGGCTAGACG
TTCTTGGTAATCCGTATGGTTTGATATCTGGTGTTGGAACCGGAGCAAAG
AATTTCTTCTACGAACCTTACCAGGGATTAATTCAAGGACCAGAAGAATT
TGCGGAAGGATTGGCGTATGGGGTGAAGAGTCTTGTTGGTGGAACCGTGG
GTGGAGTATCAGGAGCTGTGAGTAAGATTACCGGTACCTTCGGTAAAGGT
TTGGCTGCATTGACCTTGGATGAAGAATATCAACAAAAGAGACGTGAAAA
CATGAGCCAACGCCCAACTAACCTCGGTGAAGGTCTCGCCAAAGGTGGTA
AAGGCCTTGTAAAGGGTATCGTGTCTGGTGTTACAGGGATCGTTACCAAA
CCCTATGAAGGTGCCAAGAATGATGGTGCAGGTGGCTTTTTTAAGGGCGT
TGGAAAAGGCCTGATTGGCGTGGTTGCACGCCCTGTTGGTGGAGTGGTAG
ATATGGCCAGTAACACGTTTGATGGTTTGAAAAGCACGACATCTGGCGTG
AAAGCGATCGAGTTGAGCCGTGTTACTCGCGTCTTCCACGCAGATAAGGT
TTTACGACCTTTCAATCTGTACGAAGCAGATGGAAACAAAATTCTTATGC
AATGTAACAAAGGAGAATACGCCAAGAAGAATTTTTATATCACTCATGTA
GTGGACAAGAAGAACTATCTCATCCTCACTCAATCaaacATTTTGTATGT
TGGAAAGAACGAGTTGAAAATGGGTGAATGGGAATCggtttgggttatcg
agttcaATGAGCTAAAACGTGAACCAGAAGTGAAAGAGACAAAGATTATT
TTCCATATCCATAATACGGACACGCGACGTTCAATTTTCAAGAAATCGAC
GAACACACGTGAAGTGATATTGGAGTCTAGTGCTGTTGCAGACTGGTTTA
TCTTAAAGCTTAGAGATGCTAAAATGTTATAGatggtatttgaaTCTTTG
GTTGCTGACCTCTTGAACAAGTATCTGGGTCAATATGTGAAAAATCTTGA
TGCTTCTCAATTGAAGATTGGCATTTGGGGAGGAAATGTTGTCCTGACAG
AACTTGAACTGAAAGATACAGCTCTGGATGATCTTGACTTACCCATAAAA
GTTGTTCGTGGATATTTGGgtAAATTGGTCTTGTCCATCCCATGGAAAAA
TCTTTACACTGAATCAACTGTTGTCGATATTCAAGATCTCCACCTTGTCG
CTAAGCCTAATTTTGACATCAAATACAATGAAGAACgcgaagaaaaatca
aaacatgacAAGAAACAACAACAGATTCACAATATCGAAGAAGCGAGGCA
AAGAGAAGAAGACAAAAAGAAAGGCGCCAAGAAAGAAGAGAGTGACGGTT
TTGCTGAGAAACTTGCAACAAACGTCATAAAAAATCTACAGGTTACGATC
AAGAACATACATGTTCGATATGAAGACTCAATCAGTGATGTGAATGGACC
CTTTTCAGTCGGTCTTACAATGGAAAGTTTAACAGCACAAACCACAGATG
AAGATTTTGTTCCAAAGATTATCAAAGAATCTGTCTCATTAATTCATAAG
atggTGAAATTAGACAATTTGGCTTTATATTGGAATCCAGGAGACGAACT
GATTGATCCTTCACTTGATACCAAGCAATGGTTGgaagtTTCAACGAAGC
AAATTTCAACACACCAATCGAAGCCAGAGAAAACGAAATATATTTTGAGT
CCCATGGTTGCAACGAAGAAATTGAAGCTGAACACCAAACCAGGTTCCAA
CCTTGACATCCCGAAGatgttTTTGAACTTGGTTTTGGAAGAACTTGGTA
TCATCGTGGCAAGAAGTCAATATCATGGCGTGGTGCAACTGATTGAATCA
TTTGAACGAATGAATAGGAACCAACCTTTTCGTAAATACAGACCACATAC
CTCCGTTCTTGGGAACGAAAGTATTTGGTGGAAGTACTGCATGTCCAGCA
TACTGGAGGTGGATGTCAAAAGACGATCTCAAATGTGGAGCTGGAAGCAT
ATTCAAAAACATCGAGTTCTTTGCAAAGCTTACAAAGTGAAGTAcaagga
aaaattgaaacagaaaaATCCATCCAAACAAATTCTCACTGAACTAGAGa
GCATGGAGGATGAGTTGAATATTGCAAGCATCACCATTTTTCGACAGCTT
GCAGCTACAGAGGTTTTAACGGAACAAAAGAAGAAAGGCACTAAAGGAAG
TTTCTTCAGTTTCTTCTCCAGATCAAAAGAACCAGAAAAGTCTGCTGCTA
ATAAAATTGGAGATTTAATGGGTGATGACCAGGAGAAGGAAATGCAGAAA
TTGTATGACGCAATCGGTTATACTGAAAATGAAGTCATCACTCCCTTTCC
TAAAGAGTACGTGGCGATGTCAGTGGAATCGATTCTCCAGAAATTATTCA
TCAGCCTCATCGATGACACAGATAAGGCGAAAGAATTCAAAGTGTTGGAT
TTTTCACTCAACAACATCATTGTAGAAGTTTTCCAAAGACCTTCTGCTCA
AGCTCTCAAATTATGTGCAAAGATAGGAGAGATGAAGTTATTTGGTACAG
CTTCTGCTCAATGTACACCTCtcatcatcaaaaacatgttaCAAGGTCGA
GGTATGGAATTTCTGCCGTTGGTGGACTTCATCTTTGAGACGAATCCTTT
GAAGAAACCGGACATTGACCAATGTATCACTGCTATTTGTCAACCCTTAG
AAATCATCTATGATGCTAACACGATCAACCATATCATTAGTTTCTTCAAA
CCTCCTGAACATGTTATCTTGCAAGATTTACAAGACAAAGCGTATTCTAC
TTTCGAAGATTTTAAAGTTTCAAGTACGGCTGGTCTTCTACATGCTATGG
AACAAAGAACGGTTATGGACATCGACATTGATGTTGGAGCATCTCATTTG
ATCATCCCTGAAAAAGGTTCTTACAATGGTTGTACAGATATGCTGGTGAT
CGACTTTGGTAAAATCACGATGAGCAGCGATCCTAGTCAAATCAGACACC
TTGACCCTAAGGACATTGAGGATGTGAATGAAGTACAAAGCAAAGCTTAT
GATCGATTCTTGTTGTCGCTTCAAGCTCTTCAAATATTACTCGTTAGAGA
AGGTGAAGATTTAAAGAGTGCTAAAAGCAACGTCAGTAAAGCTTCATCAC
ACATTTTGCATCCCATCAATTTCGATGGCAAACTTGCCAAAGCTATACTT
CCACAAGATCCACGTTTAAAACAGATATGTGTCTCTGGTGAATTATCTTC
GCTGTTTGTTTCTGTATCGGATGATAAAGTCAGTCGTCTCATCAAGCTAG
CAGACTCGATACCACTCCCTCAATCACCTTCTCACGATAACATCGACGGA
GAAGAAAAACCTGAAGGACTCTTCACCAAGGCGTTGTCAATGATAAGCTT
GACAGGTGACAATGACACAGGGGTGGACATCGGAGGATTTTCCATCCCTG
TACCGACATCTCCAACATCAGTGACGTCAGATGAAGATGAATACGGGACA
CCACCTGATGGCTCCATATTACAGTTACAACAAGAAGCTGGTCCGGACTT
TTCATCAGGAGTGGCGAACCAAGTCAAAGTGGACTTGAACTTTAAAATCC
ATAAAGTGATGATCGCCATTGGTTTGACTGACAAAGCATTGAAACAGGAA
AAAGAATGTCTGAAATTCATCGTGGACGACATCAATACAGAGgtGATACT
ACGAAGATGGGATTTGTTCGTCAATGCAGAAGTTGGTCGTCTGGTGTTGA
ATGAAATGACATGGGGTGTTGATGGAGAACCTTTCGCCATCATGAGTACa
cccaaaaacaccaaaatgttGAAATTCAGCTATCGGAGGTGTGAATTCAA
CGAAAGTTTGAATCTCGGTCCAAGTTACTTTTATTCCAAAGAAGCGCAAG
TCAGAGCTTTACATTTCAAAGATGAATTTGGCGCCACGGATCAGATTTTA
GATGTACAAGTGGCTACTTTATTTCTGATGCTTCATCAAGAAGCACTTTT
GAGCATCATGTCATTGATCTACCAAGTACTGGAACCACTCAACAAACATG
ATAAGGAAGCCACACAGAAGATCAAACGGAGTTTGAGTACGGCAGGTAGT
CGTTTGAGTCTCTCCatcgaagaaaaagaaaaggagaGACAGATACAACG
AAAATTAGCCAACCCTAAAGCACTGGAAGCTGCCAACGAACTTAAGCAAC
AGGTTGGcttagaagaagaaaaaaagatgaGAGTGACCGCCCACCTGGAT
GGTGTTGGTATCATGATTTGTTCAGCCAAAGTTGACCTTGCACAAGCCTT
CGTTAAAGGGTTATCTGCTAAAGTACTGATGAAAGATGACTTATTAGAAG
TGAAAGCCAGCATGAAAGATATGCAAGTACAAGATAATGTTGGCGAAACA
AAGTACAAAGACATCATTAGCATGCGATCTGATGAAGTGTTCGATTTAGA
GTTGGCTATTTACGAGAATGGATCTTCTGGTAGCAAGCAATACGATATGT
CGTGTGTCGACACCAGTGTCAAACTGAACTTCGGTCAAATGCGCGTTGTT
TTCTTGTATAGATTCATACAAGACTTAATGTCATTCACCGAAAACTTCGA
AGAAGCACAGAAAGCAGTTGTGGAAGCTGGTAAAGCTGCCAAGGATAAAG
CTCTGGAAACAGCGACCGATTTGAATAGACATTCTTCTCGTGTCAAACTA
AATGTGGTTCTGAAAGCACCGACTATTATCATTCCAGTTGGATCAAACAA
TGAATTGGCTTTACTGGTGGATCTGGGTGAATTGCGTATTTACAACACAT
TCAAACTCCTCAACGATGATCAATACCATAAGAAATCTATCATCACTGAT
AACATGACCATTAAGTTATCCAATCTGAAATTGTTAAAAGCACTTATTCA
AGATGGTAAAGATTTCTTGCATCAACGAGCCATTATTGAACCTATGATGC
TACAAATAACTATTGTTCGTAATTTAACGAAAGGTAACCATTCCATACCG
GATGTTTCAGTTCAAGCAAAGATGCCAGCTATTCTGTTATCAATCAGTGA
AGAAGATGTGACCGTAGCTCTAAAGATTGTCCAAGGGAATCTCGCCGAAG
GTGAGTCACATGCGCCGAAGAAGCAAGCCAAGCCTGCCAAACAAACGTTA
AACGTGCCACAAGATCGTTTAGCAGACATTTACGAGGAGcctgaagatga
agatgagaaTCGACAAGGATATCTTCAAACCAAACTATCCTTCGATCTGG
CTAAAATTGACATCAAGCTTTACTTGAAACCATCTGATATGACATTTGAA
GATGAATTTTTAGCGAGGACGGATGATTTGTTGTTAGCTTTGTTCACTAT
TGGTAACCTGTGTGTTGATGGAGACATCATGTCCACGCAAGCTATGAAGA
TGAGCGTTCGATTGGACACTTTGGTGTTGGATGATATGAGACCTATCGAG
GAGCATGAAGGTGTTAAACGTATGATCAACTACAGTCCCGAGCCACTCCT
TGAAGAAGTCAAAACCTCTTCTCATAAACGACCAATCGACAACTCACGAA
TGATCGAAATCCAAttcgatcaaacttcatcgcaagataaaaatatcgac
ATCAAACTTTGTAACATGCTTTGTATATTCAACGTTGAGTTTATCATGGT
CCTGTTGAAAACGTTGCAAGCTGCCATACCTAAAGATGATAGTCTGCAAC
ATGGCCATTCAATGAGTAGTCTAGACTCGGCGGCAGGGTCTGGCGGCAGC
GATGACGAGGACTCTTTAGAAGCCAGCGAGATTGTCCTCTGCACTGGTGA
TCAAGAAAGACCTGAGACTAAAGTCTCTATCTTCGTCCATAACCCGCAAA
TTGTTTTACTAGCAGATGCAAAGGATGTCAAAACAAATGCACTCTTTCTT
ACAACCGagatcaattttcaatatttcgaaTTGCGAGATACTCAAAAAAT
GATTGGCGCTGTTTCTAACACCGCTATTTTGTCAACTGCTTTCAAGAATG
ACCATCGGAGTGATATATCAACAGTGTTGTCATTAGATTCCATCAATCTC
CACTCGTCATCACCCATCAATGGTAAACCTCATATGAGTGTCAGCACAAC
TTTGATCAAACTGAATATCTCACCCAAAACCATCCGAACTTTATCAGCGT
GTGCTGGTTACATCTCCAATGATCCAACAGATGAAGAAATCAAAGAAGCT
CGAAAAGCCATGCGTGATTTATGGCAAATTCAAACGTTCACCAATAAGCG
ACCGTGGTATTTAAACCACCCACCACAACAAGTCTTAAGTGCTGGCAGCT
TCGTCCTTGCGCGAACGAGAACAGGAGAATATAAGCATGGTTTCTTAGCT
AAAAAGGATGTCTCGTATCAAGTCTATTTTTCAGAGGAGCGAGGAACAGC
CAGTCACCGAGCCATGGATATCTCATCTGTTGTTTTGGATATCGTACCGC
TGATCGGTGATCTATGTGTTGGATGTAATGTTTTAGCTGTGGAATCGAAA
GAACATGGATATCGTACTGGTCGAATTACTCAGGTTTGGGATTCGAATGT
GGATAAAGATTCTTCGGATGGCGCCAAACAATCTGTTTCTGTCAAGACAA
CTGCTATTGCTCCAATCAAATACCTTGTCAATTTCTATGACAACCAAACG
GAGAACTTCTTCCCGCCTGATGAACTTCGTATCATTGGTAAACCCATCAA
GGGGGTTGTCCCTGGACTAGGGGCGTGTGTTTACGCCCGCTTTAATGATG
GTTTTTACTATCGGGGCAAAGTTGATGACATCGAGGATTATCGAATCCGA
GTGCAATTGGATGAGATCAGTGGAGAAATCGAACACGACATCGATGATCC
GTCAGCCGTTATTTTGAACCTGACGCCTCAATACCGTCAAGTCAAAAAGC
ATTTCAAAGTCATTGCATCCAAAGGAAGCACAACTAAAGGATATCATCCG
GGGAAAGTGACCGCCATCCAAGGTGAAGGAAATAACCGATTGTATTCGAT
ACGCTTCGAAGACGGTACAATTAACCAAGTACCCATCacgaaattgattt
tgatgccAAAAGCACCTTTTGATGCTTTACCTGAAGTTGGCACATACGTT
TATTCCCGAGTGTCACGCGACGCTCCTTTATACGAGAAGGGTATCGTAGC
AGAGAAGAACACAATGATCTGCGTTAAACATTTAAATGGACGGAAATTGG
CTCACGAAATACAAAACATTCATTTTGTTGTCCGAAATATCGTTCCTCTC
GTGTCATCAttgaagGTTGGTTTGGACGTCATAGTGCAACCTGACAATGA
CGATCAGAAAATGTATTTGGCTGTCATTAGGGAAGTCACCAAAAAAGAAG
GTGACAAAACGAACCGTTATCTAGTGGAGTTTACGGATGGATCCAAGAAG
AGAGTGACGCCCAGCCGGATCCGTATACTTTCTCAATACGGAAGTGCAGA
AACGAGTGAAGAAAATGCTGACATTATCACAACAAGACAGGAGGAACTAG
TTCTCGATGTGCAAGGTATCTCATTACGTGTGGAAGGTTACTTGGGAGGC
GTGTTGACACCCATGCTCAAAATGGATTCCAAAATCACAGCTAACTTGAA
GGATTGGTCAAGCCAAATGAATGCACACGCTACTGTATCATTAGAAGCCA
GTTATTATAACGAAAACGTTGCCGAATGGGAGCCAGTTATTGAACCTTTG
ATGGAGAAACGGAGGGAAAGACCGTGGCAACTCTCTGTCAATTACACGAT
GGAAGGTGACGACAATTCTGCTTCATCCACTTCCAACGAACTCGTTTTAC
AAAAACCGGAATCCAACCTGAAAATCAAATCTCAAGATAATCTTGAATTG
ACAATTTCAAAATCATGTCTTGCTTTACTCGGTGAATTGGGACAGGTGTT
TGGAGATGCAGTAGAATCTGTGGACGTTTTACCACAAGTCCTGGTCGAAA
AAGAACCTTTCATGATCGAAAACTTGCTCTCCAAGAAGGTGACAGTAACA
TTGAATGAACTTCTGCAGGGACCAAATGGAGATTCGACAATCGAGCTAGC
ATCTTCTTCGAATCCTGTTGGCATTACTTTTGCTCCCAagaaatttgaga
aacgaaAGACCAACGATCTATACACAATCAATTTAtcgGTGGACGGTTTT
CATGACATTAAAGACATTGTGGTTCAAAGAAAGCGAAGCGTTATCTATGA
TCTTGTACCAATAAAACTATTATCAGCACAGTCTTCATATTCGATAGTGG
TACAAGTGAAGACAACAGACGGACAACGTATCATCGTACTCCGATCACCA
TTGCAGTTGAAAAATCACTTTCCAATGCCGTTGGATGTCAGCTACATTTC
CAAAGAAAACCAACCAGTTAAACTGACAACAGTGGGATCGGGAGATATCT
ATTCCTTCCCTTTGTTGTTAACCTACCACAGTGTTTTTCATCTCAAACCT
GCTGGTTTCGACTACGGTGATTGCACAGAAGCTCTCAATTGGAGTGATTT
GAAGACGAGCAACGAAAAACAGTTCTCCTGCCCTTCACCTGACAAAAGTG
CTGACCCTTTCTACATGCAGGTGGTGATGAAAGAGGAGACGTACTCTTCC
GTACACGGCATGTTGGACTGTGTACCACGTTACACGTTGGAGTGCTTTCC
CGTCATCACGCTGCATAATTACCTACCTTGCACTATTAATTATAAGATCA
AGGGTATGGCGAAATCGGAAAGTCTACCAGGCGGACACAATTGGCCTTTG
TTTACCGTCAACTTCAGTGATAAACCTTCCATCTATATCGAGATTGAGTC
GTATAACAACCAAAGATGGGAAGGAGGTTTGACATTACCAACAAAACCGG
TAGATTCTTTGAACAAACCATCATTATCTTTCGTCATGATGTCTGGTGAA
CGCAAAATGGAATTGGGTGTTTATTACCAGTTAGACGGTTCATTGAACAT
CACCTTATATTCGCCTTACTGGCTTCTCAATAAAACTGGAAAACCACTTG
TCTATCAGCCAGCGGGGAGCAGCATCCAGCAAGTTCACCAAGAGAACGAT
GTAAATGCTCTTATGATGCTCGTCAAAGGGAAACATAAAAAGgcgaaagt
gaaagtgaaaaataGCGAGTCATGGTCAAATGAATTTTCATTGGATACTG
TTGGCAGTGGTGGTTCCTTGAAATGCAATGGTCCAAGAGATCGAGTTTAT
GAGATTGGTTTGAACATCAGTTTGTCATACTTTGGATTGACGAAGATTGT
GACGTTCACGCCACTCCGAATGTTATCTAACCACACCAAGTACACCATCA
GTATGGCAGAAAGTAATTCTAAATCGTCAGAATGGCACACGGTAAACCCT
GACGAGaacattccatTCTGGCCGACGAAACTTCCTTTGGTCAACCTTTA
CATTAACATCAATGGGCAAGATTCAGTGAAATTCAACCCTGAAGTTGGAA
AAACTTTACTGTTGAAGTTCCAGAATGAGGTTGGAGGAGTTTGCGTGGAT
TACCAAGAAAAGGACTCGTCCTCAGTCCTTTCGTTTAATCCGTACTTCGC
AGGTGCAGCTCCTGTGCGGCttgaaaatctttgcaaaaaGATCGGCATGA
TCGCTTATAAACAAGCAGGTTCGGTAATGGGTCACGTGTTAACACATGAC
CAATCAGTGTTGTACACGTGGGATGATCCAACCATGGAACAAGAATTGAT
TTGTTCCATTGTCAATGATGAAGCCAGTGAAACAAGGATCAAACTCGATG
CCAACGATTTCGGACGAATGAGAGTTGGAGATGGTGCAATTTATTGGGTT
TCCTTTCTGGATGGTCTTCAACGTGTTCTATTGTTCACTGATAACTTCAA
ATCTGCTTACTGCGCATGTCAGgaGCAAAATTTACGCCCAACCATGGAAG
TTGACTTTGAGATTGAGAGTTTTGGTTTGTCTCTGGTCAATGTTGATAAG
AGAATGGAGATTGGCTACTTAGCTATCCGACAAAGCAAGACTGTATGGGA
GCAACGCAAGAAAAAGAACCGCTGGAAAGCTTTACCGCTTGCCATGTGTG
AAGCTCTCGAAGAAGGTTATCTCAATTATCAAAACAGAAAAGGTGCAGTC
AAAGAGAAAGTTCTGGATAAGGAGGTGGATTACGAGAAGATGTTTATTAC
GAAACCTGAGAAGATTAAGATCAGAAGAACGTACCACAGCGGTCTTGGTT
TCAAATACACAATCTCACCCAATGAAATGCGTGTGCATGCTTCTATCAGC
TCAATACAGTTGGATAGCCATGTTCCAGGTTCGACCTTTCCAACAGTCTT
GCATATGGTTGAACCACCAAAATCTGTTGCTTCAGAAAACGCTCCAAAGC
CATTCTttgaattgagtttaatgaCAAGGATCGGTGATAAAAATGTGGTC
AATGAAGTcagCTATTGTCACGTGTTGATTCAAGAGATGGATGTGAGGGT
TGATATTGGATTTTTATTGGCTCTGATGGAACTCTTCAGTCATGCAAGAG
CTCGAACAACCGAGAAAGAACAATACGCGCTTGATATTGGCCAAGCAGCA
ACAAAGTTTGAAGAAAGCGCTGAATTTCAGGCAGCCAAACAAGATCGATA
TTACGTTTTGAACGACTTTCATTTATCACCGCTAAAGATTCACGTCAGTT
TCTCTTTGACGGGTGGTTCCAAAGATGAAAATGCTATTGCTTCATTACAT
GGTAACGTGTTGAACTTGTTGTTACAAAGTGTCGGACTGGCCTTCACTGA
AATACAAGACGTACAATTCAAATTAGCATGTTACGAAGTGCATAAGTCCA
TGCAGAGTAATTCGCAGCTCGGTGATGGAATAACTAAACATTATCAAACA
CAGGCTATCAAGCAACTTTATGTGTTGGTACTCGGGCTAGACGTTCTTGG
TAATCCGTATGGTTTGATATCTGGTGTTGGAACCGGAGCAAAGAATTTCT
TCTACGAACCTTACCAGGGATTAATTCAAGGACCAGAAGAATTTGCGGAA
GGATTGGCGTATGGGGTGAAGAGTCTTGTTGGTGGAACCGTGGGTGGAGT
ATCAGGAGCTGTGAGTAAGATTACCGGTACCTTCGGTAAAGGTTTGGCTG
CATTGACCTTGGATGAAGAATATCAACAAAAGAGACGTGAAAACATGAGC
CAACGCCCAACTAACCTCGGTGAAGGTCTCGCCAAAGGTGGTAAAGGCCT
TGTAAAGGGTATCGTGTCTGGTGTTACAGGGATCGTTACCAAACCCTATG
AAGGTGCCAAGAATGATGGTGCAGGTGGCTTTTTTAAGGGCGTTGGAAAA
GGCCTGATTGGCGTGGTTGCACGCCCTGTTGGTGGAGTGGTAGATATGGC
CAGTAACACGTTTGATGGTTTGAAAAGCACGACATCTGGCGTGAAAGCGA
TCGAGTTGAGCCGTGTTACTCGCGTCTTCCACGCAGATAAGGTTTTACGA
CCTTTCAATCTGTACGAAGCAGATGGAAACAAAATTCTTATGCAATGTAA
CAAAGGAGAATACGCCAAGAAGAATTTTTATATCACTCATGTAGTGGACA
AGAAGAACTATCTCATCCTCACTCAATCaaacATTTTGTATGTTGGAAAG
AACGAGTTGAAAATGGGTGAATGGGAATCggtttgggttatcgagttcaA
TGAGCTAAAACGTGAACCAGAAGTGAAAGAGACAAAGATTATTTTCCATA
TCCATAATACGGACACGCGACGTTCAATTTTCAAGAAATCGACGAACACA
CGTGAAGTGATATTGGAGTCTAGTGCTGTTGCAGACTGGTTTATCTTAAA
GCTTAGAGATGCTAAAATGTTATAGatggtatttgaaTCTTTGGTTGCTG
ACCTCTTGAACAAGTATCTGGGTCAATATGTGAAAAATCTTGATGCTTCT
CAATTGAAGATTGGCATTTGGGGAGGAAATGTTGTCCTGACAGAACTTGA
ACTGAAAGATACAGCTCTGGATGATCTTGACTTACCCATAAAAGTTGTTC
GTGGATATTTGGgtAAATTGGTCTTGTCCATCCCATGGAAAAATCTTTAC
ACTGAATCAACTGTTGTCGATATTCAAGATCTCCACCTTGTCGCTAAGCC
TAATTTTGACATCAAATACAATGAAGAACgcgaagaaaaatcaaaacatg
acAAGAAACAACAACAGATTCACAATATCGAAGAAGCGAGGCAAAGAGAA
GAAGACAAAAAGAAAGGCGCCAAGAAAGAAGAGAGTGACGGTTTTGCTGA
GAAACTTGCAACAAACGTCATAAAAAATCTACAGGTTACGATCAAGAACA
TACATGTTCGATATGAAGACTCAATCAGTGATGTGAATGGACCCTTTTCA
GTCGGTCTTACAATGGAAAGTTTAACAGCACAAACCACAGATGAAGATTT
TGTTCCAAAGATTATCAAAGAATCTGTCTCATTAATTCATAAGatggTGA
AATTAGACAATTTGGCTTTATATTGGAATCCAGGAGACGAACTGATTGAT
CCTTCACTTGATACCAAGCAATGGTTGgaagtTTCAACGAAGCAAATTTC
AACACACCAATCGAAGCCAGAGAAAACGAAATATATTTTGAGTCCCATGG
TTGCAACGAAGAAATTGAAGCTGAACACCAAACCAGGTTCCAACCTTGAC
ATCCCGAAGatgttTTTGAACTTGGTTTTGGAAGAACTTGGTATCATCGT
GGCAAGAAGTCAATATCATGGCGTGGTGCAACTGATTGAATCATTTGAAC
GAATGAATAGGAACCAACCTTTTCGTAAATACAGACCACATACCTCCGTT
CTTGGGAACGAAAGTATTTGGTGGAAGTACTGCATGTCCAGCATACTGGA
GGTGGATGTCAAAAGACGATCTCAAATGTGGAGCTGGAAGCATATTCAAA
AACATCGAGTTCTTTGCAAAGCTTACAAAGTGAAGTAcaaggaaaaattg
aaacagaaaaATCCATCCAAACAAATTCTCACTGAACTAGAGaGCATGGA
GGATGAGTTGAATATTGCAAGCATCACCATTTTTCGACAGCTTGCAGCTA
CAGAGGTTTTAACGGAACAAAAGAAGAAAGGCACTAAAGGAAGTTTCTTC
AGTTTCTTCTCCAGATCAAAAGAACCAGAAAAGTCTGCTGCTAATAAAAT
TGGAGATTTAATGGGTGATGACCAGGAGAAGGAAATGCAGAAATTGTATG
ACGCAATCGGTTATACTGAAAATGAAGTCATCACTCCCTTTCCTAAAGAG
TACGTGGCGATGTCAGTGGAATCGATTCTCCAGAAATTATTCATCAGCCT
CATCGATGACACAGATAAGGCGAAAGAATTCAAAGTGTTGGATTTTTCAC
TCAACAACATCATTGTAGAAGTTTTCCAAAGACCTTCTGCTCAAGCTCTC
AAATTATGTGCAAAGATAGGAGAGATGAAGTTATTTGGTACAGCTTCTGC
TCAATGTACACCTCtcatcatcaaaaacatgttaCAAGGTCGAGGTATGG
AATTTCTGCCGTTGGTGGACTTCATCTTTGAGACGAATCCTTTGAAGAAA
CCGGACATTGACCAATGTATCACTGCTATTTGTCAACCCTTAGAAATCAT
CTATGATGCTAACACGATCAACCATATCATTAGTTTCTTCAAACCTCCTG
AACATGTTATCTTGCAAGATTTACAAGACAAAGCGTATTCTACTTTCGAA
GATTTTAAAGTTTCAAGTACGGCTGGTCTTCTACATGCTATGGAACAAAG
AACGGTTATGGACATCGACATTGATGTTGGAGCATCTCATTTGATCATCC
CTGAAAAAGGTTCTTACAATGGTTGTACAGATATGCTGGTGATCGACTTT
GGTAAAATCACGATGAGCAGCGATCCTAGTCAAATCAGACACCTTGACCC
TAAGGACATTGAGGATGTGAATGAAGTACAAAGCAAAGCTTATGATCGAT
TCTTGTTGTCGCTTCAAGCTCTTCAAATATTACTCGTTAGAGAAGGTGAA
GATTTAAAGAGTGCTAAAAGCAACGTCAGTAAAGCTTCATCACACATTTT
GCATCCCATCAATTTCGATGGCAAACTTGCCAAAGCTATACTTCCACAAG
ATCCACGTTTAAAACAGATATGTGTCTCTGGTGAATTATCTTCGCTGTTT
GTTTCTGTATCGGATGATAAAGTCAGTCGTCTCATCAAGCTAGCAGACTC
GATACCACTCCCTCAATCACCTTCTCACGATAACATCGACGGAGAAGAAA
AACCTGAAGGACTCTTCACCAAGGCGTTGTCAATGATAAGCTTGACAGGT
GACAATGACACAGGGGTGGACATCGGAGGATTTTCCATCCCTGTACCGAC
ATCTCCAACATCAGTGACGTCAGATGAAGATGAATACGGGACACCACCTG
ATGGCTCCATATTACAGTTACAACAAGAAGCTGGTCCGGACTTTTCATCA
GGAGTGGCGAACCAAGTCAAAGTGGACTTGAACTTTAAAATCCATAAAGT
GATGATCGCCATTGGTTTGACTGACAAAGCATTGAAACAGGAAAAAGAAT
GTCTGAAATTCATCGTGGACGACATCAATACAGAGgtGATACTACGAAGA
TGGGATTTGTTCGTCAATGCAGAAGTTGGTCGTCTGGTGTTGAATGAAAT
GACATGGGGTGTTGATGGAGAACCTTTCGCCATCATGAGTACacccaaaa
acaccaaaatgttGAAATTCAGCTATCGGAGGTGTGAATTCAACGAAAGT
TTGAATCTCGGTCCAAGTTACTTTTATTCCAAAGAAGCGCAAGTCAGAGC
TTTACATTTCAAAGATGAATTTGGCGCCACGGATCAGATTTTAGATGTAC
AAGTGGCTACTTTATTTCTGATGCTTCATCAAGAAGCACTTTTGAGCATC
ATGTCATTGATCTACCAAGTACTGGAACCACTCAACAAACATGATAAGGA
AGCCACACAGAAGATCAAACGGAGTTTGAGTACGGCAGGTAGTCGTTTGA
GTCTCTCCatcgaagaaaaagaaaaggagaGACAGATACAACGAAAATTA
GCCAACCCTAAAGCACTGGAAGCTGCCAACGAACTTAAGCAACAGGTTGG
cttagaagaagaaaaaaagatgaGAGTGACCGCCCACCTGGATGGTGTTG
GTATCATGATTTGTTCAGCCAAAGTTGACCTTGCACAAGCCTTCGTTAAA
GGGTTATCTGCTAAAGTACTGATGAAAGATGACTTATTAGAAGTGAAAGC
CAGCATGAAAGATATGCAAGTACAAGATAATGTTGGCGAAACAAAGTACA
AAGACATCATTAGCATGCGATCTGATGAAGTGTTCGATTTAGAGTTGGCT
ATTTACGAGAATGGATCTTCTGGTAGCAAGCAATACGATATGTCGTGTGT
CGACACCAGTGTCAAACTGAACTTCGGTCAAATGCGCGTTGTTTTCTTGT
ATAGATTCATACAAGACTTAATGTCATTCACCGAAAACTTCGAAGAAGCA
CAGAAAGCAGTTGTGGAAGCTGGTAAAGCTGCCAAGGATAAAGCTCTGGA
AACAGCGACCGATTTGAATAGACATTCTTCTCGTGTCAAACTAAATGTGG
TTCTGAAAGCACCGACTATTATCATTCCAGTTGGATCAAACAATGAATTG
GCTTTACTGGTGGATCTGGGTGAATTGCGTATTTACAACACATTCAAACT
CCTCAACGATGATCAATACCATAAGAAATCTATCATCACTGATAACATGA
CCATTAAGTTATCCAATCTGAAATTGTTAAAAGCACTTATTCAAGATGGT
AAAGATTTCTTGCATCAACGAGCCATTATTGAACCTATGATGCTACAAAT
AACTATTGTTCGTAATTTAACGAAAGGTAACCATTCCATACCGGATGTTT
CAGTTCAAGCAAAGATGCCAGCTATTCTGTTATCAATCAGTGAAGAAGAT
GTGACCGTAGCTCTAAAGATTGTCCAAGGGAATCTCGCCGAAGGTGAGTC
ACATGCGCCGAAGAAGCAAGCCAAGCCTGCCAAACAAACGTTAAACGTGC
CACAAGATCGTTTAGCAGACATTTACGAGGAGcctgaagatgaagatgag
aaTCGACAAGGATATCTTCAAACCAAACTATCCTTCGATCTGGCTAAAAT
TGACATCAAGCTTTACTTGAAACCATCTGATATGACATTTGAAGATGAAT
TTTTAGCGAGGACGGATGATTTGTTGTTAGCTTTGTTCACTATTGGTAAC
CTGTGTGTTGATGGAGACATCATGTCCACGCAAGCTATGAAGATGAGCGT
TCGATTGGACACTTTGGTGTTGGATGATATGAGACCTATCGAGGAGCATG
AAGGTGTTAAACGTATGATCAACTACAGTCCCGAGCCACTCCTTGAAGAA
GTCAAAACCTCTTCTCATAAACGACCAATCGACAACTCACGAATGATCGA
AATCCAAttcgatcaaacttcatcgcaagataaaaatatcgacATCAAAC
TTTGTAACATGCTTTGTATATTCAACGTTGAGTTTATCATGGTCCTGTTG
AAAACGTTGCAAGCTGCCATACCTAAAGATGATAGTCTGCAACATGGCCA
TTCAATGAGTAGTCTAGACTCGGCGGCAGGGTCTGGCGGCAGCGATGACG
AGGACTCTTTAGAAGCCAGCGAGATTGTCCTCTGCACTGGTGATCAAGAA
AGACCTGAGACTAAAGTCTCTATCTTCGTCCATAACCCGCAAATTGTTTT
ACTAGCAGATGCAAAGGATGTCAAAACAAATGCACTCTTTCTTACAACCG
agatcaattttcaatatttcgaaTTGCGAGATACTCAAAAAATGATTGGC
GCTGTTTCTAACACCGCTATTTTGTCAACTGCTTTCAAGAATGACCATCG
GAGTGATATATCAACAGTGTTGTCATTAGATTCCATCAATCTCCACTCGT
CATCACCCATCAATGGTAAACCTCATATGAGTGTCAGCACAACTTTGATC
AAACTGAATATCTCACCCAAAACCATCCGAACTTTATCAGCGTGTGCTGG
TTACATCTCCAATGATCCAACAGATGAAGAAATCAAAGAAGCTCGAAAAG
CCATGCGTGATTTATGGCAAATTCAAACGTTCACCAATAAGCGACCGTGG
TATTTAAACCACCCACCACAACAAGTCTTAAGTGCTGGCAGCTTCGTCCT
TGCGCGAACGAGAACAGGAGAATATAAGCATGGTTTCTTAGCTAAAAAGG
ATGTCTCGTATCAAGTCTATTTTTCAGAGGAGCGAGGAACAGCCAGTCAC
CGAGCCATGGATATCTCATCTGTTGTTTTGGATATCGTACCGCTGATCGG
TGATCTATGTGTTGGATGTAATGTTTTAGCTGTGGAATCGAAAGAACATG
GATATCGTACTGGTCGAATTACTCAGGTTTGGGATTCGAATGTGGATAAA
GATTCTTCGGATGGCGCCAAACAATCTGTTTCTGTCAAGACAACTGCTAT
TGCTCCAATCAAATACCTTGTCAATTTCTATGACAACCAAACGGAGAACT
TCTTCCCGCCTGATGAACTTCGTATCATTGGTAAACCCATCAAGGGGGTT
GTCCCTGGACTAGGGGCGTGTGTTTACGCCCGCTTTAATGATGGTTTTTA
CTATCGGGGCAAAGTTGATGACATCGAGGATTATCGAATCCGAGTGCAAT
TGGATGAGATCAGTGGAGAAATCGAACACGACATCGATGATCCGTCAGCC
GTTATTTTGAACCTGACGCCTCAATACCGTCAAGTCAAAAAGCATTTCAA
AGTCATTGCATCCAAAGGAAGCACAACTAAAGGATATCATCCGGGGAAAG
TGACCGCCATCCAAGGTGAAGGAAATAACCGATTGTATTCGATACGCTTC
GAAGACGGTACAATTAACCAAGTACCCATCacgaaattgattttgatgcc
AAAAGCACCTTTTGATGCTTTACCTGAAGTTGGCACATACGTTTATTCCC
GAGTGTCACGCGACGCTCCTTTATACGAGAAGGGTATCGTAGCAGAGAAG
AACACAATGATCTGCGTTAAACATTTAAATGGACGGAAATTGGCTCACGA
AATACAAAACATTCATTTTGTTGTCCGAAATATCGTTCCTCTCGTGTCAT
CAttgaagGTTGGTTTGGACGTCATAGTGCAACCTGACAATGACGATCAG
AAAATGTATTTGGCTGTCATTAGGGAAGTCACCAAAAAAGAAGGTGACAA
AACGAACCGTTATCTAGTGGAGTTTACGGATGGATCCAAGAAGAGAGTGA
CGCCCAGCCGGATCCGTATACTTTCTCAATACGGAAGTGCAGAAACGAGT
GAAGAAAATGCTGACATTATCACAACAAGACAGGAGGAACTAGTTCTCGA
TGTGCAAGGTATCTCATTACGTGTGGAAGGTTACTTGGGAGGCGTGTTGA
CACCCATGCTCAAAATGGATTCCAAAATCACAGCTAACTTGAAGGATTGG
TCAAGCCAAATGAATGCACACGCTACTGTATCATTAGAAGCCAGTTATTA
TAACGAAAACGTTGCCGAATGGGAGCCAGTTATTGAACCTTTGATGGAGA
AACGGAGGGAAAGACCGTGGCAACTCTCTGTCAATTACACGATGGAAGGT
GACGACAATTCTGCTTCATCCACTTCCAACGAACTCGTTTTACAAAAACC
GGAATCCAACCTGAAAATCAAATCTCAAGATAATCTTGAATTGACAATTT
CAAAATCATGTCTTGCTTTACTCGGTGAATTGGGACAGGTGTTTGGAGAT
GCAGTAGAATCTGTGGACGTTTTACCACAAGTCCTGGTCGAAAAAGAACC
TTTCATGATCGAAAACTTGCTCTCCAAGAAGGTGACAGTAACATTGAATG
AACTTCTGCAGGGACCAAATGGAGATTCGACAATCGAGCTAGCATCTTCT
TCGAATCCTGTTGGCATTACTTTTGCTCCCAagaaatttgagaaacgaaA
GACCAACGATCTATACACAATCAATTTAtcgGTGGACGGTTTTCATGACA
TTAAAGACATTGTGGTTCAAAGAAAGCGAAGCGTTATCTATGATCTTGTA
CCAATAAAACTATTATCAGCACAGTCTTCATATTCGATAGTGGTACAAGT
GAAGACAACAGACGGACAACGTATCATCGTACTCCGATCACCATTGCAGT
TGAAAAATCACTTTCCAATGCCGTTGGATGTCAGCTACATTTCCAAAGAA
AACCAACCAGTTAAACTGACAACAGTGGGATCGGGAGATATCTATTCCTT
CCCTTTGTTGTTAACCTACCACAGTGTTTTTCATCTCAAACCTGCTGGTT
TCGACTACGGTGATTGCACAGAAGCTCTCAATTGGAGTGATTTGAAGACG
AGCAACGAAAAACAGTTCTCCTGCCCTTCACCTGACAAAAGTGCTGACCC
TTTCTACATGCAGGTGGTGATGAAAGAGGAGACGTACTCTTCCGTACACG
GCATGTTGGACTGTGTACCACGTTACACGTTGGAGTGCTTTCCCGTCATC
ACGCTGCATAATTACCTACCTTGCACTATTAATTATAAGATCAAGGGTAT
GGCGAAATCGGAAAGTCTACCAGGCGGACACAATTGGCCTTTGTTTACCG
TCAACTTCAGTGATAAACCTTCCATCTATATCGAGATTGAGTCGTATAAC
AACCAAAGATGGGAAGGAGGTTTGACATTACCAACAAAACCGGTAGATTC
TTTGAACAAACCATCATTATCTTTCGTCATGATGTCTGGTGAACGCAAAA
TGGAATTGGGTGTTTATTACCAGTTAGACGGTTCATTGAACATCACCTTA
TATTCGCCTTACTGGCTTCTCAATAAAACTGGAAAACCACTTGTCTATCA
GCCAGCGGGGAGCAGCATCCAGCAAGTTCACCAAGAGAACGATGTAAATG
CTCTTATGATGCTCGTCAAAGGGAAACATAAAAAGgcgaaagtgaaagtg
aaaaataGCGAGTCATGGTCAAATGAATTTTCATTGGATACTGTTGGCAG
TGGTGGTTCCTTGAAATGCAATGGTCCAAGAGATCGAGTTTATGAGATTG
GTTTGAACATCAGTTTGTCATACTTTGGATTGACGAAGATTGTGACGTTC
ACGCCACTCCGAATGTTATCTAACCACACCAAGTACACCATCAGTATGGC
AGAAAGTAATTCTAAATCGTCAGAATGGCACACGGTAAACCCTGACGAGa
acattccatTCTGGCCGACGAAACTTCCTTTGGTCAACCTTTACATTAAC
ATCAATGGGCAAGATTCAGTGAAATTCAACCCTGAAGTTGGAAAAACTTT
ACTGTTGAAGTTCCAGAATGAGGTTGGAGGAGTTTGCGTGGATTACCAAG
AAAAGGACTCGTCCTCAGTCCTTTCGTTTAATCCGTACTTCGCAGGTGCA
GCTCCTGTGCGGCttgaaaatctttgcaaaaaGATCGGCATGATCGCTTA
TAAACAAGCAGGTTCGGTAATGGGTCACGTGTTAACACATGACCAATCAG
TGTTGTACACGTGGGATGATCCAACCATGGAACAAGAATTGATTTGTTCC
ATTGTCAATGATGAAGCCAGTGAAACAAGGATCAAACTCGATGCCAACGA
TTTCGGACGAATGAGAGTTGGAGATGGTGCAATTTATTGGGTTTCCTTTC
TGGATGGTCTTCAACGTGTTCTATTGTTCACTGATAACTTCAAATCTGCT
TACTGCGCATGTCAGgaGCAAAATTTACGCCCAACCATGGAAGTTGACTT
TGAGATTGAGAGTTTTGGTTTGTCTCTGGTCAATGTTGATAAGAGAATGG
AGATTGGCTACTTAGCTATCCGACAAAGCAAGACTGTATGGGAGCAACGC
AAGAAAAAGAACCGCTGGAAAGCTTTACCGCTTGCCATGTGTGAAGCTCT
CGAAGAAGGTTATCTCAATTATCAAAACAGAAAAGGTGCAGTCAAAGAGA
AAGTTCTGGATAAGGAGGTGGATTACGAGAAGATGTTTATTACGAAACCT
GAGAAGATTAAGATCAGAAGAACGTACCACAGCGGTCTTGGTTTCAAATA
CACAATCTCACCCAATGAAATGCGTGTGCATGCTTCTATCAGCTCAATAC
AGTTGGATAGCCATGTTCCAGGTTCGACCTTTCCAACAGTCTTGCATATG
GTTGAACCACCAAAATCTGTTGCTTCAGAAAACGCTCCAAAGCCATTCTt
tgaattgagtttaatgaCAAGGATCGGTGATAAAAATGTGGTCAATGAAG
TcagCTATTGTCACGTGTTGATTCAAGAGATGGATGTGAGGGTTGATATT
GGATTTTTATTGGCTCTGATGGAACTCTTCAGTCATGCAAGAGCTCGAAC
AACCGAGAAAGAACAATACGCGCTTGATATTGGCCAAGCAGCAACAAAGT
TTGAAGAAAGCGCTGAATTTCAGGCAGCCAAACAAGATCGATATTACGTT
TTGAACGACTTTCATTTATCACCGCTAAAGATTCACGTCAGTTTCTCTTT
GACGGGTGGTTCCAAAGATGAAAATGCTATTGCTTCATTACATGGTAACG
TGTTGAACTTGTTGTTACAAAGTGTCGGACTGGCCTTCACTGAAATACAA
GACGTACAATTCAAATTAGCATGTTACGAAGTGCATAAGTCCATGCAGAG
TAATTCGCAGCTCGGTGATGGAATAACTAAACATTATCAAACACAGGCTA
TCAAGCAACTTTATGTGTTGGTACTCGGGCTAGACGTTCTTGGTAATCCG
TATGGTTTGATATCTGGTGTTGGAACCGGAGCAAAGAATTTCTTCTACGA
ACCTTACCAGGGATTAATTCAAGGACCAGAAGAATTTGCGGAAGGATTGG
CGTATGGGGTGAAGAGTCTTGTTGGTGGAACCGTGGGTGGAGTATCAGGA
GCTGTGAGTAAGATTACCGGTACCTTCGGTAAAGGTTTGGCTGCATTGAC
CTTGGATGAAGAATATCAACAAAAGAGACGTGAAAACATGAGCCAACGCC
CAACTAACCTCGGTGAAGGTCTCGCCAAAGGTGGTAAAGGCCTTGTAAAG
GGTATCGTGTCTGGTGTTACAGGGATCGTTACCAAACCCTATGAAGGTGC
CAAGAATGATGGTGCAGGTGGCTTTTTTAAGGGCGTTGGAAAAGGCCTGA
TTGGCGTGGTTGCACGCCCTGTTGGTGGAGTGGTAGATATGGCCAGTAAC
ACGTTTGATGGTTTGAAAAGCACGACATCTGGCGTGAAAGCGATCGAGTT
GAGCCGTGTTACTCGCGTCTTCCACGCAGATAAGGTTTTACGACCTTTCA
ATCTGTACGAAGCAGATGGAAACAAAATTCTTATGCAATGTAACAAAGGA
GAATACGCCAAGAAGAATTTTTATATCACTCATGTAGTGGACAAGAAGAA
CTATCTCATCCTCACTCAATCaaacATTTTGTATGTTGGAAAGAACGAGT
TGAAAATGGGTGAATGGGAATCggtttgggttatcgagttcaATGAGCTA
AAACGTGAACCAGAAGTGAAAGAGACAAAGATTATTTTCCATATCCATAA
TACGGACACGCGACGTTCAATTTTCAAGAAATCGACGAACACACGTGAAG
TGATATTGGAGTCTAGTGCTGTTGCAGACTGGTTTATCTTAAAGCTTAGA
GATGCTAAAATGTTATAGatggtatttgaaTCTTTGGTTGCTGACCTCTT
GAACAAGTATCTGGGTCAATATGTGAAAAATCTTGATGCTTCTCAATTGA
AGATTGGCATTTGGGGAGGAAATGTTGTCCTGACAGAACTTGAACTGAAA
GATACAGCTCTGGATGATCTTGACTTACCCATAAAAGTTGTTCGTGGATA
TTTGGgtAAATTGGTCTTGTCCATCCCATGGAAAAATCTTTACACTGAAT
CAACTGTTGTCGATATTCAAGATCTCCACCTTGTCGCTAAGCCTAATTTT
GACATCAAATACAATGAAGAACgcgaagaaaaatcaaaacatgacAAGAA
ACAACAACAGATTCACAATATCGAAGAAGCGAGGCAAAGAGAAGAAGACA
AAAAGAAAGGCGCCAAGAAAGAAGAGAGTGACGGTTTTGCTGAGAAACTT
GCAACAAACGTCATAAAAAATCTACAGGTTACGATCAAGAACATACATGT
TCGATATGAAGACTCAATCAGTGATGTGAATGGACCCTTTTCAGTCGGTC
TTACAATGGAAAGTTTAACAGCACAAACCACAGATGAAGATTTTGTTCCA
AAGATTATCAAAGAATCTGTCTCATTAATTCATAAGatggTGAAATTAGA
CAATTTGGCTTTATATTGGAATCCAGGAGACGAACTGATTGATCCTTCAC
TTGATACCAAGCAATGGTTGgaagtTTCAACGAAGCAAATTTCAACACAC
CAATCGAAGCCAGAGAAAACGAAATATATTTTGAGTCCCATGGTTGCAAC
GAAGAAATTGAAGCTGAACACCAAACCAGGTTCCAACCTTGACATCCCGA
AGatgttTTTGAACTTGGTTTTGGAAGAACTTGGTATCATCGTGGCAAGA
AGTCAATATCATGGCGTGGTGCAACTGATTGAATCATTTGAACGAATGAA
TAGGAACCAACCTTTTCGTAAATACAGACCACATACCTCCGTTCTTGGGA
ACGAAAGTATTTGGTGGAAGTACTGCATGTCCAGCATACTGGAGGTGGAT
GTCAAAAGACGATCTCAAATGTGGAGCTGGAAGCATATTCAAAAACATCG
AGTTCTTTGCAAAGCTTACAAAGTGAAGTAcaaggaaaaattgaaacaga
aaaATCCATCCAAACAAATTCTCACTGAACTAGAGaGCATGGAGGATGAG
TTGAATATTGCAAGCATCACCATTTTTCGACAGCTTGCAGCTACAGAGGT
TTTAACGGAACAAAAGAAGAAAGGCACTAAAGGAAGTTTCTTCAGTTTCT
TCTCCAGATCAAAAGAACCAGAAAAGTCTGCTGCTAATAAAATTGGAGAT
TTAATGGGTGATGACCAGGAGAAGGAAATGCAGAAATTGTATGACGCAAT
CGGTTATACTGAAAATGAAGTCATCACTCCCTTTCCTAAAGAGTACGTGG
CGATGTCAGTGGAATCGATTCTCCAGAAATTATTCATCAGCCTCATCGAT
GACACAGATAAGGCGAAAGAATTCAAAGTGTTGGATTTTTCACTCAACAA
CATCATTGTAGAAGTTTTCCAAAGACCTTCTGCTCAAGCTCTCAAATTAT
GTGCAAAGATAGGAGAGATGAAGTTATTTGGTACAGCTTCTGCTCAATGT
ACACCTCtcatcatcaaaaacatgttaCAAGGTCGAGGTATGGAATTTCT
GCCGTTGGTGGACTTCATCTTTGAGACGAATCCTTTGAAGAAACCGGACA
TTGACCAATGTATCACTGCTATTTGTCAACCCTTAGAAATCATCTATGAT
GCTAACACGATCAACCATATCATTAGTTTCTTCAAACCTCCTGAACATGT
TATCTTGCAAGATTTACAAGACAAAGCGTATTCTACTTTCGAAGATTTTA
AAGTTTCAAGTACGGCTGGTCTTCTACATGCTATGGAACAAAGAACGGTT
ATGGACATCGACATTGATGTTGGAGCATCTCATTTGATCATCCCTGAAAA
AGGTTCTTACAATGGTTGTACAGATATGCTGGTGATCGACTTTGGTAAAA
TCACGATGAGCAGCGATCCTAGTCAAATCAGACACCTTGACCCTAAGGAC
ATTGAGGATGTGAATGAAGTACAAAGCAAAGCTTATGATCGATTCTTGTT
GTCGCTTCAAGCTCTTCAAATATTACTCGTTAGAGAAGGTGAAGATTTAA
AGAGTGCTAAAAGCAACGTCAGTAAAGCTTCATCACACATTTTGCATCCC
ATCAATTTCGATGGCAAACTTGCCAAAGCTATACTTCCACAAGATCCACG
TTTAAAACAGATATGTGTCTCTGGTGAATTATCTTCGCTGTTTGTTTCTG
TATCGGATGATAAAGTCAGTCGTCTCATCAAGCTAGCAGACTCGATACCA
CTCCCTCAATCACCTTCTCACGATAACATCGACGGAGAAGAAAAACCTGA
AGGACTCTTCACCAAGGCGTTGTCAATGATAAGCTTGACAGGTGACAATG
ACACAGGGGTGGACATCGGAGGATTTTCCATCCCTGTACCGACATCTCCA
ACATCAGTGACGTCAGATGAAGATGAATACGGGACACCACCTGATGGCTC
CATATTACAGTTACAACAAGAAGCTGGTCCGGACTTTTCATCAGGAGTGG
CGAACCAAGTCAAAGTGGACTTGAACTTTAAAATCCATAAAGTGATGATC
GCCATTGGTTTGACTGACAAAGCATTGAAACAGGAAAAAGAATGTCTGAA
ATTCATCGTGGACGACATCAATACAGAGgtGATACTACGAAGATGGGATT
TGTTCGTCAATGCAGAAGTTGGTCGTCTGGTGTTGAATGAAATGACATGG
GGTGTTGATGGAGAACCTTTCGCCATCATGAGTACacccaaaaacaccaa
aatgttGAAATTCAGCTATCGGAGGTGTGAATTCAACGAAAGTTTGAATC
TCGGTCCAAGTTACTTTTATTCCAAAGAAGCGCAAGTCAGAGCTTTACAT
TTCAAAGATGAATTTGGCGCCACGGATCAGATTTTAGATGTACAAGTGGC
TACTTTATTTCTGATGCTTCATCAAGAAGCACTTTTGAGCATCATGTCAT
TGATCTACCAAGTACTGGAACCACTCAACAAACATGATAAGGAAGCCACA
CAGAAGATCAAACGGAGTTTGAGTACGGCAGGTAGTCGTTTGAGTCTCTC
CatcgaagaaaaagaaaaggagaGACAGATACAACGAAAATTAGCCAACC
CTAAAGCACTGGAAGCTGCCAACGAACTTAAGCAACAGGTTGGcttagaa
gaagaaaaaaagatgaGAGTGACCGCCCACCTGGATGGTGTTGGTATCAT
GATTTGTTCAGCCAAAGTTGACCTTGCACAAGCCTTCGTTAAAGGGTTAT
CTGCTAAAGTACTGATGAAAGATGACTTATTAGAAGTGAAAGCCAGCATG
AAAGATATGCAAGTACAAGATAATGTTGGCGAAACAAAGTACAAAGACAT
CATTAGCATGCGATCTGATGAAGTGTTCGATTTAGAGTTGGCTATTTACG
AGAATGGATCTTCTGGTAGCAAGCAATACGATATGTCGTGTGTCGACACC
AGTGTCAAACTGAACTTCGGTCAAATGCGCGTTGTTTTCTTGTATAGATT
CATACAAGACTTAATGTCATTCACCGAAAACTTCGAAGAAGCACAGAAAG
CAGTTGTGGAAGCTGGTAAAGCTGCCAAGGATAAAGCTCTGGAAACAGCG
ACCGATTTGAATAGACATTCTTCTCGTGTCAAACTAAATGTGGTTCTGAA
AGCACCGACTATTATCATTCCAGTTGGATCAAACAATGAATTGGCTTTAC
TGGTGGATCTGGGTGAATTGCGTATTTACAACACATTCAAACTCCTCAAC
GATGATCAATACCATAAGAAATCTATCATCACTGATAACATGACCATTAA
GTTATCCAATCTGAAATTGTTAAAAGCACTTATTCAAGATGGTAAAGATT
TCTTGCATCAACGAGCCATTATTGAACCTATGATGCTACAAATAACTATT
GTTCGTAATTTAACGAAAGGTAACCATTCCATACCGGATGTTTCAGTTCA
AGCAAAGATGCCAGCTATTCTGTTATCAATCAGTGAAGAAGATGTGACCG
TAGCTCTAAAGATTGTCCAAGGGAATCTCGCCGAAGGTGAGTCACATGCG
CCGAAGAAGCAAGCCAAGCCTGCCAAACAAACGTTAAACGTGCCACAAGA
TCGTTTAGCAGACATTTACGAGGAGcctgaagatgaagatgagaaTCGAC
AAGGATATCTTCAAACCAAACTATCCTTCGATCTGGCTAAAATTGACATC
AAGCTTTACTTGAAACCATCTGATATGACATTTGAAGATGAATTTTTAGC
GAGGACGGATGATTTGTTGTTAGCTTTGTTCACTATTGGTAACCTGTGTG
TTGATGGAGACATCATGTCCACGCAAGCTATGAAGATGAGCGTTCGATTG
GACACTTTGGTGTTGGATGATATGAGACCTATCGAGGAGCATGAAGGTGT
TAAACGTATGATCAACTACAGTCCCGAGCCACTCCTTGAAGAAGTCAAAA
CCTCTTCTCATAAACGACCAATCGACAACTCACGAATGATCGAAATCCAA
ttcgatcaaacttcatcgcaagataaaaatatcgacATCAAACTTTGTAA
CATGCTTTGTATATTCAACGTTGAGTTTATCATGGTCCTGTTGAAAACGT
TGCAAGCTGCCATACCTAAAGATGATAGTCTGCAACATGGCCATTCAATG
AGTAGTCTAGACTCGGCGGCAGGGTCTGGCGGCAGCGATGACGAGGACTC
TTTAGAAGCCAGCGAGATTGTCCTCTGCACTGGTGATCAAGAAAGACCTG
AGACTAAAGTCTCTATCTTCGTCCATAACCCGCAAATTGTTTTACTAGCA
GATGCAAAGGATGTCAAAACAAATGCACTCTTTCTTACAACCGagatcaa
ttttcaatatttcgaaTTGCGAGATACTCAAAAAATGATTGGCGCTGTTT
CTAACACCGCTATTTTGTCAACTGCTTTCAAGAATGACCATCGGAGTGAT
ATATCAACAGTGTTGTCATTAGATTCCATCAATCTCCACTCGTCATCACC
CATCAATGGTAAACCTCATATGAGTGTCAGCACAACTTTGATCAAACTGA
ATATCTCACCCAAAACCATCCGAACTTTATCAGCGTGTGCTGGTTACATC
TCCAATGATCCAACAGATGAAGAAATCAAAGAAGCTCGAAAAGCCATGCG
TGATTTATGGCAAATTCAAACGTTCACCAATAAGCGACCGTGGTATTTAA
ACCACCCACCACAACAAGTCTTAAGTGCTGGCAGCTTCGTCCTTGCGCGA
ACGAGAACAGGAGAATATAAGCATGGTTTCTTAGCTAAAAAGGATGTCTC
GTATCAAGTCTATTTTTCAGAGGAGCGAGGAACAGCCAGTCACCGAGCCA
TGGATATCTCATCTGTTGTTTTGGATATCGTACCGCTGATCGGTGATCTA
TGTGTTGGATGTAATGTTTTAGCTGTGGAATCGAAAGAACATGGATATCG
TACTGGTCGAATTACTCAGGTTTGGGATTCGAATGTGGATAAAGATTCTT
CGGATGGCGCCAAACAATCTGTTTCTGTCAAGACAACTGCTATTGCTCCA
ATCAAATACCTTGTCAATTTCTATGACAACCAAACGGAGAACTTCTTCCC
GCCTGATGAACTTCGTATCATTGGTAAACCCATCAAGGGGGTTGTCCCTG
GACTAGGGGCGTGTGTTTACGCCCGCTTTAATGATGGTTTTTACTATCGG
GGCAAAGTTGATGACATCGAGGATTATCGAATCCGAGTGCAATTGGATGA
GATCAGTGGAGAAATCGAACACGACATCGATGATCCGTCAGCCGTTATTT
TGAACCTGACGCCTCAATACCGTCAAGTCAAAAAGCATTTCAAAGTCATT
GCATCCAAAGGAAGCACAACTAAAGGATATCATCCGGGGAAAGTGACCGC
CATCCAAGGTGAAGGAAATAACCGATTGTATTCGATACGCTTCGAAGACG
GTACAATTAACCAAGTACCCATCacgaaattgattttgatgccAAAAGCA
CCTTTTGATGCTTTACCTGAAGTTGGCACATACGTTTATTCCCGAGTGTC
ACGCGACGCTCCTTTATACGAGAAGGGTATCGTAGCAGAGAAGAACACAA
TGATCTGCGTTAAACATTTAAATGGACGGAAATTGGCTCACGAAATACAA
AACATTCATTTTGTTGTCCGAAATATCGTTCCTCTCGTGTCATCAttgaa
gGTTGGTTTGGACGTCATAGTGCAACCTGACAATGACGATCAGAAAATGT
ATTTGGCTGTCATTAGGGAAGTCACCAAAAAAGAAGGTGACAAAACGAAC
CGTTATCTAGTGGAGTTTACGGATGGATCCAAGAAGAGAGTGACGCCCAG
CCGGATCCGTATACTTTCTCAATACGGAAGTGCAGAAACGAGTGAAGAAA
ATGCTGACATTATCACAACAAGACAGGAGGAACTAGTTCTCGATGTGCAA
GGTATCTCATTACGTGTGGAAGGTTACTTGGGAGGCGTGTTGACACCCAT
GCTCAAAATGGATTCCAAAATCACAGCTAACTTGAAGGATTGGTCAAGCC
AAATGAATGCACACGCTACTGTATCATTAGAAGCCAGTTATTATAACGAA
AACGTTGCCGAATGGGAGCCAGTTATTGAACCTTTGATGGAGAAACGGAG
GGAAAGACCGTGGCAACTCTCTGTCAATTACACGATGGAAGGTGACGACA
ATTCTGCTTCATCCACTTCCAACGAACTCGTTTTACAAAAACCGGAATCC
AACCTGAAAATCAAATCTCAAGATAATCTTGAATTGACAATTTCAAAATC
ATGTCTTGCTTTACTCGGTGAATTGGGACAGGTGTTTGGAGATGCAGTAG
AATCTGTGGACGTTTTACCACAAGTCCTGGTCGAAAAAGAACCTTTCATG
ATCGAAAACTTGCTCTCCAAGAAGGTGACAGTAACATTGAATGAACTTCT
GCAGGGACCAAATGGAGATTCGACAATCGAGCTAGCATCTTCTTCGAATC
CTGTTGGCATTACTTTTGCTCCCAagaaatttgagaaacgaaAGACCAAC
GATCTATACACAATCAATTTAtcgGTGGACGGTTTTCATGACATTAAAGA
CATTGTGGTTCAAAGAAAGCGAAGCGTTATCTATGATCTTGTACCAATAA
AACTATTATCAGCACAGTCTTCATATTCGATAGTGGTACAAGTGAAGACA
ACAGACGGACAACGTATCATCGTACTCCGATCACCATTGCAGTTGAAAAA
TCACTTTCCAATGCCGTTGGATGTCAGCTACATTTCCAAAGAAAACCAAC
CAGTTAAACTGACAACAGTGGGATCGGGAGATATCTATTCCTTCCCTTTG
TTGTTAACCTACCACAGTGTTTTTCATCTCAAACCTGCTGGTTTCGACTA
CGGTGATTGCACAGAAGCTCTCAATTGGAGTGATTTGAAGACGAGCAACG
AAAAACAGTTCTCCTGCCCTTCACCTGACAAAAGTGCTGACCCTTTCTAC
ATGCAGGTGGTGATGAAAGAGGAGACGTACTCTTCCGTACACGGCATGTT
GGACTGTGTACCACGTTACACGTTGGAGTGCTTTCCCGTCATCACGCTGC
ATAATTACCTACCTTGCACTATTAATTATAAGATCAAGGGTATGGCGAAA
TCGGAAAGTCTACCAGGCGGACACAATTGGCCTTTGTTTACCGTCAACTT
CAGTGATAAACCTTCCATCTATATCGAGATTGAGTCGTATAACAACCAAA
GATGGGAAGGAGGTTTGACATTACCAACAAAACCGGTAGATTCTTTGAAC
AAACCATCATTATCTTTCGTCATGATGTCTGGTGAACGCAAAATGGAATT
GGGTGTTTATTACCAGTTAGACGGTTCATTGAACATCACCTTATATTCGC
CTTACTGGCTTCTCAATAAAACTGGAAAACCACTTGTCTATCAGCCAGCG
GGGAGCAGCATCCAGCAAGTTCACCAAGAGAACGATGTAAATGCTCTTAT
GATGCTCGTCAAAGGGAAACATAAAAAGgcgaaagtgaaagtgaaaaata
GCGAGTCATGGTCAAATGAATTTTCATTGGATACTGTTGGCAGTGGTGGT
TCCTTGAAATGCAATGGTCCAAGAGATCGAGTTTATGAGATTGGTTTGAA
CATCAGTTTGTCATACTTTGGATTGACGAAGATTGTGACGTTCACGCCAC
TCCGAATGTTATCTAACCACACCAAGTACACCATCAGTATGGCAGAAAGT
AATTCTAAATCGTCAGAATGGCACACGGTAAACCCTGACGAGaacattcc
atTCTGGCCGACGAAACTTCCTTTGGTCAACCTTTACATTAACATCAATG
GGCAAGATTCAGTGAAATTCAACCCTGAAGTTGGAAAAACTTTACTGTTG
AAGTTCCAGAATGAGGTTGGAGGAGTTTGCGTGGATTACCAAGAAAAGGA
CTCGTCCTCAGTCCTTTCGTTTAATCCGTACTTCGCAGGTGCAGCTCCTG
TGCGGCttgaaaatctttgcaaaaaGATCGGCATGATCGCTTATAAACAA
GCAGGTTCGGTAATGGGTCACGTGTTAACACATGACCAATCAGTGTTGTA
CACGTGGGATGATCCAACCATGGAACAAGAATTGATTTGTTCCATTGTCA
ATGATGAAGCCAGTGAAACAAGGATCAAACTCGATGCCAACGATTTCGGA
CGAATGAGAGTTGGAGATGGTGCAATTTATTGGGTTTCCTTTCTGGATGG
TCTTCAACGTGTTCTATTGTTCACTGATAACTTCAAATCTGCTTACTGCG
CATGTCAGgaGCAAAATTTACGCCCAACCATGGAAGTTGACTTTGAGATT
GAGAGTTTTGGTTTGTCTCTGGTCAATGTTGATAAGAGAATGGAGATTGG
CTACTTAGCTATCCGACAAAGCAAGACTGTATGGGAGCAACGCAAGAAAA
AGAACCGCTGGAAAGCTTTACCGCTTGCCATGTGTGAAGCTCTCGAAGAA
GGTTATCTCAATTATCAAAACAGAAAAGGTGCAGTCAAAGAGAAAGTTCT
GGATAAGGAGGTGGATTACGAGAAGATGTTTATTACGAAACCTGAGAAGA
TTAAGATCAGAAGAACGTACCACAGCGGTCTTGGTTTCAAATACACAATC
TCACCCAATGAAATGCGTGTGCATGCTTCTATCAGCTCAATACAGTTGGA
TAGCCATGTTCCAGGTTCGACCTTTCCAACAGTCTTGCATATGGTTGAAC
CACCAAAATCTGTTGCTTCAGAAAACGCTCCAAAGCCATTCTttgaattg
agtttaatgaCAAGGATCGGTGATAAAAATGTGGTCAATGAAGTcagCTA
TTGTCACGTGTTGATTCAAGAGATGGATGTGAGGGTTGATATTGGATTTT
TATTGGCTCTGATGGAACTCTTCAGTCATGCAAGAGCTCGAACAACCGAG
AAAGAACAATACGCGCTTGATATTGGCCAAGCAGCAACAAAGTTTGAAGA
AAGCGCTGAATTTCAGGCAGCCAAACAAGATCGATATTACGTTTTGAACG
ACTTTCATTTATCACCGCTAAAGATTCACGTCAGTTTCTCTTTGACGGGT
GGTTCCAAAGATGAAAATGCTATTGCTTCATTACATGGTAACGTGTTGAA
CTTGTTGTTACAAAGTGTCGGACTGGCCTTCACTGAAATACAAGACGTAC
AATTCAAATTAGCATGTTACGAAGTGCATAAGTCCATGCAGAGTAATTCG
CAGCTCGGTGATGGAATAACTAAACATTATCAAACACAGGCTATCAAGCA
ACTTTATGTGTTGGTACTCGGGCTAGACGTTCTTGGTAATCCGTATGGTT
TGATATCTGGTGTTGGAACCGGAGCAAAGAATTTCTTCTACGAACCTTAC
CAGGGATTAATTCAAGGACCAGAAGAATTTGCGGAAGGATTGGCGTATGG
GGTGAAGAGTCTTGTTGGTGGAACCGTGGGTGGAGTATCAGGAGCTGTGA
GTAAGATTACCGGTACCTTCGGTAAAGGTTTGGCTGCATTGACCTTGGAT
GAAGAATATCAACAAAAGAGACGTGAAAACATGAGCCAACGCCCAACTAA
CCTCGGTGAAGGTCTCGCCAAAGGTGGTAAAGGCCTTGTAAAGGGTATCG
TGTCTGGTGTTACAGGGATCGTTACCAAACCCTATGAAGGTGCCAAGAAT
GATGGTGCAGGTGGCTTTTTTAAGGGCGTTGGAAAAGGCCTGATTGGCGT
GGTTGCACGCCCTGTTGGTGGAGTGGTAGATATGGCCAGTAACACGTTTG
ATGGTTTGAAAAGCACGACATCTGGCGTGAAAGCGATCGAGTTGAGCCGT
GTTACTCGCGTCTTCCACGCAGATAAGGTTTTACGACCTTTCAATCTGTA
CGAAGCAGATGGAAACAAAATTCTTATGCAATGTAACAAAGGAGAATACG
CCAAGAAGAATTTTTATATCACTCATGTAGTGGACAAGAAGAACTATCTC
ATCCTCACTCAATCaaacATTTTGTATGTTGGAAAGAACGAGTTGAAAAT
GGGTGAATGGGAATCggtttgggttatcgagttcaATGAGCTAAAACGTG
AACCAGAAGTGAAAGAGACAAAGATTATTTTCCATATCCATAATACGGAC
ACGCGACGTTCAATTTTCAAGAAATCGACGAACACACGTGAAGTGATATT
GGAGTCTAGTGCTGTTGCAGACTGGTTTATCTTAAAGCTTAGAGATGCTA
AAATGTTATAGatggtatttgaaTCTTTGGTTGCTGACCTCTTGAACAAG
TATCTGGGTCAATATGTGAAAAATCTTGATGCTTCTCAATTGAAGATTGG
CATTTGGGGAGGAAATGTTGTCCTGACAGAACTTGAACTGAAAGATACAG
CTCTGGATGATCTTGACTTACCCATAAAAGTTGTTCGTGGATATTTGGgt
AAATTGGTCTTGTCCATCCCATGGAAAAATCTTTACACTGAATCAACTGT
TGTCGATATTCAAGATCTCCACCTTGTCGCTAAGCCTAATTTTGACATCA
AATACAATGAAGAACgcgaagaaaaatcaaaacatgacAAGAAACAACAA
CAGATTCACAATATCGAAGAAGCGAGGCAAAGAGAAGAAGACAAAAAGAA
AGGCGCCAAGAAAGAAGAGAGTGACGGTTTTGCTGAGAAACTTGCAACAA
ACGTCATAAAAAATCTACAGGTTACGATCAAGAACATACATGTTCGATAT
GAAGACTCAATCAGTGATGTGAATGGACCCTTTTCAGTCGGTCTTACAAT
GGAAAGTTTAACAGCACAAACCACAGATGAAGATTTTGTTCCAAAGATTA
TCAAAGAATCTGTCTCATTAATTCATAAGatggTGAAATTAGACAATTTG
GCTTTATATTGGAATCCAGGAGACGAACTGATTGATCCTTCACTTGATAC
CAAGCAATGGTTGgaagtTTCAACGAAGCAAATTTCAACACACCAATCGA
AGCCAGAGAAAACGAAATATATTTTGAGTCCCATGGTTGCAACGAAGAAA
TTGAAGCTGAACACCAAACCAGGTTCCAACCTTGACATCCCGAAGatgtt
TTTGAACTTGGTTTTGGAAGAACTTGGTATCATCGTGGCAAGAAGTCAAT
ATCATGGCGTGGTGCAACTGATTGAATCATTTGAACGAATGAATAGGAAC
CAACCTTTTCGTAAATACAGACCACATACCTCCGTTCTTGGGAACGAAAG
TATTTGGTGGAAGTACTGCATGTCCAGCATACTGGAGGTGGATGTCAAAA
GACGATCTCAAATGTGGAGCTGGAAGCATATTCAAAAACATCGAGTTCTT
TGCAAAGCTTACAAAGTGAAGTAcaaggaaaaattgaaacagaaaaATCC
ATCCAAACAAATTCTCACTGAACTAGAGaGCATGGAGGATGAGTTGAATA
TTGCAAGCATCACCATTTTTCGACAGCTTGCAGCTACAGAGGTTTTAACG
GAACAAAAGAAGAAAGGCACTAAAGGAAGTTTCTTCAGTTTCTTCTCCAG
ATCAAAAGAACCAGAAAAGTCTGCTGCTAATAAAATTGGAGATTTAATGG
GTGATGACCAGGAGAAGGAAATGCAGAAATTGTATGACGCAATCGGTTAT
ACTGAAAATGAAGTCATCACTCCCTTTCCTAAAGAGTACGTGGCGATGTC
AGTGGAATCGATTCTCCAGAAATTATTCATCAGCCTCATCGATGACACAG
ATAAGGCGAAAGAATTCAAAGTGTTGGATTTTTCACTCAACAACATCATT
GTAGAAGTTTTCCAAAGACCTTCTGCTCAAGCTCTCAAATTATGTGCAAA
GATAGGAGAGATGAAGTTATTTGGTACAGCTTCTGCTCAATGTACACCTC
tcatcatcaaaaacatgttaCAAGGTCGAGGTATGGAATTTCTGCCGTTG
GTGGACTTCATCTTTGAGACGAATCCTTTGAAGAAACCGGACATTGACCA
ATGTATCACTGCTATTTGTCAACCCTTAGAAATCATCTATGATGCTAACA
CGATCAACCATATCATTAGTTTCTTCAAACCTCCTGAACATGTTATCTTG
CAAGATTTACAAGACAAAGCGTATTCTACTTTCGAAGATTTTAAAGTTTC
AAGTACGGCTGGTCTTCTACATGCTATGGAACAAAGAACGGTTATGGACA
TCGACATTGATGTTGGAGCATCTCATTTGATCATCCCTGAAAAAGGTTCT
TACAATGGTTGTACAGATATGCTGGTGATCGACTTTGGTAAAATCACGAT
GAGCAGCGATCCTAGTCAAATCAGACACCTTGACCCTAAGGACATTGAGG
ATGTGAATGAAGTACAAAGCAAAGCTTATGATCGATTCTTGTTGTCGCTT
CAAGCTCTTCAAATATTACTCGTTAGAGAAGGTGAAGATTTAAAGAGTGC
TAAAAGCAACGTCAGTAAAGCTTCATCACACATTTTGCATCCCATCAATT
TCGATGGCAAACTTGCCAAAGCTATACTTCCACAAGATCCACGTTTAAAA
CAGATATGTGTCTCTGGTGAATTATCTTCGCTGTTTGTTTCTGTATCGGA
TGATAAAGTCAGTCGTCTCATCAAGCTAGCAGACTCGATACCACTCCCTC
AATCACCTTCTCACGATAACATCGACGGAGAAGAAAAACCTGAAGGACTC
TTCACCAAGGCGTTGTCAATGATAAGCTTGACAGGTGACAATGACACAGG
GGTGGACATCGGAGGATTTTCCATCCCTGTACCGACATCTCCAACATCAG
TGACGTCAGATGAAGATGAATACGGGACACCACCTGATGGCTCCATATTA
CAGTTACAACAAGAAGCTGGTCCGGACTTTTCATCAGGAGTGGCGAACCA
AGTCAAAGTGGACTTGAACTTTAAAATCCATAAAGTGATGATCGCCATTG
GTTTGACTGACAAAGCATTGAAACAGGAAAAAGAATGTCTGAAATTCATC
GTGGACGACATCAATACAGAGgtGATACTACGAAGATGGGATTTGTTCGT
CAATGCAGAAGTTGGTCGTCTGGTGTTGAATGAAATGACATGGGGTGTTG
ATGGAGAACCTTTCGCCATCATGAGTACacccaaaaacaccaaaatgttG
AAATTCAGCTATCGGAGGTGTGAATTCAACGAAAGTTTGAATCTCGGTCC
AAGTTACTTTTATTCCAAAGAAGCGCAAGTCAGAGCTTTACATTTCAAAG
ATGAATTTGGCGCCACGGATCAGATTTTAGATGTACAAGTGGCTACTTTA
TTTCTGATGCTTCATCAAGAAGCACTTTTGAGCATCATGTCATTGATCTA
CCAAGTACTGGAACCACTCAACAAACATGATAAGGAAGCCACACAGAAGA
TCAAACGGAGTTTGAGTACGGCAGGTAGTCGTTTGAGTCTCTCCatcgaa
gaaaaagaaaaggagaGACAGATACAACGAAAATTAGCCAACCCTAAAGC
ACTGGAAGCTGCCAACGAACTTAAGCAACAGGTTGGcttagaagaagaaa
aaaagatgaGAGTGACCGCCCACCTGGATGGTGTTGGTATCATGATTTGT
TCAGCCAAAGTTGACCTTGCACAAGCCTTCGTTAAAGGGTTATCTGCTAA
AGTACTGATGAAAGATGACTTATTAGAAGTGAAAGCCAGCATGAAAGATA
TGCAAGTACAAGATAATGTTGGCGAAACAAAGTACAAAGACATCATTAGC
ATGCGATCTGATGAAGTGTTCGATTTAGAGTTGGCTATTTACGAGAATGG
ATCTTCTGGTAGCAAGCAATACGATATGTCGTGTGTCGACACCAGTGTCA
AACTGAACTTCGGTCAAATGCGCGTTGTTTTCTTGTATAGATTCATACAA
GACTTAATGTCATTCACCGAAAACTTCGAAGAAGCACAGAAAGCAGTTGT
GGAAGCTGGTAAAGCTGCCAAGGATAAAGCTCTGGAAACAGCGACCGATT
TGAATAGACATTCTTCTCGTGTCAAACTAAATGTGGTTCTGAAAGCACCG
ACTATTATCATTCCAGTTGGATCAAACAATGAATTGGCTTTACTGGTGGA
TCTGGGTGAATTGCGTATTTACAACACATTCAAACTCCTCAACGATGATC
AATACCATAAGAAATCTATCATCACTGATAACATGACCATTAAGTTATCC
AATCTGAAATTGTTAAAAGCACTTATTCAAGATGGTAAAGATTTCTTGCA
TCAACGAGCCATTATTGAACCTATGATGCTACAAATAACTATTGTTCGTA
ATTTAACGAAAGGTAACCATTCCATACCGGATGTTTCAGTTCAAGCAAAG
ATGCCAGCTATTCTGTTATCAATCAGTGAAGAAGATGTGACCGTAGCTCT
AAAGATTGTCCAAGGGAATCTCGCCGAAGGTGAGTCACATGCGCCGAAGA
AGCAAGCCAAGCCTGCCAAACAAACGTTAAACGTGCCACAAGATCGTTTA
GCAGACATTTACGAGGAGcctgaagatgaagatgagaaTCGACAAGGATA
TCTTCAAACCAAACTATCCTTCGATCTGGCTAAAATTGACATCAAGCTTT
ACTTGAAACCATCTGATATGACATTTGAAGATGAATTTTTAGCGAGGACG
GATGATTTGTTGTTAGCTTTGTTCACTATTGGTAACCTGTGTGTTGATGG
AGACATCATGTCCACGCAAGCTATGAAGATGAGCGTTCGATTGGACACTT
TGGTGTTGGATGATATGAGACCTATCGAGGAGCATGAAGGTGTTAAACGT
ATGATCAACTACAGTCCCGAGCCACTCCTTGAAGAAGTCAAAACCTCTTC
TCATAAACGACCAATCGACAACTCACGAATGATCGAAATCCAAttcgatc
aaacttcatcgcaagataaaaatatcgacATCAAACTTTGTAACATGCTT
TGTATATTCAACGTTGAGTTTATCATGGTCCTGTTGAAAACGTTGCAAGC
TGCCATACCTAAAGATGATAGTCTGCAACATGGCCATTCAATGAGTAGTC
TAGACTCGGCGGCAGGGTCTGGCGGCAGCGATGACGAGGACTCTTTAGAA
GCCAGCGAGATTGTCCTCTGCACTGGTGATCAAGAAAGACCTGAGACTAA
AGTCTCTATCTTCGTCCATAACCCGCAAATTGTTTTACTAGCAGATGCAA
AGGATGTCAAAACAAATGCACTCTTTCTTACAACCGagatcaattttcaa
tatttcgaaTTGCGAGATACTCAAAAAATGATTGGCGCTGTTTCTAACAC
CGCTATTTTGTCAACTGCTTTCAAGAATGACCATCGGAGTGATATATCAA
CAGTGTTGTCATTAGATTCCATCAATCTCCACTCGTCATCACCCATCAAT
GGTAAACCTCATATGAGTGTCAGCACAACTTTGATCAAACTGAATATCTC
ACCCAAAACCATCCGAACTTTATCAGCGTGTGCTGGTTACATCTCCAATG
ATCCAACAGATGAAGAAATCAAAGAAGCTCGAAAAGCCATGCGTGATTTA
TGGCAAATTCAAACGTTCACCAATAAGCGACCGTGGTATTTAAACCACCC
ACCACAACAAGTCTTAAGTGCTGGCAGCTTCGTCCTTGCGCGAACGAGAA
CAGGAGAATATAAGCATGGTTTCTTAGCTAAAAAGGATGTCTCGTATCAA
GTCTATTTTTCAGAGGAGCGAGGAACAGCCAGTCACCGAGCCATGGATAT
CTCATCTGTTGTTTTGGATATCGTACCGCTGATCGGTGATCTATGTGTTG
GATGTAATGTTTTAGCTGTGGAATCGAAAGAACATGGATATCGTACTGGT
CGAATTACTCAGGTTTGGGATTCGAATGTGGATAAAGATTCTTCGGATGG
CGCCAAACAATCTGTTTCTGTCAAGACAACTGCTATTGCTCCAATCAAAT
ACCTTGTCAATTTCTATGACAACCAAACGGAGAACTTCTTCCCGCCTGAT
GAACTTCGTATCATTGGTAAACCCATCAAGGGGGTTGTCCCTGGACTAGG
GGCGTGTGTTTACGCCCGCTTTAATGATGGTTTTTACTATCGGGGCAAAG
TTGATGACATCGAGGATTATCGAATCCGAGTGCAATTGGATGAGATCAGT
GGAGAAATCGAACACGACATCGATGATCCGTCAGCCGTTATTTTGAACCT
GACGCCTCAATACCGTCAAGTCAAAAAGCATTTCAAAGTCATTGCATCCA
AAGGAAGCACAACTAAAGGATATCATCCGGGGAAAGTGACCGCCATCCAA
GGTGAAGGAAATAACCGATTGTATTCGATACGCTTCGAAGACGGTACAAT
TAACCAAGTACCCATCacgaaattgattttgatgccAAAAGCACCTTTTG
ATGCTTTACCTGAAGTTGGCACATACGTTTATTCCCGAGTGTCACGCGAC
GCTCCTTTATACGAGAAGGGTATCGTAGCAGAGAAGAACACAATGATCTG
CGTTAAACATTTAAATGGACGGAAATTGGCTCACGAAATACAAAACATTC
ATTTTGTTGTCCGAAATATCGTTCCTCTCGTGTCATCAttgaagGTTGGT
TTGGACGTCATAGTGCAACCTGACAATGACGATCAGAAAATGTATTTGGC
TGTCATTAGGGAAGTCACCAAAAAAGAAGGTGACAAAACGAACCGTTATC
TAGTGGAGTTTACGGATGGATCCAAGAAGAGAGTGACGCCCAGCCGGATC
CGTATACTTTCTCAATACGGAAGTGCAGAAACGAGTGAAGAAAATGCTGA
CATTATCACAACAAGACAGGAGGAACTAGTTCTCGATGTGCAAGGTATCT
CATTACGTGTGGAAGGTTACTTGGGAGGCGTGTTGACACCCATGCTCAAA
ATGGATTCCAAAATCACAGCTAACTTGAAGGATTGGTCAAGCCAAATGAA
TGCACACGCTACTGTATCATTAGAAGCCAGTTATTATAACGAAAACGTTG
CCGAATGGGAGCCAGTTATTGAACCTTTGATGGAGAAACGGAGGGAAAGA
CCGTGGCAACTCTCTGTCAATTACACGATGGAAGGTGACGACAATTCTGC
TTCATCCACTTCCAACGAACTCGTTTTACAAAAACCGGAATCCAACCTGA
AAATCAAATCTCAAGATAATCTTGAATTGACAATTTCAAAATCATGTCTT
GCTTTACTCGGTGAATTGGGACAGGTGTTTGGAGATGCAGTAGAATCTGT
GGACGTTTTACCACAAGTCCTGGTCGAAAAAGAACCTTTCATGATCGAAA
ACTTGCTCTCCAAGAAGGTGACAGTAACATTGAATGAACTTCTGCAGGGA
CCAAATGGAGATTCGACAATCGAGCTAGCATCTTCTTCGAATCCTGTTGG
CATTACTTTTGCTCCCAagaaatttgagaaacgaaAGACCAACGATCTAT
ACACAATCAATTTAtcgGTGGACGGTTTTCATGACATTAAAGACATTGTG
GTTCAAAGAAAGCGAAGCGTTATCTATGATCTTGTACCAATAAAACTATT
ATCAGCACAGTCTTCATATTCGATAGTGGTACAAGTGAAGACAACAGACG
GACAACGTATCATCGTACTCCGATCACCATTGCAGTTGAAAAATCACTTT
CCAATGCCGTTGGATGTCAGCTACATTTCCAAAGAAAACCAACCAGTTAA
ACTGACAACAGTGGGATCGGGAGATATCTATTCCTTCCCTTTGTTGTTAA
CCTACCACAGTGTTTTTCATCTCAAACCTGCTGGTTTCGACTACGGTGAT
TGCACAGAAGCTCTCAATTGGAGTGATTTGAAGACGAGCAACGAAAAACA
GTTCTCCTGCCCTTCACCTGACAAAAGTGCTGACCCTTTCTACATGCAGG
TGGTGATGAAAGAGGAGACGTACTCTTCCGTACACGGCATGTTGGACTGT
GTACCACGTTACACGTTGGAGTGCTTTCCCGTCATCACGCTGCATAATTA
CCTACCTTGCACTATTAATTATAAGATCAAGGGTATGGCGAAATCGGAAA
GTCTACCAGGCGGACACAATTGGCCTTTGTTTACCGTCAACTTCAGTGAT
AAACCTTCCATCTATATCGAGATTGAGTCGTATAACAACCAAAGATGGGA
AGGAGGTTTGACATTACCAACAAAACCGGTAGATTCTTTGAACAAACCAT
CATTATCTTTCGTCATGATGTCTGGTGAACGCAAAATGGAATTGGGTGTT
TATTACCAGTTAGACGGTTCATTGAACATCACCTTATATTCGCCTTACTG
GCTTCTCAATAAAACTGGAAAACCACTTGTCTATCAGCCAGCGGGGAGCA
GCATCCAGCAAGTTCACCAAGAGAACGATGTAAATGCTCTTATGATGCTC
GTCAAAGGGAAACATAAAAAGgcgaaagtgaaagtgaaaaataGCGAGTC
ATGGTCAAATGAATTTTCATTGGATACTGTTGGCAGTGGTGGTTCCTTGA
AATGCAATGGTCCAAGAGATCGAGTTTATGAGATTGGTTTGAACATCAGT
TTGTCATACTTTGGATTGACGAAGATTGTGACGTTCACGCCACTCCGAAT
GTTATCTAACCACACCAAGTACACCATCAGTATGGCAGAAAGTAATTCTA
AATCGTCAGAATGGCACACGGTAAACCCTGACGAGaacattccatTCTGG
CCGACGAAACTTCCTTTGGTCAACCTTTACATTAACATCAATGGGCAAGA
TTCAGTGAAATTCAACCCTGAAGTTGGAAAAACTTTACTGTTGAAGTTCC
AGAATGAGGTTGGAGGAGTTTGCGTGGATTACCAAGAAAAGGACTCGTCC
TCAGTCCTTTCGTTTAATCCGTACTTCGCAGGTGCAGCTCCTGTGCGGCt
tgaaaatctttgcaaaaaGATCGGCATGATCGCTTATAAACAAGCAGGTT
CGGTAATGGGTCACGTGTTAACACATGACCAATCAGTGTTGTACACGTGG
GATGATCCAACCATGGAACAAGAATTGATTTGTTCCATTGTCAATGATGA
AGCCAGTGAAACAAGGATCAAACTCGATGCCAACGATTTCGGACGAATGA
GAGTTGGAGATGGTGCAATTTATTGGGTTTCCTTTCTGGATGGTCTTCAA
CGTGTTCTATTGTTCACTGATAACTTCAAATCTGCTTACTGCGCATGTCA
GgaGCAAAATTTACGCCCAACCATGGAAGTTGACTTTGAGATTGAGAGTT
TTGGTTTGTCTCTGGTCAATGTTGATAAGAGAATGGAGATTGGCTACTTA
GCTATCCGACAAAGCAAGACTGTATGGGAGCAACGCAAGAAAAAGAACCG
CTGGAAAGCTTTACCGCTTGCCATGTGTGAAGCTCTCGAAGAAGGTTATC
TCAATTATCAAAACAGAAAAGGTGCAGTCAAAGAGAAAGTTCTGGATAAG
GAGGTGGATTACGAGAAGATGTTTATTACGAAACCTGAGAAGATTAAGAT
CAGAAGAACGTACCACAGCGGTCTTGGTTTCAAATACACAATCTCACCCA
ATGAAATGCGTGTGCATGCTTCTATCAGCTCAATACAGTTGGATAGCCAT
GTTCCAGGTTCGACCTTTCCAACAGTCTTGCATATGGTTGAACCACCAAA
ATCTGTTGCTTCAGAAAACGCTCCAAAGCCATTCTttgaattgagtttaa
tgaCAAGGATCGGTGATAAAAATGTGGTCAATGAAGTcagCTATTGTCAC
GTGTTGATTCAAGAGATGGATGTGAGGGTTGATATTGGATTTTTATTGGC
TCTGATGGAACTCTTCAGTCATGCAAGAGCTCGAACAACCGAGAAAGAAC
AATACGCGCTTGATATTGGCCAAGCAGCAACAAAGTTTGAAGAAAGCGCT
GAATTTCAGGCAGCCAAACAAGATCGATATTACGTTTTGAACGACTTTCA
TTTATCACCGCTAAAGATTCACGTCAGTTTCTCTTTGACGGGTGGTTCCA
AAGATGAAAATGCTATTGCTTCATTACATGGTAACGTGTTGAACTTGTTG
TTACAAAGTGTCGGACTGGCCTTCACTGAAATACAAGACGTACAATTCAA
ATTAGCATGTTACGAAGTGCATAAGTCCATGCAGAGTAATTCGCAGCTCG
GTGATGGAATAACTAAACATTATCAAACACAGGCTATCAAGCAACTTTAT
GTGTTGGTACTCGGGCTAGACGTTCTTGGTAATCCGTATGGTTTGATATC
TGGTGTTGGAACCGGAGCAAAGAATTTCTTCTACGAACCTTACCAGGGAT
TAATTCAAGGACCAGAAGAATTTGCGGAAGGATTGGCGTATGGGGTGAAG
AGTCTTGTTGGTGGAACCGTGGGTGGAGTATCAGGAGCTGTGAGTAAGAT
TACCGGTACCTTCGGTAAAGGTTTGGCTGCATTGACCTTGGATGAAGAAT
ATCAACAAAAGAGACGTGAAAACATGAGCCAACGCCCAACTAACCTCGGT
GAAGGTCTCGCCAAAGGTGGTAAAGGCCTTGTAAAGGGTATCGTGTCTGG
TGTTACAGGGATCGTTACCAAACCCTATGAAGGTGCCAAGAATGATGGTG
CAGGTGGCTTTTTTAAGGGCGTTGGAAAAGGCCTGATTGGCGTGGTTGCA
CGCCCTGTTGGTGGAGTGGTAGATATGGCCAGTAACACGTTTGATGGTTT
GAAAAGCACGACATCTGGCGTGAAAGCGATCGAGTTGAGCCGTGTTACTC
GCGTCTTCCACGCAGATAAGGTTTTACGACCTTTCAATCTGTACGAAGCA
GATGGAAACAAAATTCTTATGCAATGTAACAAAGGAGAATACGCCAAGAA
GAATTTTTATATCACTCATGTAGTGGACAAGAAGAACTATCTCATCCTCA
CTCAATCaaacATTTTGTATGTTGGAAAGAACGAGTTGAAAATGGGTGAA
TGGGAATCggtttgggttatcgagttcaATGAGCTAAAACGTGAACCAGA
AGTGAAAGAGACAAAGATTATTTTCCATATCCATAATACGGACACGCGAC
GTTCAATTTTCAAGAAATCGACGAACACACGTGAAGTGATATTGGAGTCT
AGTGCTGTTGCAGACTGGTTTATCTTAAAGCTTAGAGATGCTAAAATGTT
ATAGatggtatttgaaTCTTTGGTTGCTGACCTCTTGAACAAGTATCTGG
GTCAATATGTGAAAAATCTTGATGCTTCTCAATTGAAGATTGGCATTTGG
GGAGGAAATGTTGTCCTGACAGAACTTGAACTGAAAGATACAGCTCTGGA
TGATCTTGACTTACCCATAAAAGTTGTTCGTGGATATTTGGgtAAATTGG
TCTTGTCCATCCCATGGAAAAATCTTTACACTGAATCAACTGTTGTCGAT
ATTCAAGATCTCCACCTTGTCGCTAAGCCTAATTTTGACATCAAATACAA
TGAAGAACgcgaagaaaaatcaaaacatgacAAGAAACAACAACAGATTC
ACAATATCGAAGAAGCGAGGCAAAGAGAAGAAGACAAAAAGAAAGGCGCC
AAGAAAGAAGAGAGTGACGGTTTTGCTGAGAAACTTGCAACAAACGTCAT
AAAAAATCTACAGGTTACGATCAAGAACATACATGTTCGATATGAAGACT
CAATCAGTGATGTGAATGGACCCTTTTCAGTCGGTCTTACAATGGAAAGT
TTAACAGCACAAACCACAGATGAAGATTTTGTTCCAAAGATTATCAAAGA
ATCTGTCTCATTAATTCATAAGatggTGAAATTAGACAATTTGGCTTTAT
ATTGGAATCCAGGAGACGAACTGATTGATCCTTCACTTGATACCAAGCAA
TGGTTGgaagtTTCAACGAAGCAAATTTCAACACACCAATCGAAGCCAGA
GAAAACGAAATATATTTTGAGTCCCATGGTTGCAACGAAGAAATTGAAGC
TGAACACCAAACCAGGTTCCAACCTTGACATCCCGAAGatgttTTTGAAC
TTGGTTTTGGAAGAACTTGGTATCATCGTGGCAAGAAGTCAATATCATGG
CGTGGTGCAACTGATTGAATCATTTGAACGAATGAATAGGAACCAACCTT
TTCGTAAATACAGACCACATACCTCCGTTCTTGGGAACGAAAGTATTTGG
TGGAAGTACTGCATGTCCAGCATACTGGAGGTGGATGTCAAAAGACGATC
TCAAATGTGGAGCTGGAAGCATATTCAAAAACATCGAGTTCTTTGCAAAG
CTTACAAAGTGAAGTAcaaggaaaaattgaaacagaaaaATCCATCCAAA
CAAATTCTCACTGAACTAGAGaGCATGGAGGATGAGTTGAATATTGCAAG
CATCACCATTTTTCGACAGCTTGCAGCTACAGAGGTTTTAACGGAACAAA
AGAAGAAAGGCACTAAAGGAAGTTTCTTCAGTTTCTTCTCCAGATCAAAA
GAACCAGAAAAGTCTGCTGCTAATAAAATTGGAGATTTAATGGGTGATGA
CCAGGAGAAGGAAATGCAGAAATTGTATGACGCAATCGGTTATACTGAAA
ATGAAGTCATCACTCCCTTTCCTAAAGAGTACGTGGCGATGTCAGTGGAA
TCGATTCTCCAGAAATTATTCATCAGCCTCATCGATGACACAGATAAGGC
GAAAGAATTCAAAGTGTTGGATTTTTCACTCAACAACATCATTGTAGAAG
TTTTCCAAAGACCTTCTGCTCAAGCTCTCAAATTATGTGCAAAGATAGGA
GAGATGAAGTTATTTGGTACAGCTTCTGCTCAATGTACACCTCtcatcat
caaaaacatgttaCAAGGTCGAGGTATGGAATTTCTGCCGTTGGTGGACT
TCATCTTTGAGACGAATCCTTTGAAGAAACCGGACATTGACCAATGTATC
ACTGCTATTTGTCAACCCTTAGAAATCATCTATGATGCTAACACGATCAA
CCATATCATTAGTTTCTTCAAACCTCCTGAACATGTTATCTTGCAAGATT
TACAAGACAAAGCGTATTCTACTTTCGAAGATTTTAAAGTTTCAAGTACG
GCTGGTCTTCTACATGCTATGGAACAAAGAACGGTTATGGACATCGACAT
TGATGTTGGAGCATCTCATTTGATCATCCCTGAAAAAGGTTCTTACAATG
GTTGTACAGATATGCTGGTGATCGACTTTGGTAAAATCACGATGAGCAGC
GATCCTAGTCAAATCAGACACCTTGACCCTAAGGACATTGAGGATGTGAA
TGAAGTACAAAGCAAAGCTTATGATCGATTCTTGTTGTCGCTTCAAGCTC
TTCAAATATTACTCGTTAGAGAAGGTGAAGATTTAAAGAGTGCTAAAAGC
AACGTCAGTAAAGCTTCATCACACATTTTGCATCCCATCAATTTCGATGG
CAAACTTGCCAAAGCTATACTTCCACAAGATCCACGTTTAAAACAGATAT
GTGTCTCTGGTGAATTATCTTCGCTGTTTGTTTCTGTATCGGATGATAAA
GTCAGTCGTCTCATCAAGCTAGCAGACTCGATACCACTCCCTCAATCACC
TTCTCACGATAACATCGACGGAGAAGAAAAACCTGAAGGACTCTTCACCA
AGGCGTTGTCAATGATAAGCTTGACAGGTGACAATGACACAGGGGTGGAC
ATCGGAGGATTTTCCATCCCTGTACCGACATCTCCAACATCAGTGACGTC
AGATGAAGATGAATACGGGACACCACCTGATGGCTCCATATTACAGTTAC
AACAAGAAGCTGGTCCGGACTTTTCATCAGGAGTGGCGAACCAAGTCAAA
GTGGACTTGAACTTTAAAATCCATAAAGTGATGATCGCCATTGGTTTGAC
TGACAAAGCATTGAAACAGGAAAAAGAATGTCTGAAATTCATCGTGGACG
ACATCAATACAGAGgtGATACTACGAAGATGGGATTTGTTCGTCAATGCA
GAAGTTGGTCGTCTGGTGTTGAATGAAATGACATGGGGTGTTGATGGAGA
ACCTTTCGCCATCATGAGTACacccaaaaacaccaaaatgttGAAATTCA
GCTATCGGAGGTGTGAATTCAACGAAAGTTTGAATCTCGGTCCAAGTTAC
TTTTATTCCAAAGAAGCGCAAGTCAGAGCTTTACATTTCAAAGATGAATT
TGGCGCCACGGATCAGATTTTAGATGTACAAGTGGCTACTTTATTTCTGA
TGCTTCATCAAGAAGCACTTTTGAGCATCATGTCATTGATCTACCAAGTA
CTGGAACCACTCAACAAACATGATAAGGAAGCCACACAGAAGATCAAACG
GAGTTTGAGTACGGCAGGTAGTCGTTTGAGTCTCTCCatcgaagaaaaag
aaaaggagaGACAGATACAACGAAAATTAGCCAACCCTAAAGCACTGGAA
GCTGCCAACGAACTTAAGCAACAGGTTGGcttagaagaagaaaaaaagat
gaGAGTGACCGCCCACCTGGATGGTGTTGGTATCATGATTTGTTCAGCCA
AAGTTGACCTTGCACAAGCCTTCGTTAAAGGGTTATCTGCTAAAGTACTG
ATGAAAGATGACTTATTAGAAGTGAAAGCCAGCATGAAAGATATGCAAGT
ACAAGATAATGTTGGCGAAACAAAGTACAAAGACATCATTAGCATGCGAT
CTGATGAAGTGTTCGATTTAGAGTTGGCTATTTACGAGAATGGATCTTCT
GGTAGCAAGCAATACGATATGTCGTGTGTCGACACCAGTGTCAAACTGAA
CTTCGGTCAAATGCGCGTTGTTTTCTTGTATAGATTCATACAAGACTTAA
TGTCATTCACCGAAAACTTCGAAGAAGCACAGAAAGCAGTTGTGGAAGCT
GGTAAAGCTGCCAAGGATAAAGCTCTGGAAACAGCGACCGATTTGAATAG
ACATTCTTCTCGTGTCAAACTAAATGTGGTTCTGAAAGCACCGACTATTA
TCATTCCAGTTGGATCAAACAATGAATTGGCTTTACTGGTGGATCTGGGT
GAATTGCGTATTTACAACACATTCAAACTCCTCAACGATGATCAATACCA
TAAGAAATCTATCATCACTGATAACATGACCATTAAGTTATCCAATCTGA
AATTGTTAAAAGCACTTATTCAAGATGGTAAAGATTTCTTGCATCAACGA
GCCATTATTGAACCTATGATGCTACAAATAACTATTGTTCGTAATTTAAC
GAAAGGTAACCATTCCATACCGGATGTTTCAGTTCAAGCAAAGATGCCAG
CTATTCTGTTATCAATCAGTGAAGAAGATGTGACCGTAGCTCTAAAGATT
GTCCAAGGGAATCTCGCCGAAGGTGAGTCACATGCGCCGAAGAAGCAAGC
CAAGCCTGCCAAACAAACGTTAAACGTGCCACAAGATCGTTTAGCAGACA
TTTACGAGGAGcctgaagatgaagatgagaaTCGACAAGGATATCTTCAA
ACCAAACTATCCTTCGATCTGGCTAAAATTGACATCAAGCTTTACTTGAA
ACCATCTGATATGACATTTGAAGATGAATTTTTAGCGAGGACGGATGATT
TGTTGTTAGCTTTGTTCACTATTGGTAACCTGTGTGTTGATGGAGACATC
ATGTCCACGCAAGCTATGAAGATGAGCGTTCGATTGGACACTTTGGTGTT
GGATGATATGAGACCTATCGAGGAGCATGAAGGTGTTAAACGTATGATCA
ACTACAGTCCCGAGCCACTCCTTGAAGAAGTCAAAACCTCTTCTCATAAA
CGACCAATCGACAACTCACGAATGATCGAAATCCAAttcgatcaaacttc
atcgcaagataaaaatatcgacATCAAACTTTGTAACATGCTTTGTATAT
TCAACGTTGAGTTTATCATGGTCCTGTTGAAAACGTTGCAAGCTGCCATA
CCTAAAGATGATAGTCTGCAACATGGCCATTCAATGAGTAGTCTAGACTC
GGCGGCAGGGTCTGGCGGCAGCGATGACGAGGACTCTTTAGAAGCCAGCG
AGATTGTCCTCTGCACTGGTGATCAAGAAAGACCTGAGACTAAAGTCTCT
ATCTTCGTCCATAACCCGCAAATTGTTTTACTAGCAGATGCAAAGGATGT
CAAAACAAATGCACTCTTTCTTACAACCGagatcaattttcaatatttcg
aaTTGCGAGATACTCAAAAAATGATTGGCGCTGTTTCTAACACCGCTATT
TTGTCAACTGCTTTCAAGAATGACCATCGGAGTGATATATCAACAGTGTT
GTCATTAGATTCCATCAATCTCCACTCGTCATCACCCATCAATGGTAAAC
CTCATATGAGTGTCAGCACAACTTTGATCAAACTGAATATCTCACCCAAA
ACCATCCGAACTTTATCAGCGTGTGCTGGTTACATCTCCAATGATCCAAC
AGATGAAGAAATCAAAGAAGCTCGAAAAGCCATGCGTGATTTATGGCAAA
TTCAAACGTTCACCAATAAGCGACCGTGGTATTTAAACCACCCACCACAA
CAAGTCTTAAGTGCTGGCAGCTTCGTCCTTGCGCGAACGAGAACAGGAGA
ATATAAGCATGGTTTCTTAGCTAAAAAGGATGTCTCGTATCAAGTCTATT
TTTCAGAGGAGCGAGGAACAGCCAGTCACCGAGCCATGGATATCTCATCT
GTTGTTTTGGATATCGTACCGCTGATCGGTGATCTATGTGTTGGATGTAA
TGTTTTAGCTGTGGAATCGAAAGAACATGGATATCGTACTGGTCGAATTA
CTCAGGTTTGGGATTCGAATGTGGATAAAGATTCTTCGGATGGCGCCAAA
CAATCTGTTTCTGTCAAGACAACTGCTATTGCTCCAATCAAATACCTTGT
CAATTTCTATGACAACCAAACGGAGAACTTCTTCCCGCCTGATGAACTTC
GTATCATTGGTAAACCCATCAAGGGGGTTGTCCCTGGACTAGGGGCGTGT
GTTTACGCCCGCTTTAATGATGGTTTTTACTATCGGGGCAAAGTTGATGA
CATCGAGGATTATCGAATCCGAGTGCAATTGGATGAGATCAGTGGAGAAA
TCGAACACGACATCGATGATCCGTCAGCCGTTATTTTGAACCTGACGCCT
CAATACCGTCAAGTCAAAAAGCATTTCAAAGTCATTGCATCCAAAGGAAG
CACAACTAAAGGATATCATCCGGGGAAAGTGACCGCCATCCAAGGTGAAG
GAAATAACCGATTGTATTCGATACGCTTCGAAGACGGTACAATTAACCAA
GTACCCATCacgaaattgattttgatgccAAAAGCACCTTTTGATGCTTT
ACCTGAAGTTGGCACATACGTTTATTCCCGAGTGTCACGCGACGCTCCTT
TATACGAGAAGGGTATCGTAGCAGAGAAGAACACAATGATCTGCGTTAAA
CATTTAAATGGACGGAAATTGGCTCACGAAATACAAAACATTCATTTTGT
TGTCCGAAATATCGTTCCTCTCGTGTCATCAttgaagGTTGGTTTGGACG
TCATAGTGCAACCTGACAATGACGATCAGAAAATGTATTTGGCTGTCATT
AGGGAAGTCACCAAAAAAGAAGGTGACAAAACGAACCGTTATCTAGTGGA
GTTTACGGATGGATCCAAGAAGAGAGTGACGCCCAGCCGGATCCGTATAC
TTTCTCAATACGGAAGTGCAGAAACGAGTGAAGAAAATGCTGACATTATC
ACAACAAGACAGGAGGAACTAGTTCTCGATGTGCAAGGTATCTCATTACG
TGTGGAAGGTTACTTGGGAGGCGTGTTGACACCCATGCTCAAAATGGATT
CCAAAATCACAGCTAACTTGAAGGATTGGTCAAGCCAAATGAATGCACAC
GCTACTGTATCATTAGAAGCCAGTTATTATAACGAAAACGTTGCCGAATG
GGAGCCAGTTATTGAACCTTTGATGGAGAAACGGAGGGAAAGACCGTGGC
AACTCTCTGTCAATTACACGATGGAAGGTGACGACAATTCTGCTTCATCC
ACTTCCAACGAACTCGTTTTACAAAAACCGGAATCCAACCTGAAAATCAA
ATCTCAAGATAATCTTGAATTGACAATTTCAAAATCATGTCTTGCTTTAC
TCGGTGAATTGGGACAGGTGTTTGGAGATGCAGTAGAATCTGTGGACGTT
TTACCACAAGTCCTGGTCGAAAAAGAACCTTTCATGATCGAAAACTTGCT
CTCCAAGAAGGTGACAGTAACATTGAATGAACTTCTGCAGGGACCAAATG
GAGATTCGACAATCGAGCTAGCATCTTCTTCGAATCCTGTTGGCATTACT
TTTGCTCCCAagaaatttgagaaacgaaAGACCAACGATCTATACACAAT
CAATTTAtcgGTGGACGGTTTTCATGACATTAAAGACATTGTGGTTCAAA
GAAAGCGAAGCGTTATCTATGATCTTGTACCAATAAAACTATTATCAGCA
CAGTCTTCATATTCGATAGTGGTACAAGTGAAGACAACAGACGGACAACG
TATCATCGTACTCCGATCACCATTGCAGTTGAAAAATCACTTTCCAATGC
CGTTGGATGTCAGCTACATTTCCAAAGAAAACCAACCAGTTAAACTGACA
ACAGTGGGATCGGGAGATATCTATTCCTTCCCTTTGTTGTTAACCTACCA
CAGTGTTTTTCATCTCAAACCTGCTGGTTTCGACTACGGTGATTGCACAG
AAGCTCTCAATTGGAGTGATTTGAAGACGAGCAACGAAAAACAGTTCTCC
TGCCCTTCACCTGACAAAAGTGCTGACCCTTTCTACATGCAGGTGGTGAT
GAAAGAGGAGACGTACTCTTCCGTACACGGCATGTTGGACTGTGTACCAC
GTTACACGTTGGAGTGCTTTCCCGTCATCACGCTGCATAATTACCTACCT
TGCACTATTAATTATAAGATCAAGGGTATGGCGAAATCGGAAAGTCTACC
AGGCGGACACAATTGGCCTTTGTTTACCGTCAACTTCAGTGATAAACCTT
CCATCTATATCGAGATTGAGTCGTATAACAACCAAAGATGGGAAGGAGGT
TTGACATTACCAACAAAACCGGTAGATTCTTTGAACAAACCATCATTATC
TTTCGTCATGATGTCTGGTGAACGCAAAATGGAATTGGGTGTTTATTACC
AGTTAGACGGTTCATTGAACATCACCTTATATTCGCCTTACTGGCTTCTC
AATAAAACTGGAAAACCACTTGTCTATCAGCCAGCGGGGAGCAGCATCCA
GCAAGTTCACCAAGAGAACGATGTAAATGCTCTTATGATGCTCGTCAAAG
GGAAACATAAAAAGgcgaaagtgaaagtgaaaaataGCGAGTCATGGTCA
AATGAATTTTCATTGGATACTGTTGGCAGTGGTGGTTCCTTGAAATGCAA
TGGTCCAAGAGATCGAGTTTATGAGATTGGTTTGAACATCAGTTTGTCAT
ACTTTGGATTGACGAAGATTGTGACGTTCACGCCACTCCGAATGTTATCT
AACCACACCAAGTACACCATCAGTATGGCAGAAAGTAATTCTAAATCGTC
AGAATGGCACACGGTAAACCCTGACGAGaacattccatTCTGGCCGACGA
AACTTCCTTTGGTCAACCTTTACATTAACATCAATGGGCAAGATTCAGTG
AAATTCAACCCTGAAGTTGGAAAAACTTTACTGTTGAAGTTCCAGAATGA
GGTTGGAGGAGTTTGCGTGGATTACCAAGAAAAGGACTCGTCCTCAGTCC
TTTCGTTTAATCCGTACTTCGCAGGTGCAGCTCCTGTGCGGCttgaaaat
ctttgcaaaaaGATCGGCATGATCGCTTATAAACAAGCAGGTTCGGTAAT
GGGTCACGTGTTAACACATGACCAATCAGTGTTGTACACGTGGGATGATC
CAACCATGGAACAAGAATTGATTTGTTCCATTGTCAATGATGAAGCCAGT
GAAACAAGGATCAAACTCGATGCCAACGATTTCGGACGAATGAGAGTTGG
AGATGGTGCAATTTATTGGGTTTCCTTTCTGGATGGTCTTCAACGTGTTC
TATTGTTCACTGATAACTTCAAATCTGCTTACTGCGCATGTCAGgaGCAA
AATTTACGCCCAACCATGGAAGTTGACTTTGAGATTGAGAGTTTTGGTTT
GTCTCTGGTCAATGTTGATAAGAGAATGGAGATTGGCTACTTAGCTATCC
GACAAAGCAAGACTGTATGGGAGCAACGCAAGAAAAAGAACCGCTGGAAA
GCTTTACCGCTTGCCATGTGTGAAGCTCTCGAAGAAGGTTATCTCAATTA
TCAAAACAGAAAAGGTGCAGTCAAAGAGAAAGTTCTGGATAAGGAGGTGG
ATTACGAGAAGATGTTTATTACGAAACCTGAGAAGATTAAGATCAGAAGA
ACGTACCACAGCGGTCTTGGTTTCAAATACACAATCTCACCCAATGAAAT
GCGTGTGCATGCTTCTATCAGCTCAATACAGTTGGATAGCCATGTTCCAG
GTTCGACCTTTCCAACAGTCTTGCATATGGTTGAACCACCAAAATCTGTT
GCTTCAGAAAACGCTCCAAAGCCATTCTttgaattgagtttaatgaCAAG
GATCGGTGATAAAAATGTGGTCAATGAAGTcagCTATTGTCACGTGTTGA
TTCAAGAGATGGATGTGAGGGTTGATATTGGATTTTTATTGGCTCTGATG
GAACTCTTCAGTCATGCAAGAGCTCGAACAACCGAGAAAGAACAATACGC
GCTTGATATTGGCCAAGCAGCAACAAAGTTTGAAGAAAGCGCTGAATTTC
AGGCAGCCAAACAAGATCGATATTACGTTTTGAACGACTTTCATTTATCA
CCGCTAAAGATTCACGTCAGTTTCTCTTTGACGGGTGGTTCCAAAGATGA
AAATGCTATTGCTTCATTACATGGTAACGTGTTGAACTTGTTGTTACAAA
GTGTCGGACTGGCCTTCACTGAAATACAAGACGTACAATTCAAATTAGCA
TGTTACGAAGTGCATAAGTCCATGCAGAGTAATTCGCAGCTCGGTGATGG
AATAACTAAACATTATCAAACACAGGCTATCAAGCAACTTTATGTGTTGG
TACTCGGGCTAGACGTTCTTGGTAATCCGTATGGTTTGATATCTGGTGTT
GGAACCGGAGCAAAGAATTTCTTCTACGAACCTTACCAGGGATTAATTCA
AGGACCAGAAGAATTTGCGGAAGGATTGGCGTATGGGGTGAAGAGTCTTG
TTGGTGGAACCGTGGGTGGAGTATCAGGAGCTGTGAGTAAGATTACCGGT
ACCTTCGGTAAAGGTTTGGCTGCATTGACCTTGGATGAAGAATATCAACA
AAAGAGACGTGAAAACATGAGCCAACGCCCAACTAACCTCGGTGAAGGTC
TCGCCAAAGGTGGTAAAGGCCTTGTAAAGGGTATCGTGTCTGGTGTTACA
GGGATCGTTACCAAACCCTATGAAGGTGCCAAGAATGATGGTGCAGGTGG
CTTTTTTAAGGGCGTTGGAAAAGGCCTGATTGGCGTGGTTGCACGCCCTG
TTGGTGGAGTGGTAGATATGGCCAGTAACACGTTTGATGGTTTGAAAAGC
ACGACATCTGGCGTGAAAGCGATCGAGTTGAGCCGTGTTACTCGCGTCTT
CCACGCAGATAAGGTTTTACGACCTTTCAATCTGTACGAAGCAGATGGAA
ACAAAATTCTTATGCAATGTAACAAAGGAGAATACGCCAAGAAGAATTTT
TATATCACTCATGTAGTGGACAAGAAGAACTATCTCATCCTCACTCAATC
aaacATTTTGTATGTTGGAAAGAACGAGTTGAAAATGGGTGAATGGGAAT
CggtttgggttatcgagttcaATGAGCTAAAACGTGAACCAGAAGTGAAA
GAGACAAAGATTATTTTCCATATCCATAATACGGACACGCGACGTTCAAT
TTTCAAGAAATCGACGAACACACGTGAAGTGATATTGGAGTCTAGTGCTG
TTGCAGACTGGTTTATCTTAAAGCTTAGAGATGCTAAAATGTTATAGatg
gtatttgaaTCTTTGGTTGCTGACCTCTTGAACAAGTATCTGGGTCAATA
TGTGAAAAATCTTGATGCTTCTCAATTGAAGATTGGCATTTGGGGAGGAA
ATGTTGTCCTGACAGAACTTGAACTGAAAGATACAGCTCTGGATGATCTT
GACTTACCCATAAAAGTTGTTCGTGGATATTTGGgtAAATTGGTCTTGTC
CATCCCATGGAAAAATCTTTACACTGAATCAACTGTTGTCGATATTCAAG
ATCTCCACCTTGTCGCTAAGCCTAATTTTGACATCAAATACAATGAAGAA
CgcgaagaaaaatcaaaacatgacAAGAAACAACAACAGATTCACAATAT
CGAAGAAGCGAGGCAAAGAGAAGAAGACAAAAAGAAAGGCGCCAAGAAAG
AAGAGAGTGACGGTTTTGCTGAGAAACTTGCAACAAACGTCATAAAAAAT
CTACAGGTTACGATCAAGAACATACATGTTCGATATGAAGACTCAATCAG
TGATGTGAATGGACCCTTTTCAGTCGGTCTTACAATGGAAAGTTTAACAG
CACAAACCACAGATGAAGATTTTGTTCCAAAGATTATCAAAGAATCTGTC
TCATTAATTCATAAGatggTGAAATTAGACAATTTGGCTTTATATTGGAA
TCCAGGAGACGAACTGATTGATCCTTCACTTGATACCAAGCAATGGTTGg
aagtTTCAACGAAGCAAATTTCAACACACCAATCGAAGCCAGAGAAAACG
AAATATATTTTGAGTCCCATGGTTGCAACGAAGAAATTGAAGCTGAACAC
CAAACCAGGTTCCAACCTTGACATCCCGAAGatgttTTTGAACTTGGTTT
TGGAAGAACTTGGTATCATCGTGGCAAGAAGTCAATATCATGGCGTGGTG
CAACTGATTGAATCATTTGAACGAATGAATAGGAACCAACCTTTTCGTAA
ATACAGACCACATACCTCCGTTCTTGGGAACGAAAGTATTTGGTGGAAGT
ACTGCATGTCCAGCATACTGGAGGTGGATGTCAAAAGACGATCTCAAATG
TGGAGCTGGAAGCATATTCAAAAACATCGAGTTCTTTGCAAAGCTTACAA
AGTGAAGTAcaaggaaaaattgaaacagaaaaATCCATCCAAACAAATTC
TCACTGAACTAGAGaGCATGGAGGATGAGTTGAATATTGCAAGCATCACC
ATTTTTCGACAGCTTGCAGCTACAGAGGTTTTAACGGAACAAAAGAAGAA
AGGCACTAAAGGAAGTTTCTTCAGTTTCTTCTCCAGATCAAAAGAACCAG
AAAAGTCTGCTGCTAATAAAATTGGAGATTTAATGGGTGATGACCAGGAG
AAGGAAATGCAGAAATTGTATGACGCAATCGGTTATACTGAAAATGAAGT
CATCACTCCCTTTCCTAAAGAGTACGTGGCGATGTCAGTGGAATCGATTC
TCCAGAAATTATTCATCAGCCTCATCGATGACACAGATAAGGCGAAAGAA
TTCAAAGTGTTGGATTTTTCACTCAACAACATCATTGTAGAAGTTTTCCA
AAGACCTTCTGCTCAAGCTCTCAAATTATGTGCAAAGATAGGAGAGATGA
AGTTATTTGGTACAGCTTCTGCTCAATGTACACCTCtcatcatcaaaaac
atgttaCAAGGTCGAGGTATGGAATTTCTGCCGTTGGTGGACTTCATCTT
TGAGACGAATCCTTTGAAGAAACCGGACATTGACCAATGTATCACTGCTA
TTTGTCAACCCTTAGAAATCATCTATGATGCTAACACGATCAACCATATC
ATTAGTTTCTTCAAACCTCCTGAACATGTTATCTTGCAAGATTTACAAGA
CAAAGCGTATTCTACTTTCGAAGATTTTAAAGTTTCAAGTACGGCTGGTC
TTCTACATGCTATGGAACAAAGAACGGTTATGGACATCGACATTGATGTT
GGAGCATCTCATTTGATCATCCCTGAAAAAGGTTCTTACAATGGTTGTAC
AGATATGCTGGTGATCGACTTTGGTAAAATCACGATGAGCAGCGATCCTA
GTCAAATCAGACACCTTGACCCTAAGGACATTGAGGATGTGAATGAAGTA
CAAAGCAAAGCTTATGATCGATTCTTGTTGTCGCTTCAAGCTCTTCAAAT
ATTACTCGTTAGAGAAGGTGAAGATTTAAAGAGTGCTAAAAGCAACGTCA
GTAAAGCTTCATCACACATTTTGCATCCCATCAATTTCGATGGCAAACTT
GCCAAAGCTATACTTCCACAAGATCCACGTTTAAAACAGATATGTGTCTC
TGGTGAATTATCTTCGCTGTTTGTTTCTGTATCGGATGATAAAGTCAGTC
GTCTCATCAAGCTAGCAGACTCGATACCACTCCCTCAATCACCTTCTCAC
GATAACATCGACGGAGAAGAAAAACCTGAAGGACTCTTCACCAAGGCGTT
GTCAATGATAAGCTTGACAGGTGACAATGACACAGGGGTGGACATCGGAG
GATTTTCCATCCCTGTACCGACATCTCCAACATCAGTGACGTCAGATGAA
GATGAATACGGGACACCACCTGATGGCTCCATATTACAGTTACAACAAGA
AGCTGGTCCGGACTTTTCATCAGGAGTGGCGAACCAAGTCAAAGTGGACT
TGAACTTTAAAATCCATAAAGTGATGATCGCCATTGGTTTGACTGACAAA
GCATTGAAACAGGAAAAAGAATGTCTGAAATTCATCGTGGACGACATCAA
TACAGAGgtGATACTACGAAGATGGGATTTGTTCGTCAATGCAGAAGTTG
GTCGTCTGGTGTTGAATGAAATGACATGGGGTGTTGATGGAGAACCTTTC
GCCATCATGAGTACacccaaaaacaccaaaatgttGAAATTCAGCTATCG
GAGGTGTGAATTCAACGAAAGTTTGAATCTCGGTCCAAGTTACTTTTATT
CCAAAGAAGCGCAAGTCAGAGCTTTACATTTCAAAGATGAATTTGGCGCC
ACGGATCAGATTTTAGATGTACAAGTGGCTACTTTATTTCTGATGCTTCA
TCAAGAAGCACTTTTGAGCATCATGTCATTGATCTACCAAGTACTGGAAC
CACTCAACAAACATGATAAGGAAGCCACACAGAAGATCAAACGGAGTTTG
AGTACGGCAGGTAGTCGTTTGAGTCTCTCCatcgaagaaaaagaaaagga
gaGACAGATACAACGAAAATTAGCCAACCCTAAAGCACTGGAAGCTGCCA
ACGAACTTAAGCAACAGGTTGGcttagaagaagaaaaaaagatgaGAGTG
ACCGCCCACCTGGATGGTGTTGGTATCATGATTTGTTCAGCCAAAGTTGA
CCTTGCACAAGCCTTCGTTAAAGGGTTATCTGCTAAAGTACTGATGAAAG
ATGACTTATTAGAAGTGAAAGCCAGCATGAAAGATATGCAAGTACAAGAT
AATGTTGGCGAAACAAAGTACAAAGACATCATTAGCATGCGATCTGATGA
AGTGTTCGATTTAGAGTTGGCTATTTACGAGAATGGATCTTCTGGTAGCA
AGCAATACGATATGTCGTGTGTCGACACCAGTGTCAAACTGAACTTCGGT
CAAATGCGCGTTGTTTTCTTGTATAGATTCATACAAGACTTAATGTCATT
CACCGAAAACTTCGAAGAAGCACAGAAAGCAGTTGTGGAAGCTGGTAAAG
CTGCCAAGGATAAAGCTCTGGAAACAGCGACCGATTTGAATAGACATTCT
TCTCGTGTCAAACTAAATGTGGTTCTGAAAGCACCGACTATTATCATTCC
AGTTGGATCAAACAATGAATTGGCTTTACTGGTGGATCTGGGTGAATTGC
GTATTTACAACACATTCAAACTCCTCAACGATGATCAATACCATAAGAAA
TCTATCATCACTGATAACATGACCATTAAGTTATCCAATCTGAAATTGTT
AAAAGCACTTATTCAAGATGGTAAAGATTTCTTGCATCAACGAGCCATTA
TTGAACCTATGATGCTACAAATAACTATTGTTCGTAATTTAACGAAAGGT
AACCATTCCATACCGGATGTTTCAGTTCAAGCAAAGATGCCAGCTATTCT
GTTATCAATCAGTGAAGAAGATGTGACCGTAGCTCTAAAGATTGTCCAAG
GGAATCTCGCCGAAGGTGAGTCACATGCGCCGAAGAAGCAAGCCAAGCCT
GCCAAACAAACGTTAAACGTGCCACAAGATCGTTTAGCAGACATTTACGA
GGAGcctgaagatgaagatgagaaTCGACAAGGATATCTTCAAACCAAAC
TATCCTTCGATCTGGCTAAAATTGACATCAAGCTTTACTTGAAACCATCT
GATATGACATTTGAAGATGAATTTTTAGCGAGGACGGATGATTTGTTGTT
AGCTTTGTTCACTATTGGTAACCTGTGTGTTGATGGAGACATCATGTCCA
CGCAAGCTATGAAGATGAGCGTTCGATTGGACACTTTGGTGTTGGATGAT
ATGAGACCTATCGAGGAGCATGAAGGTGTTAAACGTATGATCAACTACAG
TCCCGAGCCACTCCTTGAAGAAGTCAAAACCTCTTCTCATAAACGACCAA
TCGACAACTCACGAATGATCGAAATCCAAttcgatcaaacttcatcgcaa
gataaaaatatcgacATCAAACTTTGTAACATGCTTTGTATATTCAACGT
TGAGTTTATCATGGTCCTGTTGAAAACGTTGCAAGCTGCCATACCTAAAG
ATGATAGTCTGCAACATGGCCATTCAATGAGTAGTCTAGACTCGGCGGCA
GGGTCTGGCGGCAGCGATGACGAGGACTCTTTAGAAGCCAGCGAGATTGT
CCTCTGCACTGGTGATCAAGAAAGACCTGAGACTAAAGTCTCTATCTTCG
TCCATAACCCGCAAATTGTTTTACTAGCAGATGCAAAGGATGTCAAAACA
AATGCACTCTTTCTTACAACCGagatcaattttcaatatttcgaaTTGCG
AGATACTCAAAAAATGATTGGCGCTGTTTCTAACACCGCTATTTTGTCAA
CTGCTTTCAAGAATGACCATCGGAGTGATATATCAACAGTGTTGTCATTA
GATTCCATCAATCTCCACTCGTCATCACCCATCAATGGTAAACCTCATAT
GAGTGTCAGCACAACTTTGATCAAACTGAATATCTCACCCAAAACCATCC
GAACTTTATCAGCGTGTGCTGGTTACATCTCCAATGATCCAACAGATGAA
GAAATCAAAGAAGCTCGAAAAGCCATGCGTGATTTATGGCAAATTCAAAC
GTTCACCAATAAGCGACCGTGGTATTTAAACCACCCACCACAACAAGTCT
TAAGTGCTGGCAGCTTCGTCCTTGCGCGAACGAGAACAGGAGAATATAAG
CATGGTTTCTTAGCTAAAAAGGATGTCTCGTATCAAGTCTATTTTTCAGA
GGAGCGAGGAACAGCCAGTCACCGAGCCATGGATATCTCATCTGTTGTTT
TGGATATCGTACCGCTGATCGGTGATCTATGTGTTGGATGTAATGTTTTA
GCTGTGGAATCGAAAGAACATGGATATCGTACTGGTCGAATTACTCAGGT
TTGGGATTCGAATGTGGATAAAGATTCTTCGGATGGCGCCAAACAATCTG
TTTCTGTCAAGACAACTGCTATTGCTCCAATCAAATACCTTGTCAATTTC
TATGACAACCAAACGGAGAACTTCTTCCCGCCTGATGAACTTCGTATCAT
TGGTAAACCCATCAAGGGGGTTGTCCCTGGACTAGGGGCGTGTGTTTACG
CCCGCTTTAATGATGGTTTTTACTATCGGGGCAAAGTTGATGACATCGAG
GATTATCGAATCCGAGTGCAATTGGATGAGATCAGTGGAGAAATCGAACA
CGACATCGATGATCCGTCAGCCGTTATTTTGAACCTGACGCCTCAATACC
GTCAAGTCAAAAAGCATTTCAAAGTCATTGCATCCAAAGGAAGCACAACT
AAAGGATATCATCCGGGGAAAGTGACCGCCATCCAAGGTGAAGGAAATAA
CCGATTGTATTCGATACGCTTCGAAGACGGTACAATTAACCAAGTACCCA
TCacgaaattgattttgatgccAAAAGCACCTTTTGATGCTTTACCTGAA
GTTGGCACATACGTTTATTCCCGAGTGTCACGCGACGCTCCTTTATACGA
GAAGGGTATCGTAGCAGAGAAGAACACAATGATCTGCGTTAAACATTTAA
ATGGACGGAAATTGGCTCACGAAATACAAAACATTCATTTTGTTGTCCGA
AATATCGTTCCTCTCGTGTCATCAttgaagGTTGGTTTGGACGTCATAGT
GCAACCTGACAATGACGATCAGAAAATGTATTTGGCTGTCATTAGGGAAG
TCACCAAAAAAGAAGGTGACAAAACGAACCGTTATCTAGTGGAGTTTACG
GATGGATCCAAGAAGAGAGTGACGCCCAGCCGGATCCGTATACTTTCTCA
ATACGGAAGTGCAGAAACGAGTGAAGAAAATGCTGACATTATCACAACAA
GACAGGAGGAACTAGTTCTCGATGTGCAAGGTATCTCATTACGTGTGGAA
GGTTACTTGGGAGGCGTGTTGACACCCATGCTCAAAATGGATTCCAAAAT
CACAGCTAACTTGAAGGATTGGTCAAGCCAAATGAATGCACACGCTACTG
TATCATTAGAAGCCAGTTATTATAACGAAAACGTTGCCGAATGGGAGCCA
GTTATTGAACCTTTGATGGAGAAACGGAGGGAAAGACCGTGGCAACTCTC
TGTCAATTACACGATGGAAGGTGACGACAATTCTGCTTCATCCACTTCCA
ACGAACTCGTTTTACAAAAACCGGAATCCAACCTGAAAATCAAATCTCAA
GATAATCTTGAATTGACAATTTCAAAATCATGTCTTGCTTTACTCGGTGA
ATTGGGACAGGTGTTTGGAGATGCAGTAGAATCTGTGGACGTTTTACCAC
AAGTCCTGGTCGAAAAAGAACCTTTCATGATCGAAAACTTGCTCTCCAAG
AAGGTGACAGTAACATTGAATGAACTTCTGCAGGGACCAAATGGAGATTC
GACAATCGAGCTAGCATCTTCTTCGAATCCTGTTGGCATTACTTTTGCTC
CCAagaaatttgagaaacgaaAGACCAACGATCTATACACAATCAATTTA
tcgGTGGACGGTTTTCATGACATTAAAGACATTGTGGTTCAAAGAAAGCG
AAGCGTTATCTATGATCTTGTACCAATAAAACTATTATCAGCACAGTCTT
CATATTCGATAGTGGTACAAGTGAAGACAACAGACGGACAACGTATCATC
GTACTCCGATCACCATTGCAGTTGAAAAATCACTTTCCAATGCCGTTGGA
TGTCAGCTACATTTCCAAAGAAAACCAACCAGTTAAACTGACAACAGTGG
GATCGGGAGATATCTATTCCTTCCCTTTGTTGTTAACCTACCACAGTGTT
TTTCATCTCAAACCTGCTGGTTTCGACTACGGTGATTGCACAGAAGCTCT
CAATTGGAGTGATTTGAAGACGAGCAACGAAAAACAGTTCTCCTGCCCTT
CACCTGACAAAAGTGCTGACCCTTTCTACATGCAGGTGGTGATGAAAGAG
GAGACGTACTCTTCCGTACACGGCATGTTGGACTGTGTACCACGTTACAC
GTTGGAGTGCTTTCCCGTCATCACGCTGCATAATTACCTACCTTGCACTA
TTAATTATAAGATCAAGGGTATGGCGAAATCGGAAAGTCTACCAGGCGGA
CACAATTGGCCTTTGTTTACCGTCAACTTCAGTGATAAACCTTCCATCTA
TATCGAGATTGAGTCGTATAACAACCAAAGATGGGAAGGAGGTTTGACAT
TACCAACAAAACCGGTAGATTCTTTGAACAAACCATCATTATCTTTCGTC
ATGATGTCTGGTGAACGCAAAATGGAATTGGGTGTTTATTACCAGTTAGA
CGGTTCATTGAACATCACCTTATATTCGCCTTACTGGCTTCTCAATAAAA
CTGGAAAACCACTTGTCTATCAGCCAGCGGGGAGCAGCATCCAGCAAGTT
CACCAAGAGAACGATGTAAATGCTCTTATGATGCTCGTCAAAGGGAAACA
TAAAAAGgcgaaagtgaaagtgaaaaataGCGAGTCATGGTCAAATGAAT
TTTCATTGGATACTGTTGGCAGTGGTGGTTCCTTGAAATGCAATGGTCCA
AGAGATCGAGTTTATGAGATTGGTTTGAACATCAGTTTGTCATACTTTGG
ATTGACGAAGATTGTGACGTTCACGCCACTCCGAATGTTATCTAACCACA
CCAAGTACACCATCAGTATGGCAGAAAGTAATTCTAAATCGTCAGAATGG
CACACGGTAAACCCTGACGAGaacattccatTCTGGCCGACGAAACTTCC
TTTGGTCAACCTTTACATTAACATCAATGGGCAAGATTCAGTGAAATTCA
ACCCTGAAGTTGGAAAAACTTTACTGTTGAAGTTCCAGAATGAGGTTGGA
GGAGTTTGCGTGGATTACCAAGAAAAGGACTCGTCCTCAGTCCTTTCGTT
TAATCCGTACTTCGCAGGTGCAGCTCCTGTGCGGCttgaaaatctttgca
aaaaGATCGGCATGATCGCTTATAAACAAGCAGGTTCGGTAATGGGTCAC
GTGTTAACACATGACCAATCAGTGTTGTACACGTGGGATGATCCAACCAT
GGAACAAGAATTGATTTGTTCCATTGTCAATGATGAAGCCAGTGAAACAA
GGATCAAACTCGATGCCAACGATTTCGGACGAATGAGAGTTGGAGATGGT
GCAATTTATTGGGTTTCCTTTCTGGATGGTCTTCAACGTGTTCTATTGTT
CACTGATAACTTCAAATCTGCTTACTGCGCATGTCAGgaGCAAAATTTAC
GCCCAACCATGGAAGTTGACTTTGAGATTGAGAGTTTTGGTTTGTCTCTG
GTCAATGTTGATAAGAGAATGGAGATTGGCTACTTAGCTATCCGACAAAG
CAAGACTGTATGGGAGCAACGCAAGAAAAAGAACCGCTGGAAAGCTTTAC
CGCTTGCCATGTGTGAAGCTCTCGAAGAAGGTTATCTCAATTATCAAAAC
AGAAAAGGTGCAGTCAAAGAGAAAGTTCTGGATAAGGAGGTGGATTACGA
GAAGATGTTTATTACGAAACCTGAGAAGATTAAGATCAGAAGAACGTACC
ACAGCGGTCTTGGTTTCAAATACACAATCTCACCCAATGAAATGCGTGTG
CATGCTTCTATCAGCTCAATACAGTTGGATAGCCATGTTCCAGGTTCGAC
CTTTCCAACAGTCTTGCATATGGTTGAACCACCAAAATCTGTTGCTTCAG
AAAACGCTCCAAAGCCATTCTttgaattgagtttaatgaCAAGGATCGGT
GATAAAAATGTGGTCAATGAAGTcagCTATTGTCACGTGTTGATTCAAGA
GATGGATGTGAGGGTTGATATTGGATTTTTATTGGCTCTGATGGAACTCT
TCAGTCATGCAAGAGCTCGAACAACCGAGAAAGAACAATACGCGCTTGAT
ATTGGCCAAGCAGCAACAAAGTTTGAAGAAAGCGCTGAATTTCAGGCAGC
CAAACAAGATCGATATTACGTTTTGAACGACTTTCATTTATCACCGCTAA
AGATTCACGTCAGTTTCTCTTTGACGGGTGGTTCCAAAGATGAAAATGCT
ATTGCTTCATTACATGGTAACGTGTTGAACTTGTTGTTACAAAGTGTCGG
ACTGGCCTTCACTGAAATACAAGACGTACAATTCAAATTAGCATGTTACG
AAGTGCATAAGTCCATGCAGAGTAATTCGCAGCTCGGTGATGGAATAACT
AAACATTATCAAACACAGGCTATCAAGCAACTTTATGTGTTGGTACTCGG
GCTAGACGTTCTTGGTAATCCGTATGGTTTGATATCTGGTGTTGGAACCG
GAGCAAAGAATTTCTTCTACGAACCTTACCAGGGATTAATTCAAGGACCA
GAAGAATTTGCGGAAGGATTGGCGTATGGGGTGAAGAGTCTTGTTGGTGG
AACCGTGGGTGGAGTATCAGGAGCTGTGAGTAAGATTACCGGTACCTTCG
GTAAAGGTTTGGCTGCATTGACCTTGGATGAAGAATATCAACAAAAGAGA
CGTGAAAACATGAGCCAACGCCCAACTAACCTCGGTGAAGGTCTCGCCAA
AGGTGGTAAAGGCCTTGTAAAGGGTATCGTGTCTGGTGTTACAGGGATCG
TTACCAAACCCTATGAAGGTGCCAAGAATGATGGTGCAGGTGGCTTTTTT
AAGGGCGTTGGAAAAGGCCTGATTGGCGTGGTTGCACGCCCTGTTGGTGG
AGTGGTAGATATGGCCAGTAACACGTTTGATGGTTTGAAAAGCACGACAT
CTGGCGTGAAAGCGATCGAGTTGAGCCGTGTTACTCGCGTCTTCCACGCA
GATAAGGTTTTACGACCTTTCAATCTGTACGAAGCAGATGGAAACAAAAT
TCTTATGCAATGTAACAAAGGAGAATACGCCAAGAAGAATTTTTATATCA
CTCATGTAGTGGACAAGAAGAACTATCTCATCCTCACTCAATCaaacATT
TTGTATGTTGGAAAGAACGAGTTGAAAATGGGTGAATGGGAATCggtttg
ggttatcgagttcaATGAGCTAAAACGTGAACCAGAAGTGAAAGAGACAA
AGATTATTTTCCATATCCATAATACGGACACGCGACGTTCAATTTTCAAG
AAATCGACGAACACACGTGAAGTGATATTGGAGTCTAGTGCTGTTGCAGA
CTGGTTTATCTTAAAGCTTAGAGATGCTAAAATGTTATAGatggtatttg
aaTCTTTGGTTGCTGACCTCTTGAACAAGTATCTGGGTCAATATGTGAAA
AATCTTGATGCTTCTCAATTGAAGATTGGCATTTGGGGAGGAAATGTTGT
CCTGACAGAACTTGAACTGAAAGATACAGCTCTGGATGATCTTGACTTAC
CCATAAAAGTTGTTCGTGGATATTTGGgtAAATTGGTCTTGTCCATCCCA
TGGAAAAATCTTTACACTGAATCAACTGTTGTCGATATTCAAGATCTCCA
CCTTGTCGCTAAGCCTAATTTTGACATCAAATACAATGAAGAACgcgaag
aaaaatcaaaacatgacAAGAAACAACAACAGATTCACAATATCGAAGAA
GCGAGGCAAAGAGAAGAAGACAAAAAGAAAGGCGCCAAGAAAGAAGAGAG
TGACGGTTTTGCTGAGAAACTTGCAACAAACGTCATAAAAAATCTACAGG
TTACGATCAAGAACATACATGTTCGATATGAAGACTCAATCAGTGATGTG
AATGGACCCTTTTCAGTCGGTCTTACAATGGAAAGTTTAACAGCACAAAC
CACAGATGAAGATTTTGTTCCAAAGATTATCAAAGAATCTGTCTCATTAA
TTCATAAGatggTGAAATTAGACAATTTGGCTTTATATTGGAATCCAGGA
GACGAACTGATTGATCCTTCACTTGATACCAAGCAATGGTTGgaagtTTC
AACGAAGCAAATTTCAACACACCAATCGAAGCCAGAGAAAACGAAATATA
TTTTGAGTCCCATGGTTGCAACGAAGAAATTGAAGCTGAACACCAAACCA
GGTTCCAACCTTGACATCCCGAAGatgttTTTGAACTTGGTTTTGGAAGA
ACTTGGTATCATCGTGGCAAGAAGTCAATATCATGGCGTGGTGCAACTGA
TTGAATCATTTGAACGAATGAATAGGAACCAACCTTTTCGTAAATACAGA
CCACATACCTCCGTTCTTGGGAACGAAAGTATTTGGTGGAAGTACTGCAT
GTCCAGCATACTGGAGGTGGATGTCAAAAGACGATCTCAAATGTGGAGCT
GGAAGCATATTCAAAAACATCGAGTTCTTTGCAAAGCTTACAAAGTGAAG
TAcaaggaaaaattgaaacagaaaaATCCATCCAAACAAATTCTCACTGA
ACTAGAGaGCATGGAGGATGAGTTGAATATTGCAAGCATCACCATTTTTC
GACAGCTTGCAGCTACAGAGGTTTTAACGGAACAAAAGAAGAAAGGCACT
AAAGGAAGTTTCTTCAGTTTCTTCTCCAGATCAAAAGAACCAGAAAAGTC
TGCTGCTAATAAAATTGGAGATTTAATGGGTGATGACCAGGAGAAGGAAA
TGCAGAAATTGTATGACGCAATCGGTTATACTGAAAATGAAGTCATCACT
CCCTTTCCTAAAGAGTACGTGGCGATGTCAGTGGAATCGATTCTCCAGAA
ATTATTCATCAGCCTCATCGATGACACAGATAAGGCGAAAGAATTCAAAG
TGTTGGATTTTTCACTCAACAACATCATTGTAGAAGTTTTCCAAAGACCT
TCTGCTCAAGCTCTCAAATTATGTGCAAAGATAGGAGAGATGAAGTTATT
TGGTACAGCTTCTGCTCAATGTACACCTCtcatcatcaaaaacatgttaC
AAGGTCGAGGTATGGAATTTCTGCCGTTGGTGGACTTCATCTTTGAGACG
AATCCTTTGAAGAAACCGGACATTGACCAATGTATCACTGCTATTTGTCA
ACCCTTAGAAATCATCTATGATGCTAACACGATCAACCATATCATTAGTT
TCTTCAAACCTCCTGAACATGTTATCTTGCAAGATTTACAAGACAAAGCG
TATTCTACTTTCGAAGATTTTAAAGTTTCAAGTACGGCTGGTCTTCTACA
TGCTATGGAACAAAGAACGGTTATGGACATCGACATTGATGTTGGAGCAT
CTCATTTGATCATCCCTGAAAAAGGTTCTTACAATGGTTGTACAGATATG
CTGGTGATCGACTTTGGTAAAATCACGATGAGCAGCGATCCTAGTCAAAT
CAGACACCTTGACCCTAAGGACATTGAGGATGTGAATGAAGTACAAAGCA
AAGCTTATGATCGATTCTTGTTGTCGCTTCAAGCTCTTCAAATATTACTC
GTTAGAGAAGGTGAAGATTTAAAGAGTGCTAAAAGCAACGTCAGTAAAGC
TTCATCACACATTTTGCATCCCATCAATTTCGATGGCAAACTTGCCAAAG
CTATACTTCCACAAGATCCACGTTTAAAACAGATATGTGTCTCTGGTGAA
TTATCTTCGCTGTTTGTTTCTGTATCGGATGATAAAGTCAGTCGTCTCAT
CAAGCTAGCAGACTCGATACCACTCCCTCAATCACCTTCTCACGATAACA
TCGACGGAGAAGAAAAACCTGAAGGACTCTTCACCAAGGCGTTGTCAATG
ATAAGCTTGACAGGTGACAATGACACAGGGGTGGACATCGGAGGATTTTC
CATCCCTGTACCGACATCTCCAACATCAGTGACGTCAGATGAAGATGAAT
ACGGGACACCACCTGATGGCTCCATATTACAGTTACAACAAGAAGCTGGT
CCGGACTTTTCATCAGGAGTGGCGAACCAAGTCAAAGTGGACTTGAACTT
TAAAATCCATAAAGTGATGATCGCCATTGGTTTGACTGACAAAGCATTGA
AACAGGAAAAAGAATGTCTGAAATTCATCGTGGACGACATCAATACAGAG
gtGATACTACGAAGATGGGATTTGTTCGTCAATGCAGAAGTTGGTCGTCT
GGTGTTGAATGAAATGACATGGGGTGTTGATGGAGAACCTTTCGCCATCA
TGAGTACacccaaaaacaccaaaatgttGAAATTCAGCTATCGGAGGTGT
GAATTCAACGAAAGTTTGAATCTCGGTCCAAGTTACTTTTATTCCAAAGA
AGCGCAAGTCAGAGCTTTACATTTCAAAGATGAATTTGGCGCCACGGATC
AGATTTTAGATGTACAAGTGGCTACTTTATTTCTGATGCTTCATCAAGAA
GCACTTTTGAGCATCATGTCATTGATCTACCAAGTACTGGAACCACTCAA
CAAACATGATAAGGAAGCCACACAGAAGATCAAACGGAGTTTGAGTACGG
CAGGTAGTCGTTTGAGTCTCTCCatcgaagaaaaagaaaaggagaGACAG
ATACAACGAAAATTAGCCAACCCTAAAGCACTGGAAGCTGCCAACGAACT
TAAGCAACAGGTTGGcttagaagaagaaaaaaagatgaGAGTGACCGCCC
ACCTGGATGGTGTTGGTATCATGATTTGTTCAGCCAAAGTTGACCTTGCA
CAAGCCTTCGTTAAAGGGTTATCTGCTAAAGTACTGATGAAAGATGACTT
ATTAGAAGTGAAAGCCAGCATGAAAGATATGCAAGTACAAGATAATGTTG
GCGAAACAAAGTACAAAGACATCATTAGCATGCGATCTGATGAAGTGTTC
GATTTAGAGTTGGCTATTTACGAGAATGGATCTTCTGGTAGCAAGCAATA
CGATATGTCGTGTGTCGACACCAGTGTCAAACTGAACTTCGGTCAAATGC
GCGTTGTTTTCTTGTATAGATTCATACAAGACTTAATGTCATTCACCGAA
AACTTCGAAGAAGCACAGAAAGCAGTTGTGGAAGCTGGTAAAGCTGCCAA
GGATAAAGCTCTGGAAACAGCGACCGATTTGAATAGACATTCTTCTCGTG
TCAAACTAAATGTGGTTCTGAAAGCACCGACTATTATCATTCCAGTTGGA
TCAAACAATGAATTGGCTTTACTGGTGGATCTGGGTGAATTGCGTATTTA
CAACACATTCAAACTCCTCAACGATGATCAATACCATAAGAAATCTATCA
TCACTGATAACATGACCATTAAGTTATCCAATCTGAAATTGTTAAAAGCA
CTTATTCAAGATGGTAAAGATTTCTTGCATCAACGAGCCATTATTGAACC
TATGATGCTACAAATAACTATTGTTCGTAATTTAACGAAAGGTAACCATT
CCATACCGGATGTTTCAGTTCAAGCAAAGATGCCAGCTATTCTGTTATCA
ATCAGTGAAGAAGATGTGACCGTAGCTCTAAAGATTGTCCAAGGGAATCT
CGCCGAAGGTGAGTCACATGCGCCGAAGAAGCAAGCCAAGCCTGCCAAAC
AAACGTTAAACGTGCCACAAGATCGTTTAGCAGACATTTACGAGGAGcct
gaagatgaagatgagaaTCGACAAGGATATCTTCAAACCAAACTATCCTT
CGATCTGGCTAAAATTGACATCAAGCTTTACTTGAAACCATCTGATATGA
CATTTGAAGATGAATTTTTAGCGAGGACGGATGATTTGTTGTTAGCTTTG
TTCACTATTGGTAACCTGTGTGTTGATGGAGACATCATGTCCACGCAAGC
TATGAAGATGAGCGTTCGATTGGACACTTTGGTGTTGGATGATATGAGAC
CTATCGAGGAGCATGAAGGTGTTAAACGTATGATCAACTACAGTCCCGAG
CCACTCCTTGAAGAAGTCAAAACCTCTTCTCATAAACGACCAATCGACAA
CTCACGAATGATCGAAATCCAAttcgatcaaacttcatcgcaagataaaa
atatcgacATCAAACTTTGTAACATGCTTTGTATATTCAACGTTGAGTTT
ATCATGGTCCTGTTGAAAACGTTGCAAGCTGCCATACCTAAAGATGATAG
TCTGCAACATGGCCATTCAATGAGTAGTCTAGACTCGGCGGCAGGGTCTG
GCGGCAGCGATGACGAGGACTCTTTAGAAGCCAGCGAGATTGTCCTCTGC
ACTGGTGATCAAGAAAGACCTGAGACTAAAGTCTCTATCTTCGTCCATAA
CCCGCAAATTGTTTTACTAGCAGATGCAAAGGATGTCAAAACAAATGCAC
TCTTTCTTACAACCGagatcaattttcaatatttcgaaTTGCGAGATACT
CAAAAAATGATTGGCGCTGTTTCTAACACCGCTATTTTGTCAACTGCTTT
CAAGAATGACCATCGGAGTGATATATCAACAGTGTTGTCATTAGATTCCA
TCAATCTCCACTCGTCATCACCCATCAATGGTAAACCTCATATGAGTGTC
AGCACAACTTTGATCAAACTGAATATCTCACCCAAAACCATCCGAACTTT
ATCAGCGTGTGCTGGTTACATCTCCAATGATCCAACAGATGAAGAAATCA
AAGAAGCTCGAAAAGCCATGCGTGATTTATGGCAAATTCAAACGTTCACC
AATAAGCGACCGTGGTATTTAAACCACCCACCACAACAAGTCTTAAGTGC
TGGCAGCTTCGTCCTTGCGCGAACGAGAACAGGAGAATATAAGCATGGTT
TCTTAGCTAAAAAGGATGTCTCGTATCAAGTCTATTTTTCAGAGGAGCGA
GGAACAGCCAGTCACCGAGCCATGGATATCTCATCTGTTGTTTTGGATAT
CGTACCGCTGATCGGTGATCTATGTGTTGGATGTAATGTTTTAGCTGTGG
AATCGAAAGAACATGGATATCGTACTGGTCGAATTACTCAGGTTTGGGAT
TCGAATGTGGATAAAGATTCTTCGGATGGCGCCAAACAATCTGTTTCTGT
CAAGACAACTGCTATTGCTCCAATCAAATACCTTGTCAATTTCTATGACA
ACCAAACGGAGAACTTCTTCCCGCCTGATGAACTTCGTATCATTGGTAAA
CCCATCAAGGGGGTTGTCCCTGGACTAGGGGCGTGTGTTTACGCCCGCTT
TAATGATGGTTTTTACTATCGGGGCAAAGTTGATGACATCGAGGATTATC
GAATCCGAGTGCAATTGGATGAGATCAGTGGAGAAATCGAACACGACATC
GATGATCCGTCAGCCGTTATTTTGAACCTGACGCCTCAATACCGTCAAGT
CAAAAAGCATTTCAAAGTCATTGCATCCAAAGGAAGCACAACTAAAGGAT
ATCATCCGGGGAAAGTGACCGCCATCCAAGGTGAAGGAAATAACCGATTG
TATTCGATACGCTTCGAAGACGGTACAATTAACCAAGTACCCATCacgaa
attgattttgatgccAAAAGCACCTTTTGATGCTTTACCTGAAGTTGGCA
CATACGTTTATTCCCGAGTGTCACGCGACGCTCCTTTATACGAGAAGGGT
ATCGTAGCAGAGAAGAACACAATGATCTGCGTTAAACATTTAAATGGACG
GAAATTGGCTCACGAAATACAAAACATTCATTTTGTTGTCCGAAATATCG
TTCCTCTCGTGTCATCAttgaagGTTGGTTTGGACGTCATAGTGCAACCT
GACAATGACGATCAGAAAATGTATTTGGCTGTCATTAGGGAAGTCACCAA
AAAAGAAGGTGACAAAACGAACCGTTATCTAGTGGAGTTTACGGATGGAT
CCAAGAAGAGAGTGACGCCCAGCCGGATCCGTATACTTTCTCAATACGGA
AGTGCAGAAACGAGTGAAGAAAATGCTGACATTATCACAACAAGACAGGA
GGAACTAGTTCTCGATGTGCAAGGTATCTCATTACGTGTGGAAGGTTACT
TGGGAGGCGTGTTGACACCCATGCTCAAAATGGATTCCAAAATCACAGCT
AACTTGAAGGATTGGTCAAGCCAAATGAATGCACACGCTACTGTATCATT
AGAAGCCAGTTATTATAACGAAAACGTTGCCGAATGGGAGCCAGTTATTG
AACCTTTGATGGAGAAACGGAGGGAAAGACCGTGGCAACTCTCTGTCAAT
TACACGATGGAAGGTGACGACAATTCTGCTTCATCCACTTCCAACGAACT
CGTTTTACAAAAACCGGAATCCAACCTGAAAATCAAATCTCAAGATAATC
TTGAATTGACAATTTCAAAATCATGTCTTGCTTTACTCGGTGAATTGGGA
CAGGTGTTTGGAGATGCAGTAGAATCTGTGGACGTTTTACCACAAGTCCT
GGTCGAAAAAGAACCTTTCATGATCGAAAACTTGCTCTCCAAGAAGGTGA
CAGTAACATTGAATGAACTTCTGCAGGGACCAAATGGAGATTCGACAATC
GAGCTAGCATCTTCTTCGAATCCTGTTGGCATTACTTTTGCTCCCAagaa
atttgagaaacgaaAGACCAACGATCTATACACAATCAATTTAtcgGTGG
ACGGTTTTCATGACATTAAAGACATTGTGGTTCAAAGAAAGCGAAGCGTT
ATCTATGATCTTGTACCAATAAAACTATTATCAGCACAGTCTTCATATTC
GATAGTGGTACAAGTGAAGACAACAGACGGACAACGTATCATCGTACTCC
GATCACCATTGCAGTTGAAAAATCACTTTCCAATGCCGTTGGATGTCAGC
TACATTTCCAAAGAAAACCAACCAGTTAAACTGACAACAGTGGGATCGGG
AGATATCTATTCCTTCCCTTTGTTGTTAACCTACCACAGTGTTTTTCATC
TCAAACCTGCTGGTTTCGACTACGGTGATTGCACAGAAGCTCTCAATTGG
AGTGATTTGAAGACGAGCAACGAAAAACAGTTCTCCTGCCCTTCACCTGA
CAAAAGTGCTGACCCTTTCTACATGCAGGTGGTGATGAAAGAGGAGACGT
ACTCTTCCGTACACGGCATGTTGGACTGTGTACCACGTTACACGTTGGAG
TGCTTTCCCGTCATCACGCTGCATAATTACCTACCTTGCACTATTAATTA
TAAGATCAAGGGTATGGCGAAATCGGAAAGTCTACCAGGCGGACACAATT
GGCCTTTGTTTACCGTCAACTTCAGTGATAAACCTTCCATCTATATCGAG
ATTGAGTCGTATAACAACCAAAGATGGGAAGGAGGTTTGACATTACCAAC
AAAACCGGTAGATTCTTTGAACAAACCATCATTATCTTTCGTCATGATGT
CTGGTGAACGCAAAATGGAATTGGGTGTTTATTACCAGTTAGACGGTTCA
TTGAACATCACCTTATATTCGCCTTACTGGCTTCTCAATAAAACTGGAAA
ACCACTTGTCTATCAGCCAGCGGGGAGCAGCATCCAGCAAGTTCACCAAG
AGAACGATGTAAATGCTCTTATGATGCTCGTCAAAGGGAAACATAAAAAG
gcgaaagtgaaagtgaaaaataGCGAGTCATGGTCAAATGAATTTTCATT
GGATACTGTTGGCAGTGGTGGTTCCTTGAAATGCAATGGTCCAAGAGATC
GAGTTTATGAGATTGGTTTGAACATCAGTTTGTCATACTTTGGATTGACG
AAGATTGTGACGTTCACGCCACTCCGAATGTTATCTAACCACACCAAGTA
CACCATCAGTATGGCAGAAAGTAATTCTAAATCGTCAGAATGGCACACGG
TAAACCCTGACGAGaacattccatTCTGGCCGACGAAACTTCCTTTGGTC
AACCTTTACATTAACATCAATGGGCAAGATTCAGTGAAATTCAACCCTGA
AGTTGGAAAAACTTTACTGTTGAAGTTCCAGAATGAGGTTGGAGGAGTTT
GCGTGGATTACCAAGAAAAGGACTCGTCCTCAGTCCTTTCGTTTAATCCG
TACTTCGCAGGTGCAGCTCCTGTGCGGCttgaaaatctttgcaaaaaGAT
CGGCATGATCGCTTATAAACAAGCAGGTTCGGTAATGGGTCACGTGTTAA
CACATGACCAATCAGTGTTGTACACGTGGGATGATCCAACCATGGAACAA
GAATTGATTTGTTCCATTGTCAATGATGAAGCCAGTGAAACAAGGATCAA
ACTCGATGCCAACGATTTCGGACGAATGAGAGTTGGAGATGGTGCAATTT
ATTGGGTTTCCTTTCTGGATGGTCTTCAACGTGTTCTATTGTTCACTGAT
AACTTCAAATCTGCTTACTGCGCATGTCAGgaGCAAAATTTACGCCCAAC
CATGGAAGTTGACTTTGAGATTGAGAGTTTTGGTTTGTCTCTGGTCAATG
TTGATAAGAGAATGGAGATTGGCTACTTAGCTATCCGACAAAGCAAGACT
GTATGGGAGCAACGCAAGAAAAAGAACCGCTGGAAAGCTTTACCGCTTGC
CATGTGTGAAGCTCTCGAAGAAGGTTATCTCAATTATCAAAACAGAAAAG
GTGCAGTCAAAGAGAAAGTTCTGGATAAGGAGGTGGATTACGAGAAGATG
TTTATTACGAAACCTGAGAAGATTAAGATCAGAAGAACGTACCACAGCGG
TCTTGGTTTCAAATACACAATCTCACCCAATGAAATGCGTGTGCATGCTT
CTATCAGCTCAATACAGTTGGATAGCCATGTTCCAGGTTCGACCTTTCCA
ACAGTCTTGCATATGGTTGAACCACCAAAATCTGTTGCTTCAGAAAACGC
TCCAAAGCCATTCTttgaattgagtttaatgaCAAGGATCGGTGATAAAA
ATGTGGTCAATGAAGTcagCTATTGTCACGTGTTGATTCAAGAGATGGAT
GTGAGGGTTGATATTGGATTTTTATTGGCTCTGATGGAACTCTTCAGTCA
TGCAAGAGCTCGAACAACCGAGAAAGAACAATACGCGCTTGATATTGGCC
AAGCAGCAACAAAGTTTGAAGAAAGCGCTGAATTTCAGGCAGCCAAACAA
GATCGATATTACGTTTTGAACGACTTTCATTTATCACCGCTAAAGATTCA
CGTCAGTTTCTCTTTGACGGGTGGTTCCAAAGATGAAAATGCTATTGCTT
CATTACATGGTAACGTGTTGAACTTGTTGTTACAAAGTGTCGGACTGGCC
TTCACTGAAATACAAGACGTACAATTCAAATTAGCATGTTACGAAGTGCA
TAAGTCCATGCAGAGTAATTCGCAGCTCGGTGATGGAATAACTAAACATT
ATCAAACACAGGCTATCAAGCAACTTTATGTGTTGGTACTCGGGCTAGAC
GTTCTTGGTAATCCGTATGGTTTGATATCTGGTGTTGGAACCGGAGCAAA
GAATTTCTTCTACGAACCTTACCAGGGATTAATTCAAGGACCAGAAGAAT
TTGCGGAAGGATTGGCGTATGGGGTGAAGAGTCTTGTTGGTGGAACCGTG
GGTGGAGTATCAGGAGCTGTGAGTAAGATTACCGGTACCTTCGGTAAAGG
TTTGGCTGCATTGACCTTGGATGAAGAATATCAACAAAAGAGACGTGAAA
ACATGAGCCAACGCCCAACTAACCTCGGTGAAGGTCTCGCCAAAGGTGGT
AAAGGCCTTGTAAAGGGTATCGTGTCTGGTGTTACAGGGATCGTTACCAA
ACCCTATGAAGGTGCCAAGAATGATGGTGCAGGTGGCTTTTTTAAGGGCG
TTGGAAAAGGCCTGATTGGCGTGGTTGCACGCCCTGTTGGTGGAGTGGTA
GATATGGCCAGTAACACGTTTGATGGTTTGAAAAGCACGACATCTGGCGT
GAAAGCGATCGAGTTGAGCCGTGTTACTCGCGTCTTCCACGCAGATAAGG
TTTTACGACCTTTCAATCTGTACGAAGCAGATGGAAACAAAATTCTTATG
CAATGTAACAAAGGAGAATACGCCAAGAAGAATTTTTATATCACTCATGT
AGTGGACAAGAAGAACTATCTCATCCTCACTCAATCaaacATTTTGTATG
TTGGAAAGAACGAGTTGAAAATGGGTGAATGGGAATCggtttgggttatc
gagttcaATGAGCTAAAACGTGAACCAGAAGTGAAAGAGACAAAGATTAT
TTTCCATATCCATAATACGGACACGCGACGTTCAATTTTCAAGAAATCGA
CGAACACACGTGAAGTGATATTGGAGTCTAGTGCTGTTGCAGACTGGTTT
ATCTTAAAGCTTAGAGATGCTAAAATGTTATAGatggtatttgaaTCTTT
GGTTGCTGACCTCTTGAACAAGTATCTGGGTCAATATGTGAAAAATCTTG
ATGCTTCTCAATTGAAGATTGGCATTTGGGGAGGAAATGTTGTCCTGACA
GAACTTGAACTGAAAGATACAGCTCTGGATGATCTTGACTTACCCATAAA
AGTTGTTCGTGGATATTTGGgtAAATTGGTCTTGTCCATCCCATGGAAAA
ATCTTTACACTGAATCAACTGTTGTCGATATTCAAGATCTCCACCTTGTC
GCTAAGCCTAATTTTGACATCAAATACAATGAAGAACgcgaagaaaaatc
aaaacatgacAAGAAACAACAACAGATTCACAATATCGAAGAAGCGAGGC
AAAGAGAAGAAGACAAAAAGAAAGGCGCCAAGAAAGAAGAGAGTGACGGT
TTTGCTGAGAAACTTGCAACAAACGTCATAAAAAATCTACAGGTTACGAT
CAAGAACATACATGTTCGATATGAAGACTCAATCAGTGATGTGAATGGAC
CCTTTTCAGTCGGTCTTACAATGGAAAGTTTAACAGCACAAACCACAGAT
GAAGATTTTGTTCCAAAGATTATCAAAGAATCTGTCTCATTAATTCATAA
GatggTGAAATTAGACAATTTGGCTTTATATTGGAATCCAGGAGACGAAC
TGATTGATCCTTCACTTGATACCAAGCAATGGTTGgaagtTTCAACGAAG
CAAATTTCAACACACCAATCGAAGCCAGAGAAAACGAAATATATTTTGAG
TCCCATGGTTGCAACGAAGAAATTGAAGCTGAACACCAAACCAGGTTCCA
ACCTTGACATCCCGAAGatgttTTTGAACTTGGTTTTGGAAGAACTTGGT
ATCATCGTGGCAAGAAGTCAATATCATGGCGTGGTGCAACTGATTGAATC
ATTTGAACGAATGAATAGGAACCAACCTTTTCGTAAATACAGACCACATA
CCTCCGTTCTTGGGAACGAAAGTATTTGGTGGAAGTACTGCATGTCCAGC
ATACTGGAGGTGGATGTCAAAAGACGATCTCAAATGTGGAGCTGGAAGCA
TATTCAAAAACATCGAGTTCTTTGCAAAGCTTACAAAGTGAAGTAcaagg
aaaaattgaaacagaaaaATCCATCCAAACAAATTCTCACTGAACTAGAG
aGCATGGAGGATGAGTTGAATATTGCAAGCATCACCATTTTTCGACAGCT
TGCAGCTACAGAGGTTTTAACGGAACAAAAGAAGAAAGGCACTAAAGGAA
GTTTCTTCAGTTTCTTCTCCAGATCAAAAGAACCAGAAAAGTCTGCTGCT
AATAAAATTGGAGATTTAATGGGTGATGACCAGGAGAAGGAAATGCAGAA
ATTGTATGACGCAATCGGTTATACTGAAAATGAAGTCATCACTCCCTTTC
CTAAAGAGTACGTGGCGATGTCAGTGGAATCGATTCTCCAGAAATTATTC
ATCAGCCTCATCGATGACACAGATAAGGCGAAAGAATTCAAAGTGTTGGA
TTTTTCACTCAACAACATCATTGTAGAAGTTTTCCAAAGACCTTCTGCTC
AAGCTCTCAAATTATGTGCAAAGATAGGAGAGATGAAGTTATTTGGTACA
GCTTCTGCTCAATGTACACCTCtcatcatcaaaaacatgttaCAAGGTCG
AGGTATGGAATTTCTGCCGTTGGTGGACTTCATCTTTGAGACGAATCCTT
TGAAGAAACCGGACATTGACCAATGTATCACTGCTATTTGTCAACCCTTA
GAAATCATCTATGATGCTAACACGATCAACCATATCATTAGTTTCTTCAA
ACCTCCTGAACATGTTATCTTGCAAGATTTACAAGACAAAGCGTATTCTA
CTTTCGAAGATTTTAAAGTTTCAAGTACGGCTGGTCTTCTACATGCTATG
GAACAAAGAACGGTTATGGACATCGACATTGATGTTGGAGCATCTCATTT
GATCATCCCTGAAAAAGGTTCTTACAATGGTTGTACAGATATGCTGGTGA
TCGACTTTGGTAAAATCACGATGAGCAGCGATCCTAGTCAAATCAGACAC
CTTGACCCTAAGGACATTGAGGATGTGAATGAAGTACAAAGCAAAGCTTA
TGATCGATTCTTGTTGTCGCTTCAAGCTCTTCAAATATTACTCGTTAGAG
AAGGTGAAGATTTAAAGAGTGCTAAAAGCAACGTCAGTAAAGCTTCATCA
CACATTTTGCATCCCATCAATTTCGATGGCAAACTTGCCAAAGCTATACT
TCCACAAGATCCACGTTTAAAACAGATATGTGTCTCTGGTGAATTATCTT
CGCTGTTTGTTTCTGTATCGGATGATAAAGTCAGTCGTCTCATCAAGCTA
GCAGACTCGATACCACTCCCTCAATCACCTTCTCACGATAACATCGACGG
AGAAGAAAAACCTGAAGGACTCTTCACCAAGGCGTTGTCAATGATAAGCT
TGACAGGTGACAATGACACAGGGGTGGACATCGGAGGATTTTCCATCCCT
GTACCGACATCTCCAACATCAGTGACGTCAGATGAAGATGAATACGGGAC
ACCACCTGATGGCTCCATATTACAGTTACAACAAGAAGCTGGTCCGGACT
TTTCATCAGGAGTGGCGAACCAAGTCAAAGTGGACTTGAACTTTAAAATC
CATAAAGTGATGATCGCCATTGGTTTGACTGACAAAGCATTGAAACAGGA
AAAAGAATGTCTGAAATTCATCGTGGACGACATCAATACAGAGgtGATAC
TACGAAGATGGGATTTGTTCGTCAATGCAGAAGTTGGTCGTCTGGTGTTG
AATGAAATGACATGGGGTGTTGATGGAGAACCTTTCGCCATCATGAGTAC
acccaaaaacaccaaaatgttGAAATTCAGCTATCGGAGGTGTGAATTCA
ACGAAAGTTTGAATCTCGGTCCAAGTTACTTTTATTCCAAAGAAGCGCAA
GTCAGAGCTTTACATTTCAAAGATGAATTTGGCGCCACGGATCAGATTTT
AGATGTACAAGTGGCTACTTTATTTCTGATGCTTCATCAAGAAGCACTTT
TGAGCATCATGTCATTGATCTACCAAGTACTGGAACCACTCAACAAACAT
GATAAGGAAGCCACACAGAAGATCAAACGGAGTTTGAGTACGGCAGGTAG
TCGTTTGAGTCTCTCCatcgaagaaaaagaaaaggagaGACAGATACAAC
GAAAATTAGCCAACCCTAAAGCACTGGAAGCTGCCAACGAACTTAAGCAA
CAGGTTGGcttagaagaagaaaaaaagatgaGAGTGACCGCCCACCTGGA
TGGTGTTGGTATCATGATTTGTTCAGCCAAAGTTGACCTTGCACAAGCCT
TCGTTAAAGGGTTATCTGCTAAAGTACTGATGAAAGATGACTTATTAGAA
GTGAAAGCCAGCATGAAAGATATGCAAGTACAAGATAATGTTGGCGAAAC
AAAGTACAAAGACATCATTAGCATGCGATCTGATGAAGTGTTCGATTTAG
AGTTGGCTATTTACGAGAATGGATCTTCTGGTAGCAAGCAATACGATATG
TCGTGTGTCGACACCAGTGTCAAACTGAACTTCGGTCAAATGCGCGTTGT
TTTCTTGTATAGATTCATACAAGACTTAATGTCATTCACCGAAAACTTCG
AAGAAGCACAGAAAGCAGTTGTGGAAGCTGGTAAAGCTGCCAAGGATAAA
GCTCTGGAAACAGCGACCGATTTGAATAGACATTCTTCTCGTGTCAAACT
AAATGTGGTTCTGAAAGCACCGACTATTATCATTCCAGTTGGATCAAACA
ATGAATTGGCTTTACTGGTGGATCTGGGTGAATTGCGTATTTACAACACA
TTCAAACTCCTCAACGATGATCAATACCATAAGAAATCTATCATCACTGA
TAACATGACCATTAAGTTATCCAATCTGAAATTGTTAAAAGCACTTATTC
AAGATGGTAAAGATTTCTTGCATCAACGAGCCATTATTGAACCTATGATG
CTACAAATAACTATTGTTCGTAATTTAACGAAAGGTAACCATTCCATACC
GGATGTTTCAGTTCAAGCAAAGATGCCAGCTATTCTGTTATCAATCAGTG
AAGAAGATGTGACCGTAGCTCTAAAGATTGTCCAAGGGAATCTCGCCGAA
GGTGAGTCACATGCGCCGAAGAAGCAAGCCAAGCCTGCCAAACAAACGTT
AAACGTGCCACAAGATCGTTTAGCAGACATTTACGAGGAGcctgaagatg
aagatgagaaTCGACAAGGATATCTTCAAACCAAACTATCCTTCGATCTG
GCTAAAATTGACATCAAGCTTTACTTGAAACCATCTGATATGACATTTGA
AGATGAATTTTTAGCGAGGACGGATGATTTGTTGTTAGCTTTGTTCACTA
TTGGTAACCTGTGTGTTGATGGAGACATCATGTCCACGCAAGCTATGAAG
ATGAGCGTTCGATTGGACACTTTGGTGTTGGATGATATGAGACCTATCGA
GGAGCATGAAGGTGTTAAACGTATGATCAACTACAGTCCCGAGCCACTCC
TTGAAGAAGTCAAAACCTCTTCTCATAAACGACCAATCGACAACTCACGA
ATGATCGAAATCCAAttcgatcaaacttcatcgcaagataaaaatatcga
cATCAAACTTTGTAACATGCTTTGTATATTCAACGTTGAGTTTATCATGG
TCCTGTTGAAAACGTTGCAAGCTGCCATACCTAAAGATGATAGTCTGCAA
CATGGCCATTCAATGAGTAGTCTAGACTCGGCGGCAGGGTCTGGCGGCAG
CGATGACGAGGACTCTTTAGAAGCCAGCGAGATTGTCCTCTGCACTGGTG
ATCAAGAAAGACCTGAGACTAAAGTCTCTATCTTCGTCCATAACCCGCAA
ATTGTTTTACTAGCAGATGCAAAGGATGTCAAAACAAATGCACTCTTTCT
TACAACCGagatcaattttcaatatttcgaaTTGCGAGATACTCAAAAAA
TGATTGGCGCTGTTTCTAACACCGCTATTTTGTCAACTGCTTTCAAGAAT
GACCATCGGAGTGATATATCAACAGTGTTGTCATTAGATTCCATCAATCT
CCACTCGTCATCACCCATCAATGGTAAACCTCATATGAGTGTCAGCACAA
CTTTGATCAAACTGAATATCTCACCCAAAACCATCCGAACTTTATCAGCG
TGTGCTGGTTACATCTCCAATGATCCAACAGATGAAGAAATCAAAGAAGC
TCGAAAAGCCATGCGTGATTTATGGCAAATTCAAACGTTCACCAATAAGC
GACCGTGGTATTTAAACCACCCACCACAACAAGTCTTAAGTGCTGGCAGC
TTCGTCCTTGCGCGAACGAGAACAGGAGAATATAAGCATGGTTTCTTAGC
TAAAAAGGATGTCTCGTATCAAGTCTATTTTTCAGAGGAGCGAGGAACAG
CCAGTCACCGAGCCATGGATATCTCATCTGTTGTTTTGGATATCGTACCG
CTGATCGGTGATCTATGTGTTGGATGTAATGTTTTAGCTGTGGAATCGAA
AGAACATGGATATCGTACTGGTCGAATTACTCAGGTTTGGGATTCGAATG
TGGATAAAGATTCTTCGGATGGCGCCAAACAATCTGTTTCTGTCAAGACA
ACTGCTATTGCTCCAATCAAATACCTTGTCAATTTCTATGACAACCAAAC
GGAGAACTTCTTCCCGCCTGATGAACTTCGTATCATTGGTAAACCCATCA
AGGGGGTTGTCCCTGGACTAGGGGCGTGTGTTTACGCCCGCTTTAATGAT
GGTTTTTACTATCGGGGCAAAGTTGATGACATCGAGGATTATCGAATCCG
AGTGCAATTGGATGAGATCAGTGGAGAAATCGAACACGACATCGATGATC
CGTCAGCCGTTATTTTGAACCTGACGCCTCAATACCGTCAAGTCAAAAAG
CATTTCAAAGTCATTGCATCCAAAGGAAGCACAACTAAAGGATATCATCC
GGGGAAAGTGACCGCCATCCAAGGTGAAGGAAATAACCGATTGTATTCGA
TACGCTTCGAAGACGGTACAATTAACCAAGTACCCATCacgaaattgatt
ttgatgccAAAAGCACCTTTTGATGCTTTACCTGAAGTTGGCACATACGT
TTATTCCCGAGTGTCACGCGACGCTCCTTTATACGAGAAGGGTATCGTAG
CAGAGAAGAACACAATGATCTGCGTTAAACATTTAAATGGACGGAAATTG
GCTCACGAAATACAAAACATTCATTTTGTTGTCCGAAATATCGTTCCTCT
CGTGTCATCAttgaagGTTGGTTTGGACGTCATAGTGCAACCTGACAATG
ACGATCAGAAAATGTATTTGGCTGTCATTAGGGAAGTCACCAAAAAAGAA
GGTGACAAAACGAACCGTTATCTAGTGGAGTTTACGGATGGATCCAAGAA
GAGAGTGACGCCCAGCCGGATCCGTATACTTTCTCAATACGGAAGTGCAG
AAACGAGTGAAGAAAATGCTGACATTATCACAACAAGACAGGAGGAACTA
GTTCTCGATGTGCAAGGTATCTCATTACGTGTGGAAGGTTACTTGGGAGG
CGTGTTGACACCCATGCTCAAAATGGATTCCAAAATCACAGCTAACTTGA
AGGATTGGTCAAGCCAAATGAATGCACACGCTACTGTATCATTAGAAGCC
AGTTATTATAACGAAAACGTTGCCGAATGGGAGCCAGTTATTGAACCTTT
GATGGAGAAACGGAGGGAAAGACCGTGGCAACTCTCTGTCAATTACACGA
TGGAAGGTGACGACAATTCTGCTTCATCCACTTCCAACGAACTCGTTTTA
CAAAAACCGGAATCCAACCTGAAAATCAAATCTCAAGATAATCTTGAATT
GACAATTTCAAAATCATGTCTTGCTTTACTCGGTGAATTGGGACAGGTGT
TTGGAGATGCAGTAGAATCTGTGGACGTTTTACCACAAGTCCTGGTCGAA
AAAGAACCTTTCATGATCGAAAACTTGCTCTCCAAGAAGGTGACAGTAAC
ATTGAATGAACTTCTGCAGGGACCAAATGGAGATTCGACAATCGAGCTAG
CATCTTCTTCGAATCCTGTTGGCATTACTTTTGCTCCCAagaaatttgag
aaacgaaAGACCAACGATCTATACACAATCAATTTAtcgGTGGACGGTTT
TCATGACATTAAAGACATTGTGGTTCAAAGAAAGCGAAGCGTTATCTATG
ATCTTGTACCAATAAAACTATTATCAGCACAGTCTTCATATTCGATAGTG
GTACAAGTGAAGACAACAGACGGACAACGTATCATCGTACTCCGATCACC
ATTGCAGTTGAAAAATCACTTTCCAATGCCGTTGGATGTCAGCTACATTT
CCAAAGAAAACCAACCAGTTAAACTGACAACAGTGGGATCGGGAGATATC
TATTCCTTCCCTTTGTTGTTAACCTACCACAGTGTTTTTCATCTCAAACC
TGCTGGTTTCGACTACGGTGATTGCACAGAAGCTCTCAATTGGAGTGATT
TGAAGACGAGCAACGAAAAACAGTTCTCCTGCCCTTCACCTGACAAAAGT
GCTGACCCTTTCTACATGCAGGTGGTGATGAAAGAGGAGACGTACTCTTC
CGTACACGGCATGTTGGACTGTGTACCACGTTACACGTTGGAGTGCTTTC
CCGTCATCACGCTGCATAATTACCTACCTTGCACTATTAATTATAAGATC
AAGGGTATGGCGAAATCGGAAAGTCTACCAGGCGGACACAATTGGCCTTT
GTTTACCGTCAACTTCAGTGATAAACCTTCCATCTATATCGAGATTGAGT
CGTATAACAACCAAAGATGGGAAGGAGGTTTGACATTACCAACAAAACCG
GTAGATTCTTTGAACAAACCATCATTATCTTTCGTCATGATGTCTGGTGA
ACGCAAAATGGAATTGGGTGTTTATTACCAGTTAGACGGTTCATTGAACA
TCACCTTATATTCGCCTTACTGGCTTCTCAATAAAACTGGAAAACCACTT
GTCTATCAGCCAGCGGGGAGCAGCATCCAGCAAGTTCACCAAGAGAACGA
TGTAAATGCTCTTATGATGCTCGTCAAAGGGAAACATAAAAAGgcgaaag
tgaaagtgaaaaataGCGAGTCATGGTCAAATGAATTTTCATTGGATACT
GTTGGCAGTGGTGGTTCCTTGAAATGCAATGGTCCAAGAGATCGAGTTTA
TGAGATTGGTTTGAACATCAGTTTGTCATACTTTGGATTGACGAAGATTG
TGACGTTCACGCCACTCCGAATGTTATCTAACCACACCAAGTACACCATC
AGTATGGCAGAAAGTAATTCTAAATCGTCAGAATGGCACACGGTAAACCC
TGACGAGaacattccatTCTGGCCGACGAAACTTCCTTTGGTCAACCTTT
ACATTAACATCAATGGGCAAGATTCAGTGAAATTCAACCCTGAAGTTGGA
AAAACTTTACTGTTGAAGTTCCAGAATGAGGTTGGAGGAGTTTGCGTGGA
TTACCAAGAAAAGGACTCGTCCTCAGTCCTTTCGTTTAATCCGTACTTCG
CAGGTGCAGCTCCTGTGCGGCttgaaaatctttgcaaaaaGATCGGCATG
ATCGCTTATAAACAAGCAGGTTCGGTAATGGGTCACGTGTTAACACATGA
CCAATCAGTGTTGTACACGTGGGATGATCCAACCATGGAACAAGAATTGA
TTTGTTCCATTGTCAATGATGAAGCCAGTGAAACAAGGATCAAACTCGAT
GCCAACGATTTCGGACGAATGAGAGTTGGAGATGGTGCAATTTATTGGGT
TTCCTTTCTGGATGGTCTTCAACGTGTTCTATTGTTCACTGATAACTTCA
AATCTGCTTACTGCGCATGTCAGgaGCAAAATTTACGCCCAACCATGGAA
GTTGACTTTGAGATTGAGAGTTTTGGTTTGTCTCTGGTCAATGTTGATAA
GAGAATGGAGATTGGCTACTTAGCTATCCGACAAAGCAAGACTGTATGGG
AGCAACGCAAGAAAAAGAACCGCTGGAAAGCTTTACCGCTTGCCATGTGT
GAAGCTCTCGAAGAAGGTTATCTCAATTATCAAAACAGAAAAGGTGCAGT
CAAAGAGAAAGTTCTGGATAAGGAGGTGGATTACGAGAAGATGTTTATTA
CGAAACCTGAGAAGATTAAGATCAGAAGAACGTACCACAGCGGTCTTGGT
TTCAAATACACAATCTCACCCAATGAAATGCGTGTGCATGCTTCTATCAG
CTCAATACAGTTGGATAGCCATGTTCCAGGTTCGACCTTTCCAACAGTCT
TGCATATGGTTGAACCACCAAAATCTGTTGCTTCAGAAAACGCTCCAAAG
CCATTCTttgaattgagtttaatgaCAAGGATCGGTGATAAAAATGTGGT
CAATGAAGTcagCTATTGTCACGTGTTGATTCAAGAGATGGATGTGAGGG
TTGATATTGGATTTTTATTGGCTCTGATGGAACTCTTCAGTCATGCAAGA
GCTCGAACAACCGAGAAAGAACAATACGCGCTTGATATTGGCCAAGCAGC
AACAAAGTTTGAAGAAAGCGCTGAATTTCAGGCAGCCAAACAAGATCGAT
ATTACGTTTTGAACGACTTTCATTTATCACCGCTAAAGATTCACGTCAGT
TTCTCTTTGACGGGTGGTTCCAAAGATGAAAATGCTATTGCTTCATTACA
TGGTAACGTGTTGAACTTGTTGTTACAAAGTGTCGGACTGGCCTTCACTG
AAATACAAGACGTACAATTCAAATTAGCATGTTACGAAGTGCATAAGTCC
ATGCAGAGTAATTCGCAGCTCGGTGATGGAATAACTAAACATTATCAAAC
ACAGGCTATCAAGCAACTTTATGTGTTGGTACTCGGGCTAGACGTTCTTG
GTAATCCGTATGGTTTGATATCTGGTGTTGGAACCGGAGCAAAGAATTTC
TTCTACGAACCTTACCAGGGATTAATTCAAGGACCAGAAGAATTTGCGGA
AGGATTGGCGTATGGGGTGAAGAGTCTTGTTGGTGGAACCGTGGGTGGAG
TATCAGGAGCTGTGAGTAAGATTACCGGTACCTTCGGTAAAGGTTTGGCT
GCATTGACCTTGGATGAAGAATATCAACAAAAGAGACGTGAAAACATGAG
CCAACGCCCAACTAACCTCGGTGAAGGTCTCGCCAAAGGTGGTAAAGGCC
TTGTAAAGGGTATCGTGTCTGGTGTTACAGGGATCGTTACCAAACCCTAT
GAAGGTGCCAAGAATGATGGTGCAGGTGGCTTTTTTAAGGGCGTTGGAAA
AGGCCTGATTGGCGTGGTTGCACGCCCTGTTGGTGGAGTGGTAGATATGG
CCAGTAACACGTTTGATGGTTTGAAAAGCACGACATCTGGCGTGAAAGCG
ATCGAGTTGAGCCGTGTTACTCGCGTCTTCCACGCAGATAAGGTTTTACG
ACCTTTCAATCTGTACGAAGCAGATGGAAACAAAATTCTTATGCAATGTA
ACAAAGGAGAATACGCCAAGAAGAATTTTTATATCACTCATGTAGTGGAC
AAGAAGAACTATCTCATCCTCACTCAATCaaacATTTTGTATGTTGGAAA
GAACGAGTTGAAAATGGGTGAATGGGAATCggtttgggttatcgagttca
ATGAGCTAAAACGTGAACCAGAAGTGAAAGAGACAAAGATTATTTTCCAT
ATCCATAATACGGACACGCGACGTTCAATTTTCAAGAAATCGACGAACAC
ACGTGAAGTGATATTGGAGTCTAGTGCTGTTGCAGACTGGTTTATCTTAA
AGCTTAGAGATGCTAAAATGTTATAGatggtatttgaaTCTTTGGTTGCT
GACCTCTTGAACAAGTATCTGGGTCAATATGTGAAAAATCTTGATGCTTC
TCAATTGAAGATTGGCATTTGGGGAGGAAATGTTGTCCTGACAGAACTTG
AACTGAAAGATACAGCTCTGGATGATCTTGACTTACCCATAAAAGTTGTT
CGTGGATATTTGGgtAAATTGGTCTTGTCCATCCCATGGAAAAATCTTTA
CACTGAATCAACTGTTGTCGATATTCAAGATCTCCACCTTGTCGCTAAGC
CTAATTTTGACATCAAATACAATGAAGAACgcgaagaaaaatcaaaacat
gacAAGAAACAACAACAGATTCACAATATCGAAGAAGCGAGGCAAAGAGA
AGAAGACAAAAAGAAAGGCGCCAAGAAAGAAGAGAGTGACGGTTTTGCTG
AGAAACTTGCAACAAACGTCATAAAAAATCTACAGGTTACGATCAAGAAC
ATACATGTTCGATATGAAGACTCAATCAGTGATGTGAATGGACCCTTTTC
AGTCGGTCTTACAATGGAAAGTTTAACAGCACAAACCACAGATGAAGATT
TTGTTCCAAAGATTATCAAAGAATCTGTCTCATTAATTCATAAGatggTG
AAATTAGACAATTTGGCTTTATATTGGAATCCAGGAGACGAACTGATTGA
TCCTTCACTTGATACCAAGCAATGGTTGgaagtTTCAACGAAGCAAATTT
CAACACACCAATCGAAGCCAGAGAAAACGAAATATATTTTGAGTCCCATG
GTTGCAACGAAGAAATTGAAGCTGAACACCAAACCAGGTTCCAACCTTGA
CATCCCGAAGatgttTTTGAACTTGGTTTTGGAAGAACTTGGTATCATCG
TGGCAAGAAGTCAATATCATGGCGTGGTGCAACTGATTGAATCATTTGAA
CGAATGAATAGGAACCAACCTTTTCGTAAATACAGACCACATACCTCCGT
TCTTGGGAACGAAAGTATTTGGTGGAAGTACTGCATGTCCAGCATACTGG
AGGTGGATGTCAAAAGACGATCTCAAATGTGGAGCTGGAAGCATATTCAA
AAACATCGAGTTCTTTGCAAAGCTTACAAAGTGAAGTAcaaggaaaaatt
gaaacagaaaaATCCATCCAAACAAATTCTCACTGAACTAGAGaGCATGG
AGGATGAGTTGAATATTGCAAGCATCACCATTTTTCGACAGCTTGCAGCT
ACAGAGGTTTTAACGGAACAAAAGAAGAAAGGCACTAAAGGAAGTTTCTT
CAGTTTCTTCTCCAGATCAAAAGAACCAGAAAAGTCTGCTGCTAATAAAA
TTGGAGATTTAATGGGTGATGACCAGGAGAAGGAAATGCAGAAATTGTAT
GACGCAATCGGTTATACTGAAAATGAAGTCATCACTCCCTTTCCTAAAGA
GTACGTGGCGATGTCAGTGGAATCGATTCTCCAGAAATTATTCATCAGCC
TCATCGATGACACAGATAAGGCGAAAGAATTCAAAGTGTTGGATTTTTCA
CTCAACAACATCATTGTAGAAGTTTTCCAAAGACCTTCTGCTCAAGCTCT
CAAATTATGTGCAAAGATAGGAGAGATGAAGTTATTTGGTACAGCTTCTG
CTCAATGTACACCTCtcatcatcaaaaacatgttaCAAGGTCGAGGTATG
GAATTTCTGCCGTTGGTGGACTTCATCTTTGAGACGAATCCTTTGAAGAA
ACCGGACATTGACCAATGTATCACTGCTATTTGTCAACCCTTAGAAATCA
TCTATGATGCTAACACGATCAACCATATCATTAGTTTCTTCAAACCTCCT
GAACATGTTATCTTGCAAGATTTACAAGACAAAGCGTATTCTACTTTCGA
AGATTTTAAAGTTTCAAGTACGGCTGGTCTTCTACATGCTATGGAACAAA
GAACGGTTATGGACATCGACATTGATGTTGGAGCATCTCATTTGATCATC
CCTGAAAAAGGTTCTTACAATGGTTGTACAGATATGCTGGTGATCGACTT
TGGTAAAATCACGATGAGCAGCGATCCTAGTCAAATCAGACACCTTGACC
CTAAGGACATTGAGGATGTGAATGAAGTACAAAGCAAAGCTTATGATCGA
TTCTTGTTGTCGCTTCAAGCTCTTCAAATATTACTCGTTAGAGAAGGTGA
AGATTTAAAGAGTGCTAAAAGCAACGTCAGTAAAGCTTCATCACACATTT
TGCATCCCATCAATTTCGATGGCAAACTTGCCAAAGCTATACTTCCACAA
GATCCACGTTTAAAACAGATATGTGTCTCTGGTGAATTATCTTCGCTGTT
TGTTTCTGTATCGGATGATAAAGTCAGTCGTCTCATCAAGCTAGCAGACT
CGATACCACTCCCTCAATCACCTTCTCACGATAACATCGACGGAGAAGAA
AAACCTGAAGGACTCTTCACCAAGGCGTTGTCAATGATAAGCTTGACAGG
TGACAATGACACAGGGGTGGACATCGGAGGATTTTCCATCCCTGTACCGA
CATCTCCAACATCAGTGACGTCAGATGAAGATGAATACGGGACACCACCT
GATGGCTCCATATTACAGTTACAACAAGAAGCTGGTCCGGACTTTTCATC
AGGAGTGGCGAACCAAGTCAAAGTGGACTTGAACTTTAAAATCCATAAAG
TGATGATCGCCATTGGTTTGACTGACAAAGCATTGAAACAGGAAAAAGAA
TGTCTGAAATTCATCGTGGACGACATCAATACAGAGgtGATACTACGAAG
ATGGGATTTGTTCGTCAATGCAGAAGTTGGTCGTCTGGTGTTGAATGAAA
TGACATGGGGTGTTGATGGAGAACCTTTCGCCATCATGAGTACacccaaa
aacaccaaaatgttGAAATTCAGCTATCGGAGGTGTGAATTCAACGAAAG
TTTGAATCTCGGTCCAAGTTACTTTTATTCCAAAGAAGCGCAAGTCAGAG
CTTTACATTTCAAAGATGAATTTGGCGCCACGGATCAGATTTTAGATGTA
CAAGTGGCTACTTTATTTCTGATGCTTCATCAAGAAGCACTTTTGAGCAT
CATGTCATTGATCTACCAAGTACTGGAACCACTCAACAAACATGATAAGG
AAGCCACACAGAAGATCAAACGGAGTTTGAGTACGGCAGGTAGTCGTTTG
AGTCTCTCCatcgaagaaaaagaaaaggagaGACAGATACAACGAAAATT
AGCCAACCCTAAAGCACTGGAAGCTGCCAACGAACTTAAGCAACAGGTTG
GcttagaagaagaaaaaaagatgaGAGTGACCGCCCACCTGGATGGTGTT
GGTATCATGATTTGTTCAGCCAAAGTTGACCTTGCACAAGCCTTCGTTAA
AGGGTTATCTGCTAAAGTACTGATGAAAGATGACTTATTAGAAGTGAAAG
CCAGCATGAAAGATATGCAAGTACAAGATAATGTTGGCGAAACAAAGTAC
AAAGACATCATTAGCATGCGATCTGATGAAGTGTTCGATTTAGAGTTGGC
TATTTACGAGAATGGATCTTCTGGTAGCAAGCAATACGATATGTCGTGTG
TCGACACCAGTGTCAAACTGAACTTCGGTCAAATGCGCGTTGTTTTCTTG
TATAGATTCATACAAGACTTAATGTCATTCACCGAAAACTTCGAAGAAGC
ACAGAAAGCAGTTGTGGAAGCTGGTAAAGCTGCCAAGGATAAAGCTCTGG
AAACAGCGACCGATTTGAATAGACATTCTTCTCGTGTCAAACTAAATGTG
GTTCTGAAAGCACCGACTATTATCATTCCAGTTGGATCAAACAATGAATT
GGCTTTACTGGTGGATCTGGGTGAATTGCGTATTTACAACACATTCAAAC
TCCTCAACGATGATCAATACCATAAGAAATCTATCATCACTGATAACATG
ACCATTAAGTTATCCAATCTGAAATTGTTAAAAGCACTTATTCAAGATGG
TAAAGATTTCTTGCATCAACGAGCCATTATTGAACCTATGATGCTACAAA
TAACTATTGTTCGTAATTTAACGAAAGGTAACCATTCCATACCGGATGTT
TCAGTTCAAGCAAAGATGCCAGCTATTCTGTTATCAATCAGTGAAGAAGA
TGTGACCGTAGCTCTAAAGATTGTCCAAGGGAATCTCGCCGAAGGTGAGT
CACATGCGCCGAAGAAGCAAGCCAAGCCTGCCAAACAAACGTTAAACGTG
CCACAAGATCGTTTAGCAGACATTTACGAGGAGcctgaagatgaagatga
gaaTCGACAAGGATATCTTCAAACCAAACTATCCTTCGATCTGGCTAAAA
TTGACATCAAGCTTTACTTGAAACCATCTGATATGACATTTGAAGATGAA
TTTTTAGCGAGGACGGATGATTTGTTGTTAGCTTTGTTCACTATTGGTAA
CCTGTGTGTTGATGGAGACATCATGTCCACGCAAGCTATGAAGATGAGCG
TTCGATTGGACACTTTGGTGTTGGATGATATGAGACCTATCGAGGAGCAT
GAAGGTGTTAAACGTATGATCAACTACAGTCCCGAGCCACTCCTTGAAGA
AGTCAAAACCTCTTCTCATAAACGACCAATCGACAACTCACGAATGATCG
AAATCCAAttcgatcaaacttcatcgcaagataaaaatatcgacATCAAA
CTTTGTAACATGCTTTGTATATTCAACGTTGAGTTTATCATGGTCCTGTT
GAAAACGTTGCAAGCTGCCATACCTAAAGATGATAGTCTGCAACATGGCC
ATTCAATGAGTAGTCTAGACTCGGCGGCAGGGTCTGGCGGCAGCGATGAC
GAGGACTCTTTAGAAGCCAGCGAGATTGTCCTCTGCACTGGTGATCAAGA
AAGACCTGAGACTAAAGTCTCTATCTTCGTCCATAACCCGCAAATTGTTT
TACTAGCAGATGCAAAGGATGTCAAAACAAATGCACTCTTTCTTACAACC
GagatcaattttcaatatttcgaaTTGCGAGATACTCAAAAAATGATTGG
CGCTGTTTCTAACACCGCTATTTTGTCAACTGCTTTCAAGAATGACCATC
GGAGTGATATATCAACAGTGTTGTCATTAGATTCCATCAATCTCCACTCG
TCATCACCCATCAATGGTAAACCTCATATGAGTGTCAGCACAACTTTGAT
CAAACTGAATATCTCACCCAAAACCATCCGAACTTTATCAGCGTGTGCTG
GTTACATCTCCAATGATCCAACAGATGAAGAAATCAAAGAAGCTCGAAAA
GCCATGCGTGATTTATGGCAAATTCAAACGTTCACCAATAAGCGACCGTG
GTATTTAAACCACCCACCACAACAAGTCTTAAGTGCTGGCAGCTTCGTCC
TTGCGCGAACGAGAACAGGAGAATATAAGCATGGTTTCTTAGCTAAAAAG
GATGTCTCGTATCAAGTCTATTTTTCAGAGGAGCGAGGAACAGCCAGTCA
CCGAGCCATGGATATCTCATCTGTTGTTTTGGATATCGTACCGCTGATCG
GTGATCTATGTGTTGGATGTAATGTTTTAGCTGTGGAATCGAAAGAACAT
GGATATCGTACTGGTCGAATTACTCAGGTTTGGGATTCGAATGTGGATAA
AGATTCTTCGGATGGCGCCAAACAATCTGTTTCTGTCAAGACAACTGCTA
TTGCTCCAATCAAATACCTTGTCAATTTCTATGACAACCAAACGGAGAAC
TTCTTCCCGCCTGATGAACTTCGTATCATTGGTAAACCCATCAAGGGGGT
TGTCCCTGGACTAGGGGCGTGTGTTTACGCCCGCTTTAATGATGGTTTTT
ACTATCGGGGCAAAGTTGATGACATCGAGGATTATCGAATCCGAGTGCAA
TTGGATGAGATCAGTGGAGAAATCGAACACGACATCGATGATCCGTCAGC
CGTTATTTTGAACCTGACGCCTCAATACCGTCAAGTCAAAAAGCATTTCA
AAGTCATTGCATCCAAAGGAAGCACAACTAAAGGATATCATCCGGGGAAA
GTGACCGCCATCCAAGGTGAAGGAAATAACCGATTGTATTCGATACGCTT
CGAAGACGGTACAATTAACCAAGTACCCATCacgaaattgattttgatgc
cAAAAGCACCTTTTGATGCTTTACCTGAAGTTGGCACATACGTTTATTCC
CGAGTGTCACGCGACGCTCCTTTATACGAGAAGGGTATCGTAGCAGAGAA
GAACACAATGATCTGCGTTAAACATTTAAATGGACGGAAATTGGCTCACG
AAATACAAAACATTCATTTTGTTGTCCGAAATATCGTTCCTCTCGTGTCA
TCAttgaagGTTGGTTTGGACGTCATAGTGCAACCTGACAATGACGATCA
GAAAATGTATTTGGCTGTCATTAGGGAAGTCACCAAAAAAGAAGGTGACA
AAACGAACCGTTATCTAGTGGAGTTTACGGATGGATCCAAGAAGAGAGTG
ACGCCCAGCCGGATCCGTATACTTTCTCAATACGGAAGTGCAGAAACGAG
TGAAGAAAATGCTGACATTATCACAACAAGACAGGAGGAACTAGTTCTCG
ATGTGCAAGGTATCTCATTACGTGTGGAAGGTTACTTGGGAGGCGTGTTG
ACACCCATGCTCAAAATGGATTCCAAAATCACAGCTAACTTGAAGGATTG
GTCAAGCCAAATGAATGCACACGCTACTGTATCATTAGAAGCCAGTTATT
ATAACGAAAACGTTGCCGAATGGGAGCCAGTTATTGAACCTTTGATGGAG
AAACGGAGGGAAAGACCGTGGCAACTCTCTGTCAATTACACGATGGAAGG
TGACGACAATTCTGCTTCATCCACTTCCAACGAACTCGTTTTACAAAAAC
CGGAATCCAACCTGAAAATCAAATCTCAAGATAATCTTGAATTGACAATT
TCAAAATCATGTCTTGCTTTACTCGGTGAATTGGGACAGGTGTTTGGAGA
TGCAGTAGAATCTGTGGACGTTTTACCACAAGTCCTGGTCGAAAAAGAAC
CTTTCATGATCGAAAACTTGCTCTCCAAGAAGGTGACAGTAACATTGAAT
GAACTTCTGCAGGGACCAAATGGAGATTCGACAATCGAGCTAGCATCTTC
TTCGAATCCTGTTGGCATTACTTTTGCTCCCAagaaatttgagaaacgaa
AGACCAACGATCTATACACAATCAATTTAtcgGTGGACGGTTTTCATGAC
ATTAAAGACATTGTGGTTCAAAGAAAGCGAAGCGTTATCTATGATCTTGT
ACCAATAAAACTATTATCAGCACAGTCTTCATATTCGATAGTGGTACAAG
TGAAGACAACAGACGGACAACGTATCATCGTACTCCGATCACCATTGCAG
TTGAAAAATCACTTTCCAATGCCGTTGGATGTCAGCTACATTTCCAAAGA
AAACCAACCAGTTAAACTGACAACAGTGGGATCGGGAGATATCTATTCCT
TCCCTTTGTTGTTAACCTACCACAGTGTTTTTCATCTCAAACCTGCTGGT
TTCGACTACGGTGATTGCACAGAAGCTCTCAATTGGAGTGATTTGAAGAC
GAGCAACGAAAAACAGTTCTCCTGCCCTTCACCTGACAAAAGTGCTGACC
CTTTCTACATGCAGGTGGTGATGAAAGAGGAGACGTACTCTTCCGTACAC
GGCATGTTGGACTGTGTACCACGTTACACGTTGGAGTGCTTTCCCGTCAT
CACGCTGCATAATTACCTACCTTGCACTATTAATTATAAGATCAAGGGTA
TGGCGAAATCGGAAAGTCTACCAGGCGGACACAATTGGCCTTTGTTTACC
GTCAACTTCAGTGATAAACCTTCCATCTATATCGAGATTGAGTCGTATAA
CAACCAAAGATGGGAAGGAGGTTTGACATTACCAACAAAACCGGTAGATT
CTTTGAACAAACCATCATTATCTTTCGTCATGATGTCTGGTGAACGCAAA
ATGGAATTGGGTGTTTATTACCAGTTAGACGGTTCATTGAACATCACCTT
ATATTCGCCTTACTGGCTTCTCAATAAAACTGGAAAACCACTTGTCTATC
AGCCAGCGGGGAGCAGCATCCAGCAAGTTCACCAAGAGAACGATGTAAAT
GCTCTTATGATGCTCGTCAAAGGGAAACATAAAAAGgcgaaagtgaaagt
gaaaaataGCGAGTCATGGTCAAATGAATTTTCATTGGATACTGTTGGCA
GTGGTGGTTCCTTGAAATGCAATGGTCCAAGAGATCGAGTTTATGAGATT
GGTTTGAACATCAGTTTGTCATACTTTGGATTGACGAAGATTGTGACGTT
CACGCCACTCCGAATGTTATCTAACCACACCAAGTACACCATCAGTATGG
CAGAAAGTAATTCTAAATCGTCAGAATGGCACACGGTAAACCCTGACGAG
aacattccatTCTGGCCGACGAAACTTCCTTTGGTCAACCTTTACATTAA
CATCAATGGGCAAGATTCAGTGAAATTCAACCCTGAAGTTGGAAAAACTT
TACTGTTGAAGTTCCAGAATGAGGTTGGAGGAGTTTGCGTGGATTACCAA
GAAAAGGACTCGTCCTCAGTCCTTTCGTTTAATCCGTACTTCGCAGGTGC
AGCTCCTGTGCGGCttgaaaatctttgcaaaaaGATCGGCATGATCGCTT
ATAAACAAGCAGGTTCGGTAATGGGTCACGTGTTAACACATGACCAATCA
GTGTTGTACACGTGGGATGATCCAACCATGGAACAAGAATTGATTTGTTC
CATTGTCAATGATGAAGCCAGTGAAACAAGGATCAAACTCGATGCCAACG
ATTTCGGACGAATGAGAGTTGGAGATGGTGCAATTTATTGGGTTTCCTTT
CTGGATGGTCTTCAACGTGTTCTATTGTTCACTGATAACTTCAAATCTGC
TTACTGCGCATGTCAGgaGCAAAATTTACGCCCAACCATGGAAGTTGACT
TTGAGATTGAGAGTTTTGGTTTGTCTCTGGTCAATGTTGATAAGAGAATG
GAGATTGGCTACTTAGCTATCCGACAAAGCAAGACTGTATGGGAGCAACG
CAAGAAAAAGAACCGCTGGAAAGCTTTACCGCTTGCCATGTGTGAAGCTC
TCGAAGAAGGTTATCTCAATTATCAAAACAGAAAAGGTGCAGTCAAAGAG
AAAGTTCTGGATAAGGAGGTGGATTACGAGAAGATGTTTATTACGAAACC
TGAGAAGATTAAGATCAGAAGAACGTACCACAGCGGTCTTGGTTTCAAAT
ACACAATCTCACCCAATGAAATGCGTGTGCATGCTTCTATCAGCTCAATA
CAGTTGGATAGCCATGTTCCAGGTTCGACCTTTCCAACAGTCTTGCATAT
GGTTGAACCACCAAAATCTGTTGCTTCAGAAAACGCTCCAAAGCCATTCT
ttgaattgagtttaatgaCAAGGATCGGTGATAAAAATGTGGTCAATGAA
GTcagCTATTGTCACGTGTTGATTCAAGAGATGGATGTGAGGGTTGATAT
TGGATTTTTATTGGCTCTGATGGAACTCTTCAGTCATGCAAGAGCTCGAA
CAACCGAGAAAGAACAATACGCGCTTGATATTGGCCAAGCAGCAACAAAG
TTTGAAGAAAGCGCTGAATTTCAGGCAGCCAAACAAGATCGATATTACGT
TTTGAACGACTTTCATTTATCACCGCTAAAGATTCACGTCAGTTTCTCTT
TGACGGGTGGTTCCAAAGATGAAAATGCTATTGCTTCATTACATGGTAAC
GTGTTGAACTTGTTGTTACAAAGTGTCGGACTGGCCTTCACTGAAATACA
AGACGTACAATTCAAATTAGCATGTTACGAAGTGCATAAGTCCATGCAGA
GTAATTCGCAGCTCGGTGATGGAATAACTAAACATTATCAAACACAGGCT
ATCAAGCAACTTTATGTGTTGGTACTCGGGCTAGACGTTCTTGGTAATCC
GTATGGTTTGATATCTGGTGTTGGAACCGGAGCAAAGAATTTCTTCTACG
AACCTTACCAGGGATTAATTCAAGGACCAGAAGAATTTGCGGAAGGATTG
GCGTATGGGGTGAAGAGTCTTGTTGGTGGAACCGTGGGTGGAGTATCAGG
AGCTGTGAGTAAGATTACCGGTACCTTCGGTAAAGGTTTGGCTGCATTGA
CCTTGGATGAAGAATATCAACAAAAGAGACGTGAAAACATGAGCCAACGC
CCAACTAACCTCGGTGAAGGTCTCGCCAAAGGTGGTAAAGGCCTTGTAAA
GGGTATCGTGTCTGGTGTTACAGGGATCGTTACCAAACCCTATGAAGGTG
CCAAGAATGATGGTGCAGGTGGCTTTTTTAAGGGCGTTGGAAAAGGCCTG
ATTGGCGTGGTTGCACGCCCTGTTGGTGGAGTGGTAGATATGGCCAGTAA
CACGTTTGATGGTTTGAAAAGCACGACATCTGGCGTGAAAGCGATCGAGT
TGAGCCGTGTTACTCGCGTCTTCCACGCAGATAAGGTTTTACGACCTTTC
AATCTGTACGAAGCAGATGGAAACAAAATTCTTATGCAATGTAACAAAGG
AGAATACGCCAAGAAGAATTTTTATATCACTCATGTAGTGGACAAGAAGA
ACTATCTCATCCTCACTCAATCaaacATTTTGTATGTTGGAAAGAACGAG
TTGAAAATGGGTGAATGGGAATCggtttgggttatcgagttcaATGAGCT
AAAACGTGAACCAGAAGTGAAAGAGACAAAGATTATTTTCCATATCCATA
ATACGGACACGCGACGTTCAATTTTCAAGAAATCGACGAACACACGTGAA
GTGATATTGGAGTCTAGTGCTGTTGCAGACTGGTTTATCTTAAAGCTTAG
AGATGCTAAAATGTTATAGatggtatttgaaTCTTTGGTTGCTGACCTCT
TGAACAAGTATCTGGGTCAATATGTGAAAAATCTTGATGCTTCTCAATTG
AAGATTGGCATTTGGGGAGGAAATGTTGTCCTGACAGAACTTGAACTGAA
AGATACAGCTCTGGATGATCTTGACTTACCCATAAAAGTTGTTCGTGGAT
ATTTGGgtAAATTGGTCTTGTCCATCCCATGGAAAAATCTTTACACTGAA
TCAACTGTTGTCGATATTCAAGATCTCCACCTTGTCGCTAAGCCTAATTT
TGACATCAAATACAATGAAGAACgcgaagaaaaatcaaaacatgacAAGA
AACAACAACAGATTCACAATATCGAAGAAGCGAGGCAAAGAGAAGAAGAC
AAAAAGAAAGGCGCCAAGAAAGAAGAGAGTGACGGTTTTGCTGAGAAACT
TGCAACAAACGTCATAAAAAATCTACAGGTTACGATCAAGAACATACATG
TTCGATATGAAGACTCAATCAGTGATGTGAATGGACCCTTTTCAGTCGGT
CTTACAATGGAAAGTTTAACAGCACAAACCACAGATGAAGATTTTGTTCC
AAAGATTATCAAAGAATCTGTCTCATTAATTCATAAGatggTGAAATTAG
ACAATTTGGCTTTATATTGGAATCCAGGAGACGAACTGATTGATCCTTCA
CTTGATACCAAGCAATGGTTGgaagtTTCAACGAAGCAAATTTCAACACA
CCAATCGAAGCCAGAGAAAACGAAATATATTTTGAGTCCCATGGTTGCAA
CGAAGAAATTGAAGCTGAACACCAAACCAGGTTCCAACCTTGACATCCCG
AAGatgttTTTGAACTTGGTTTTGGAAGAACTTGGTATCATCGTGGCAAG
AAGTCAATATCATGGCGTGGTGCAACTGATTGAATCATTTGAACGAATGA
ATAGGAACCAACCTTTTCGTAAATACAGACCACATACCTCCGTTCTTGGG
AACGAAAGTATTTGGTGGAAGTACTGCATGTCCAGCATACTGGAGGTGGA
TGTCAAAAGACGATCTCAAATGTGGAGCTGGAAGCATATTCAAAAACATC
GAGTTCTTTGCAAAGCTTACAAAGTGAAGTAcaaggaaaaattgaaacag
aaaaATCCATCCAAACAAATTCTCACTGAACTAGAGaGCATGGAGGATGA
GTTGAATATTGCAAGCATCACCATTTTTCGACAGCTTGCAGCTACAGAGG
TTTTAACGGAACAAAAGAAGAAAGGCACTAAAGGAAGTTTCTTCAGTTTC
TTCTCCAGATCAAAAGAACCAGAAAAGTCTGCTGCTAATAAAATTGGAGA
TTTAATGGGTGATGACCAGGAGAAGGAAATGCAGAAATTGTATGACGCAA
TCGGTTATACTGAAAATGAAGTCATCACTCCCTTTCCTAAAGAGTACGTG
GCGATGTCAGTGGAATCGATTCTCCAGAAATTATTCATCAGCCTCATCGA
TGACACAGATAAGGCGAAAGAATTCAAAGTGTTGGATTTTTCACTCAACA
ACATCATTGTAGAAGTTTTCCAAAGACCTTCTGCTCAAGCTCTCAAATTA
TGTGCAAAGATAGGAGAGATGAAGTTATTTGGTACAGCTTCTGCTCAATG
TACACCTCtcatcatcaaaaacatgttaCAAGGTCGAGGTATGGAATTTC
TGCCGTTGGTGGACTTCATCTTTGAGACGAATCCTTTGAAGAAACCGGAC
ATTGACCAATGTATCACTGCTATTTGTCAACCCTTAGAAATCATCTATGA
TGCTAACACGATCAACCATATCATTAGTTTCTTCAAACCTCCTGAACATG
TTATCTTGCAAGATTTACAAGACAAAGCGTATTCTACTTTCGAAGATTTT
AAAGTTTCAAGTACGGCTGGTCTTCTACATGCTATGGAACAAAGAACGGT
TATGGACATCGACATTGATGTTGGAGCATCTCATTTGATCATCCCTGAAA
AAGGTTCTTACAATGGTTGTACAGATATGCTGGTGATCGACTTTGGTAAA
ATCACGATGAGCAGCGATCCTAGTCAAATCAGACACCTTGACCCTAAGGA
CATTGAGGATGTGAATGAAGTACAAAGCAAAGCTTATGATCGATTCTTGT
TGTCGCTTCAAGCTCTTCAAATATTACTCGTTAGAGAAGGTGAAGATTTA
AAGAGTGCTAAAAGCAACGTCAGTAAAGCTTCATCACACATTTTGCATCC
CATCAATTTCGATGGCAAACTTGCCAAAGCTATACTTCCACAAGATCCAC
GTTTAAAACAGATATGTGTCTCTGGTGAATTATCTTCGCTGTTTGTTTCT
GTATCGGATGATAAAGTCAGTCGTCTCATCAAGCTAGCAGACTCGATACC
ACTCCCTCAATCACCTTCTCACGATAACATCGACGGAGAAGAAAAACCTG
AAGGACTCTTCACCAAGGCGTTGTCAATGATAAGCTTGACAGGTGACAAT
GACACAGGGGTGGACATCGGAGGATTTTCCATCCCTGTACCGACATCTCC
AACATCAGTGACGTCAGATGAAGATGAATACGGGACACCACCTGATGGCT
CCATATTACAGTTACAACAAGAAGCTGGTCCGGACTTTTCATCAGGAGTG
GCGAACCAAGTCAAAGTGGACTTGAACTTTAAAATCCATAAAGTGATGAT
CGCCATTGGTTTGACTGACAAAGCATTGAAACAGGAAAAAGAATGTCTGA
AATTCATCGTGGACGACATCAATACAGAGgtGATACTACGAAGATGGGAT
TTGTTCGTCAATGCAGAAGTTGGTCGTCTGGTGTTGAATGAAATGACATG
GGGTGTTGATGGAGAACCTTTCGCCATCATGAGTACacccaaaaacacca
aaatgttGAAATTCAGCTATCGGAGGTGTGAATTCAACGAAAGTTTGAAT
CTCGGTCCAAGTTACTTTTATTCCAAAGAAGCGCAAGTCAGAGCTTTACA
TTTCAAAGATGAATTTGGCGCCACGGATCAGATTTTAGATGTACAAGTGG
CTACTTTATTTCTGATGCTTCATCAAGAAGCACTTTTGAGCATCATGTCA
TTGATCTACCAAGTACTGGAACCACTCAACAAACATGATAAGGAAGCCAC
ACAGAAGATCAAACGGAGTTTGAGTACGGCAGGTAGTCGTTTGAGTCTCT
CCatcgaagaaaaagaaaaggagaGACAGATACAACGAAAATTAGCCAAC
CCTAAAGCACTGGAAGCTGCCAACGAACTTAAGCAACAGGTTGGcttaga
agaagaaaaaaagatgaGAGTGACCGCCCACCTGGATGGTGTTGGTATCA
TGATTTGTTCAGCCAAAGTTGACCTTGCACAAGCCTTCGTTAAAGGGTTA
TCTGCTAAAGTACTGATGAAAGATGACTTATTAGAAGTGAAAGCCAGCAT
GAAAGATATGCAAGTACAAGATAATGTTGGCGAAACAAAGTACAAAGACA
TCATTAGCATGCGATCTGATGAAGTGTTCGATTTAGAGTTGGCTATTTAC
GAGAATGGATCTTCTGGTAGCAAGCAATACGATATGTCGTGTGTCGACAC
CAGTGTCAAACTGAACTTCGGTCAAATGCGCGTTGTTTTCTTGTATAGAT
TCATACAAGACTTAATGTCATTCACCGAAAACTTCGAAGAAGCACAGAAA
GCAGTTGTGGAAGCTGGTAAAGCTGCCAAGGATAAAGCTCTGGAAACAGC
GACCGATTTGAATAGACATTCTTCTCGTGTCAAACTAAATGTGGTTCTGA
AAGCACCGACTATTATCATTCCAGTTGGATCAAACAATGAATTGGCTTTA
CTGGTGGATCTGGGTGAATTGCGTATTTACAACACATTCAAACTCCTCAA
CGATGATCAATACCATAAGAAATCTATCATCACTGATAACATGACCATTA
AGTTATCCAATCTGAAATTGTTAAAAGCACTTATTCAAGATGGTAAAGAT
TTCTTGCATCAACGAGCCATTATTGAACCTATGATGCTACAAATAACTAT
TGTTCGTAATTTAACGAAAGGTAACCATTCCATACCGGATGTTTCAGTTC
AAGCAAAGATGCCAGCTATTCTGTTATCAATCAGTGAAGAAGATGTGACC
GTAGCTCTAAAGATTGTCCAAGGGAATCTCGCCGAAGGTGAGTCACATGC
GCCGAAGAAGCAAGCCAAGCCTGCCAAACAAACGTTAAACGTGCCACAAG
ATCGTTTAGCAGACATTTACGAGGAGcctgaagatgaagatgagaaTCGA
CAAGGATATCTTCAAACCAAACTATCCTTCGATCTGGCTAAAATTGACAT
CAAGCTTTACTTGAAACCATCTGATATGACATTTGAAGATGAATTTTTAG
CGAGGACGGATGATTTGTTGTTAGCTTTGTTCACTATTGGTAACCTGTGT
GTTGATGGAGACATCATGTCCACGCAAGCTATGAAGATGAGCGTTCGATT
GGACACTTTGGTGTTGGATGATATGAGACCTATCGAGGAGCATGAAGGTG
TTAAACGTATGATCAACTACAGTCCCGAGCCACTCCTTGAAGAAGTCAAA
ACCTCTTCTCATAAACGACCAATCGACAACTCACGAATGATCGAAATCCA
AttcgatcaaacttcatcgcaagataaaaatatcgacATCAAACTTTGTA
ACATGCTTTGTATATTCAACGTTGAGTTTATCATGGTCCTGTTGAAAACG
TTGCAAGCTGCCATACCTAAAGATGATAGTCTGCAACATGGCCATTCAAT
GAGTAGTCTAGACTCGGCGGCAGGGTCTGGCGGCAGCGATGACGAGGACT
CTTTAGAAGCCAGCGAGATTGTCCTCTGCACTGGTGATCAAGAAAGACCT
GAGACTAAAGTCTCTATCTTCGTCCATAACCCGCAAATTGTTTTACTAGC
AGATGCAAAGGATGTCAAAACAAATGCACTCTTTCTTACAACCGagatca
attttcaatatttcgaaTTGCGAGATACTCAAAAAATGATTGGCGCTGTT
TCTAACACCGCTATTTTGTCAACTGCTTTCAAGAATGACCATCGGAGTGA
TATATCAACAGTGTTGTCATTAGATTCCATCAATCTCCACTCGTCATCAC
CCATCAATGGTAAACCTCATATGAGTGTCAGCACAACTTTGATCAAACTG
AATATCTCACCCAAAACCATCCGAACTTTATCAGCGTGTGCTGGTTACAT
CTCCAATGATCCAACAGATGAAGAAATCAAAGAAGCTCGAAAAGCCATGC
GTGATTTATGGCAAATTCAAACGTTCACCAATAAGCGACCGTGGTATTTA
AACCACCCACCACAACAAGTCTTAAGTGCTGGCAGCTTCGTCCTTGCGCG
AACGAGAACAGGAGAATATAAGCATGGTTTCTTAGCTAAAAAGGATGTCT
CGTATCAAGTCTATTTTTCAGAGGAGCGAGGAACAGCCAGTCACCGAGCC
ATGGATATCTCATCTGTTGTTTTGGATATCGTACCGCTGATCGGTGATCT
ATGTGTTGGATGTAATGTTTTAGCTGTGGAATCGAAAGAACATGGATATC
GTACTGGTCGAATTACTCAGGTTTGGGATTCGAATGTGGATAAAGATTCT
TCGGATGGCGCCAAACAATCTGTTTCTGTCAAGACAACTGCTATTGCTCC
AATCAAATACCTTGTCAATTTCTATGACAACCAAACGGAGAACTTCTTCC
CGCCTGATGAACTTCGTATCATTGGTAAACCCATCAAGGGGGTTGTCCCT
GGACTAGGGGCGTGTGTTTACGCCCGCTTTAATGATGGTTTTTACTATCG
GGGCAAAGTTGATGACATCGAGGATTATCGAATCCGAGTGCAATTGGATG
AGATCAGTGGAGAAATCGAACACGACATCGATGATCCGTCAGCCGTTATT
TTGAACCTGACGCCTCAATACCGTCAAGTCAAAAAGCATTTCAAAGTCAT
TGCATCCAAAGGAAGCACAACTAAAGGATATCATCCGGGGAAAGTGACCG
CCATCCAAGGTGAAGGAAATAACCGATTGTATTCGATACGCTTCGAAGAC
GGTACAATTAACCAAGTACCCATCacgaaattgattttgatgccAAAAGC
ACCTTTTGATGCTTTACCTGAAGTTGGCACATACGTTTATTCCCGAGTGT
CACGCGACGCTCCTTTATACGAGAAGGGTATCGTAGCAGAGAAGAACACA
ATGATCTGCGTTAAACATTTAAATGGACGGAAATTGGCTCACGAAATACA
AAACATTCATTTTGTTGTCCGAAATATCGTTCCTCTCGTGTCATCAttga
agGTTGGTTTGGACGTCATAGTGCAACCTGACAATGACGATCAGAAAATG
TATTTGGCTGTCATTAGGGAAGTCACCAAAAAAGAAGGTGACAAAACGAA
CCGTTATCTAGTGGAGTTTACGGATGGATCCAAGAAGAGAGTGACGCCCA
GCCGGATCCGTATACTTTCTCAATACGGAAGTGCAGAAACGAGTGAAGAA
AATGCTGACATTATCACAACAAGACAGGAGGAACTAGTTCTCGATGTGCA
AGGTATCTCATTACGTGTGGAAGGTTACTTGGGAGGCGTGTTGACACCCA
TGCTCAAAATGGATTCCAAAATCACAGCTAACTTGAAGGATTGGTCAAGC
CAAATGAATGCACACGCTACTGTATCATTAGAAGCCAGTTATTATAACGA
AAACGTTGCCGAATGGGAGCCAGTTATTGAACCTTTGATGGAGAAACGGA
GGGAAAGACCGTGGCAACTCTCTGTCAATTACACGATGGAAGGTGACGAC
AATTCTGCTTCATCCACTTCCAACGAACTCGTTTTACAAAAACCGGAATC
CAACCTGAAAATCAAATCTCAAGATAATCTTGAATTGACAATTTCAAAAT
CATGTCTTGCTTTACTCGGTGAATTGGGACAGGTGTTTGGAGATGCAGTA
GAATCTGTGGACGTTTTACCACAAGTCCTGGTCGAAAAAGAACCTTTCAT
GATCGAAAACTTGCTCTCCAAGAAGGTGACAGTAACATTGAATGAACTTC
TGCAGGGACCAAATGGAGATTCGACAATCGAGCTAGCATCTTCTTCGAAT
CCTGTTGGCATTACTTTTGCTCCCAagaaatttgagaaacgaaAGACCAA
CGATCTATACACAATCAATTTAtcgGTGGACGGTTTTCATGACATTAAAG
ACATTGTGGTTCAAAGAAAGCGAAGCGTTATCTATGATCTTGTACCAATA
AAACTATTATCAGCACAGTCTTCATATTCGATAGTGGTACAAGTGAAGAC
AACAGACGGACAACGTATCATCGTACTCCGATCACCATTGCAGTTGAAAA
ATCACTTTCCAATGCCGTTGGATGTCAGCTACATTTCCAAAGAAAACCAA
CCAGTTAAACTGACAACAGTGGGATCGGGAGATATCTATTCCTTCCCTTT
GTTGTTAACCTACCACAGTGTTTTTCATCTCAAACCTGCTGGTTTCGACT
ACGGTGATTGCACAGAAGCTCTCAATTGGAGTGATTTGAAGACGAGCAAC
GAAAAACAGTTCTCCTGCCCTTCACCTGACAAAAGTGCTGACCCTTTCTA
CATGCAGGTGGTGATGAAAGAGGAGACGTACTCTTCCGTACACGGCATGT
TGGACTGTGTACCACGTTACACGTTGGAGTGCTTTCCCGTCATCACGCTG
CATAATTACCTACCTTGCACTATTAATTATAAGATCAAGGGTATGGCGAA
ATCGGAAAGTCTACCAGGCGGACACAATTGGCCTTTGTTTACCGTCAACT
TCAGTGATAAACCTTCCATCTATATCGAGATTGAGTCGTATAACAACCAA
AGATGGGAAGGAGGTTTGACATTACCAACAAAACCGGTAGATTCTTTGAA
CAAACCATCATTATCTTTCGTCATGATGTCTGGTGAACGCAAAATGGAAT
TGGGTGTTTATTACCAGTTAGACGGTTCATTGAACATCACCTTATATTCG
CCTTACTGGCTTCTCAATAAAACTGGAAAACCACTTGTCTATCAGCCAGC
GGGGAGCAGCATCCAGCAAGTTCACCAAGAGAACGATGTAAATGCTCTTA
TGATGCTCGTCAAAGGGAAACATAAAAAGgcgaaagtgaaagtgaaaaat
aGCGAGTCATGGTCAAATGAATTTTCATTGGATACTGTTGGCAGTGGTGG
TTCCTTGAAATGCAATGGTCCAAGAGATCGAGTTTATGAGATTGGTTTGA
ACATCAGTTTGTCATACTTTGGATTGACGAAGATTGTGACGTTCACGCCA
CTCCGAATGTTATCTAACCACACCAAGTACACCATCAGTATGGCAGAAAG
TAATTCTAAATCGTCAGAATGGCACACGGTAAACCCTGACGAGaacattc
catTCTGGCCGACGAAACTTCCTTTGGTCAACCTTTACATTAACATCAAT
GGGCAAGATTCAGTGAAATTCAACCCTGAAGTTGGAAAAACTTTACTGTT
GAAGTTCCAGAATGAGGTTGGAGGAGTTTGCGTGGATTACCAAGAAAAGG
ACTCGTCCTCAGTCCTTTCGTTTAATCCGTACTTCGCAGGTGCAGCTCCT
GTGCGGCttgaaaatctttgcaaaaaGATCGGCATGATCGCTTATAAACA
AGCAGGTTCGGTAATGGGTCACGTGTTAACACATGACCAATCAGTGTTGT
ACACGTGGGATGATCCAACCATGGAACAAGAATTGATTTGTTCCATTGTC
AATGATGAAGCCAGTGAAACAAGGATCAAACTCGATGCCAACGATTTCGG
ACGAATGAGAGTTGGAGATGGTGCAATTTATTGGGTTTCCTTTCTGGATG
GTCTTCAACGTGTTCTATTGTTCACTGATAACTTCAAATCTGCTTACTGC
GCATGTCAGgaGCAAAATTTACGCCCAACCATGGAAGTTGACTTTGAGAT
TGAGAGTTTTGGTTTGTCTCTGGTCAATGTTGATAAGAGAATGGAGATTG
GCTACTTAGCTATCCGACAAAGCAAGACTGTATGGGAGCAACGCAAGAAA
AAGAACCGCTGGAAAGCTTTACCGCTTGCCATGTGTGAAGCTCTCGAAGA
AGGTTATCTCAATTATCAAAACAGAAAAGGTGCAGTCAAAGAGAAAGTTC
TGGATAAGGAGGTGGATTACGAGAAGATGTTTATTACGAAACCTGAGAAG
ATTAAGATCAGAAGAACGTACCACAGCGGTCTTGGTTTCAAATACACAAT
CTCACCCAATGAAATGCGTGTGCATGCTTCTATCAGCTCAATACAGTTGG
ATAGCCATGTTCCAGGTTCGACCTTTCCAACAGTCTTGCATATGGTTGAA
CCACCAAAATCTGTTGCTTCAGAAAACGCTCCAAAGCCATTCTttgaatt
gagtttaatgaCAAGGATCGGTGATAAAAATGTGGTCAATGAAGTcagCT
ATTGTCACGTGTTGATTCAAGAGATGGATGTGAGGGTTGATATTGGATTT
TTATTGGCTCTGATGGAACTCTTCAGTCATGCAAGAGCTCGAACAACCGA
GAAAGAACAATACGCGCTTGATATTGGCCAAGCAGCAACAAAGTTTGAAG
AAAGCGCTGAATTTCAGGCAGCCAAACAAGATCGATATTACGTTTTGAAC
GACTTTCATTTATCACCGCTAAAGATTCACGTCAGTTTCTCTTTGACGGG
TGGTTCCAAAGATGAAAATGCTATTGCTTCATTACATGGTAACGTGTTGA
ACTTGTTGTTACAAAGTGTCGGACTGGCCTTCACTGAAATACAAGACGTA
CAATTCAAATTAGCATGTTACGAAGTGCATAAGTCCATGCAGAGTAATTC
GCAGCTCGGTGATGGAATAACTAAACATTATCAAACACAGGCTATCAAGC
AACTTTATGTGTTGGTACTCGGGCTAGACGTTCTTGGTAATCCGTATGGT
TTGATATCTGGTGTTGGAACCGGAGCAAAGAATTTCTTCTACGAACCTTA
CCAGGGATTAATTCAAGGACCAGAAGAATTTGCGGAAGGATTGGCGTATG
GGGTGAAGAGTCTTGTTGGTGGAACCGTGGGTGGAGTATCAGGAGCTGTG
AGTAAGATTACCGGTACCTTCGGTAAAGGTTTGGCTGCATTGACCTTGGA
TGAAGAATATCAACAAAAGAGACGTGAAAACATGAGCCAACGCCCAACTA
ACCTCGGTGAAGGTCTCGCCAAAGGTGGTAAAGGCCTTGTAAAGGGTATC
GTGTCTGGTGTTACAGGGATCGTTACCAAACCCTATGAAGGTGCCAAGAA
TGATGGTGCAGGTGGCTTTTTTAAGGGCGTTGGAAAAGGCCTGATTGGCG
TGGTTGCACGCCCTGTTGGTGGAGTGGTAGATATGGCCAGTAACACGTTT
GATGGTTTGAAAAGCACGACATCTGGCGTGAAAGCGATCGAGTTGAGCCG
TGTTACTCGCGTCTTCCACGCAGATAAGGTTTTACGACCTTTCAATCTGT
ACGAAGCAGATGGAAACAAAATTCTTATGCAATGTAACAAAGGAGAATAC
GCCAAGAAGAATTTTTATATCACTCATGTAGTGGACAAGAAGAACTATCT
CATCCTCACTCAATCaaacATTTTGTATGTTGGAAAGAACGAGTTGAAAA
TGGGTGAATGGGAATCggtttgggttatcgagttcaATGAGCTAAAACGT
GAACCAGAAGTGAAAGAGACAAAGATTATTTTCCATATCCATAATACGGA
CACGCGACGTTCAATTTTCAAGAAATCGACGAACACACGTGAAGTGATAT
TGGAGTCTAGTGCTGTTGCAGACTGGTTTATCTTAAAGCTTAGAGATGCT
AAAATGTTATAGatggtatttgaaTCTTTGGTTGCTGACCTCTTGAACAA
GTATCTGGGTCAATATGTGAAAAATCTTGATGCTTCTCAATTGAAGATTG
GCATTTGGGGAGGAAATGTTGTCCTGACAGAACTTGAACTGAAAGATACA
GCTCTGGATGATCTTGACTTACCCATAAAAGTTGTTCGTGGATATTTGGg
tAAATTGGTCTTGTCCATCCCATGGAAAAATCTTTACACTGAATCAACTG
TTGTCGATATTCAAGATCTCCACCTTGTCGCTAAGCCTAATTTTGACATC
AAATACAATGAAGAACgcgaagaaaaatcaaaacatgacAAGAAACAACA
ACAGATTCACAATATCGAAGAAGCGAGGCAAAGAGAAGAAGACAAAAAGA
AAGGCGCCAAGAAAGAAGAGAGTGACGGTTTTGCTGAGAAACTTGCAACA
AACGTCATAAAAAATCTACAGGTTACGATCAAGAACATACATGTTCGATA
TGAAGACTCAATCAGTGATGTGAATGGACCCTTTTCAGTCGGTCTTACAA
TGGAAAGTTTAACAGCACAAACCACAGATGAAGATTTTGTTCCAAAGATT
ATCAAAGAATCTGTCTCATTAATTCATAAGatggTGAAATTAGACAATTT
GGCTTTATATTGGAATCCAGGAGACGAACTGATTGATCCTTCACTTGATA
CCAAGCAATGGTTGgaagtTTCAACGAAGCAAATTTCAACACACCAATCG
AAGCCAGAGAAAACGAAATATATTTTGAGTCCCATGGTTGCAACGAAGAA
ATTGAAGCTGAACACCAAACCAGGTTCCAACCTTGACATCCCGAAGatgt
tTTTGAACTTGGTTTTGGAAGAACTTGGTATCATCGTGGCAAGAAGTCAA
TATCATGGCGTGGTGCAACTGATTGAATCATTTGAACGAATGAATAGGAA
CCAACCTTTTCGTAAATACAGACCACATACCTCCGTTCTTGGGAACGAAA
GTATTTGGTGGAAGTACTGCATGTCCAGCATACTGGAGGTGGATGTCAAA
AGACGATCTCAAATGTGGAGCTGGAAGCATATTCAAAAACATCGAGTTCT
TTGCAAAGCTTACAAAGTGAAGTAcaaggaaaaattgaaacagaaaaATC
CATCCAAACAAATTCTCACTGAACTAGAGaGCATGGAGGATGAGTTGAAT
ATTGCAAGCATCACCATTTTTCGACAGCTTGCAGCTACAGAGGTTTTAAC
GGAACAAAAGAAGAAAGGCACTAAAGGAAGTTTCTTCAGTTTCTTCTCCA
GATCAAAAGAACCAGAAAAGTCTGCTGCTAATAAAATTGGAGATTTAATG
GGTGATGACCAGGAGAAGGAAATGCAGAAATTGTATGACGCAATCGGTTA
TACTGAAAATGAAGTCATCACTCCCTTTCCTAAAGAGTACGTGGCGATGT
CAGTGGAATCGATTCTCCAGAAATTATTCATCAGCCTCATCGATGACACA
GATAAGGCGAAAGAATTCAAAGTGTTGGATTTTTCACTCAACAACATCAT
TGTAGAAGTTTTCCAAAGACCTTCTGCTCAAGCTCTCAAATTATGTGCAA
AGATAGGAGAGATGAAGTTATTTGGTACAGCTTCTGCTCAATGTACACCT
CtcatcatcaaaaacatgttaCAAGGTCGAGGTATGGAATTTCTGCCGTT
GGTGGACTTCATCTTTGAGACGAATCCTTTGAAGAAACCGGACATTGACC
AATGTATCACTGCTATTTGTCAACCCTTAGAAATCATCTATGATGCTAAC
ACGATCAACCATATCATTAGTTTCTTCAAACCTCCTGAACATGTTATCTT
GCAAGATTTACAAGACAAAGCGTATTCTACTTTCGAAGATTTTAAAGTTT
CAAGTACGGCTGGTCTTCTACATGCTATGGAACAAAGAACGGTTATGGAC
ATCGACATTGATGTTGGAGCATCTCATTTGATCATCCCTGAAAAAGGTTC
TTACAATGGTTGTACAGATATGCTGGTGATCGACTTTGGTAAAATCACGA
TGAGCAGCGATCCTAGTCAAATCAGACACCTTGACCCTAAGGACATTGAG
GATGTGAATGAAGTACAAAGCAAAGCTTATGATCGATTCTTGTTGTCGCT
TCAAGCTCTTCAAATATTACTCGTTAGAGAAGGTGAAGATTTAAAGAGTG
CTAAAAGCAACGTCAGTAAAGCTTCATCACACATTTTGCATCCCATCAAT
TTCGATGGCAAACTTGCCAAAGCTATACTTCCACAAGATCCACGTTTAAA
ACAGATATGTGTCTCTGGTGAATTATCTTCGCTGTTTGTTTCTGTATCGG
ATGATAAAGTCAGTCGTCTCATCAAGCTAGCAGACTCGATACCACTCCCT
CAATCACCTTCTCACGATAACATCGACGGAGAAGAAAAACCTGAAGGACT
CTTCACCAAGGCGTTGTCAATGATAAGCTTGACAGGTGACAATGACACAG
GGGTGGACATCGGAGGATTTTCCATCCCTGTACCGACATCTCCAACATCA
GTGACGTCAGATGAAGATGAATACGGGACACCACCTGATGGCTCCATATT
ACAGTTACAACAAGAAGCTGGTCCGGACTTTTCATCAGGAGTGGCGAACC
AAGTCAAAGTGGACTTGAACTTTAAAATCCATAAAGTGATGATCGCCATT
GGTTTGACTGACAAAGCATTGAAACAGGAAAAAGAATGTCTGAAATTCAT
CGTGGACGACATCAATACAGAGgtGATACTACGAAGATGGGATTTGTTCG
TCAATGCAGAAGTTGGTCGTCTGGTGTTGAATGAAATGACATGGGGTGTT
GATGGAGAACCTTTCGCCATCATGAGTACacccaaaaacaccaaaatgtt
GAAATTCAGCTATCGGAGGTGTGAATTCAACGAAAGTTTGAATCTCGGTC
CAAGTTACTTTTATTCCAAAGAAGCGCAAGTCAGAGCTTTACATTTCAAA
GATGAATTTGGCGCCACGGATCAGATTTTAGATGTACAAGTGGCTACTTT
ATTTCTGATGCTTCATCAAGAAGCACTTTTGAGCATCATGTCATTGATCT
ACCAAGTACTGGAACCACTCAACAAACATGATAAGGAAGCCACACAGAAG
ATCAAACGGAGTTTGAGTACGGCAGGTAGTCGTTTGAGTCTCTCCatcga
agaaaaagaaaaggagaGACAGATACAACGAAAATTAGCCAACCCTAAAG
CACTGGAAGCTGCCAACGAACTTAAGCAACAGGTTGGcttagaagaagaa
aaaaagatgaGAGTGACCGCCCACCTGGATGGTGTTGGTATCATGATTTG
TTCAGCCAAAGTTGACCTTGCACAAGCCTTCGTTAAAGGGTTATCTGCTA
AAGTACTGATGAAAGATGACTTATTAGAAGTGAAAGCCAGCATGAAAGAT
ATGCAAGTACAAGATAATGTTGGCGAAACAAAGTACAAAGACATCATTAG
CATGCGATCTGATGAAGTGTTCGATTTAGAGTTGGCTATTTACGAGAATG
GATCTTCTGGTAGCAAGCAATACGATATGTCGTGTGTCGACACCAGTGTC
AAACTGAACTTCGGTCAAATGCGCGTTGTTTTCTTGTATAGATTCATACA
AGACTTAATGTCATTCACCGAAAACTTCGAAGAAGCACAGAAAGCAGTTG
TGGAAGCTGGTAAAGCTGCCAAGGATAAAGCTCTGGAAACAGCGACCGAT
TTGAATAGACATTCTTCTCGTGTCAAACTAAATGTGGTTCTGAAAGCACC
GACTATTATCATTCCAGTTGGATCAAACAATGAATTGGCTTTACTGGTGG
ATCTGGGTGAATTGCGTATTTACAACACATTCAAACTCCTCAACGATGAT
CAATACCATAAGAAATCTATCATCACTGATAACATGACCATTAAGTTATC
CAATCTGAAATTGTTAAAAGCACTTATTCAAGATGGTAAAGATTTCTTGC
ATCAACGAGCCATTATTGAACCTATGATGCTACAAATAACTATTGTTCGT
AATTTAACGAAAGGTAACCATTCCATACCGGATGTTTCAGTTCAAGCAAA
GATGCCAGCTATTCTGTTATCAATCAGTGAAGAAGATGTGACCGTAGCTC
TAAAGATTGTCCAAGGGAATCTCGCCGAAGGTGAGTCACATGCGCCGAAG
AAGCAAGCCAAGCCTGCCAAACAAACGTTAAACGTGCCACAAGATCGTTT
AGCAGACATTTACGAGGAGcctgaagatgaagatgagaaTCGACAAGGAT
ATCTTCAAACCAAACTATCCTTCGATCTGGCTAAAATTGACATCAAGCTT
TACTTGAAACCATCTGATATGACATTTGAAGATGAATTTTTAGCGAGGAC
GGATGATTTGTTGTTAGCTTTGTTCACTATTGGTAACCTGTGTGTTGATG
GAGACATCATGTCCACGCAAGCTATGAAGATGAGCGTTCGATTGGACACT
TTGGTGTTGGATGATATGAGACCTATCGAGGAGCATGAAGGTGTTAAACG
TATGATCAACTACAGTCCCGAGCCACTCCTTGAAGAAGTCAAAACCTCTT
CTCATAAACGACCAATCGACAACTCACGAATGATCGAAATCCAAttcgat
caaacttcatcgcaagataaaaatatcgacATCAAACTTTGTAACATGCT
TTGTATATTCAACGTTGAGTTTATCATGGTCCTGTTGAAAACGTTGCAAG
CTGCCATACCTAAAGATGATAGTCTGCAACATGGCCATTCAATGAGTAGT
CTAGACTCGGCGGCAGGGTCTGGCGGCAGCGATGACGAGGACTCTTTAGA
AGCCAGCGAGATTGTCCTCTGCACTGGTGATCAAGAAAGACCTGAGACTA
AAGTCTCTATCTTCGTCCATAACCCGCAAATTGTTTTACTAGCAGATGCA
AAGGATGTCAAAACAAATGCACTCTTTCTTACAACCGagatcaattttca
atatttcgaaTTGCGAGATACTCAAAAAATGATTGGCGCTGTTTCTAACA
CCGCTATTTTGTCAACTGCTTTCAAGAATGACCATCGGAGTGATATATCA
ACAGTGTTGTCATTAGATTCCATCAATCTCCACTCGTCATCACCCATCAA
TGGTAAACCTCATATGAGTGTCAGCACAACTTTGATCAAACTGAATATCT
CACCCAAAACCATCCGAACTTTATCAGCGTGTGCTGGTTACATCTCCAAT
GATCCAACAGATGAAGAAATCAAAGAAGCTCGAAAAGCCATGCGTGATTT
ATGGCAAATTCAAACGTTCACCAATAAGCGACCGTGGTATTTAAACCACC
CACCACAACAAGTCTTAAGTGCTGGCAGCTTCGTCCTTGCGCGAACGAGA
ACAGGAGAATATAAGCATGGTTTCTTAGCTAAAAAGGATGTCTCGTATCA
AGTCTATTTTTCAGAGGAGCGAGGAACAGCCAGTCACCGAGCCATGGATA
TCTCATCTGTTGTTTTGGATATCGTACCGCTGATCGGTGATCTATGTGTT
GGATGTAATGTTTTAGCTGTGGAATCGAAAGAACATGGATATCGTACTGG
TCGAATTACTCAGGTTTGGGATTCGAATGTGGATAAAGATTCTTCGGATG
GCGCCAAACAATCTGTTTCTGTCAAGACAACTGCTATTGCTCCAATCAAA
TACCTTGTCAATTTCTATGACAACCAAACGGAGAACTTCTTCCCGCCTGA
TGAACTTCGTATCATTGGTAAACCCATCAAGGGGGTTGTCCCTGGACTAG
GGGCGTGTGTTTACGCCCGCTTTAATGATGGTTTTTACTATCGGGGCAAA
GTTGATGACATCGAGGATTATCGAATCCGAGTGCAATTGGATGAGATCAG
TGGAGAAATCGAACACGACATCGATGATCCGTCAGCCGTTATTTTGAACC
TGACGCCTCAATACCGTCAAGTCAAAAAGCATTTCAAAGTCATTGCATCC
AAAGGAAGCACAACTAAAGGATATCATCCGGGGAAAGTGACCGCCATCCA
AGGTGAAGGAAATAACCGATTGTATTCGATACGCTTCGAAGACGGTACAA
TTAACCAAGTACCCATCacgaaattgattttgatgccAAAAGCACCTTTT
GATGCTTTACCTGAAGTTGGCACATACGTTTATTCCCGAGTGTCACGCGA
CGCTCCTTTATACGAGAAGGGTATCGTAGCAGAGAAGAACACAATGATCT
GCGTTAAACATTTAAATGGACGGAAATTGGCTCACGAAATACAAAACATT
CATTTTGTTGTCCGAAATATCGTTCCTCTCGTGTCATCAttgaagGTTGG
TTTGGACGTCATAGTGCAACCTGACAATGACGATCAGAAAATGTATTTGG
CTGTCATTAGGGAAGTCACCAAAAAAGAAGGTGACAAAACGAACCGTTAT
CTAGTGGAGTTTACGGATGGATCCAAGAAGAGAGTGACGCCCAGCCGGAT
CCGTATACTTTCTCAATACGGAAGTGCAGAAACGAGTGAAGAAAATGCTG
ACATTATCACAACAAGACAGGAGGAACTAGTTCTCGATGTGCAAGGTATC
TCATTACGTGTGGAAGGTTACTTGGGAGGCGTGTTGACACCCATGCTCAA
AATGGATTCCAAAATCACAGCTAACTTGAAGGATTGGTCAAGCCAAATGA
ATGCACACGCTACTGTATCATTAGAAGCCAGTTATTATAACGAAAACGTT
GCCGAATGGGAGCCAGTTATTGAACCTTTGATGGAGAAACGGAGGGAAAG
ACCGTGGCAACTCTCTGTCAATTACACGATGGAAGGTGACGACAATTCTG
CTTCATCCACTTCCAACGAACTCGTTTTACAAAAACCGGAATCCAACCTG
AAAATCAAATCTCAAGATAATCTTGAATTGACAATTTCAAAATCATGTCT
TGCTTTACTCGGTGAATTGGGACAGGTGTTTGGAGATGCAGTAGAATCTG
TGGACGTTTTACCACAAGTCCTGGTCGAAAAAGAACCTTTCATGATCGAA
AACTTGCTCTCCAAGAAGGTGACAGTAACATTGAATGAACTTCTGCAGGG
ACCAAATGGAGATTCGACAATCGAGCTAGCATCTTCTTCGAATCCTGTTG
GCATTACTTTTGCTCCCAagaaatttgagaaacgaaAGACCAACGATCTA
TACACAATCAATTTAtcgGTGGACGGTTTTCATGACATTAAAGACATTGT
GGTTCAAAGAAAGCGAAGCGTTATCTATGATCTTGTACCAATAAAACTAT
TATCAGCACAGTCTTCATATTCGATAGTGGTACAAGTGAAGACAACAGAC
GGACAACGTATCATCGTACTCCGATCACCATTGCAGTTGAAAAATCACTT
TCCAATGCCGTTGGATGTCAGCTACATTTCCAAAGAAAACCAACCAGTTA
AACTGACAACAGTGGGATCGGGAGATATCTATTCCTTCCCTTTGTTGTTA
ACCTACCACAGTGTTTTTCATCTCAAACCTGCTGGTTTCGACTACGGTGA
TTGCACAGAAGCTCTCAATTGGAGTGATTTGAAGACGAGCAACGAAAAAC
AGTTCTCCTGCCCTTCACCTGACAAAAGTGCTGACCCTTTCTACATGCAG
GTGGTGATGAAAGAGGAGACGTACTCTTCCGTACACGGCATGTTGGACTG
TGTACCACGTTACACGTTGGAGTGCTTTCCCGTCATCACGCTGCATAATT
ACCTACCTTGCACTATTAATTATAAGATCAAGGGTATGGCGAAATCGGAA
AGTCTACCAGGCGGACACAATTGGCCTTTGTTTACCGTCAACTTCAGTGA
TAAACCTTCCATCTATATCGAGATTGAGTCGTATAACAACCAAAGATGGG
AAGGAGGTTTGACATTACCAACAAAACCGGTAGATTCTTTGAACAAACCA
TCATTATCTTTCGTCATGATGTCTGGTGAACGCAAAATGGAATTGGGTGT
TTATTACCAGTTAGACGGTTCATTGAACATCACCTTATATTCGCCTTACT
GGCTTCTCAATAAAACTGGAAAACCACTTGTCTATCAGCCAGCGGGGAGC
AGCATCCAGCAAGTTCACCAAGAGAACGATGTAAATGCTCTTATGATGCT
CGTCAAAGGGAAACATAAAAAGgcgaaagtgaaagtgaaaaataGCGAGT
CATGGTCAAATGAATTTTCATTGGATACTGTTGGCAGTGGTGGTTCCTTG
AAATGCAATGGTCCAAGAGATCGAGTTTATGAGATTGGTTTGAACATCAG
TTTGTCATACTTTGGATTGACGAAGATTGTGACGTTCACGCCACTCCGAA
TGTTATCTAACCACACCAAGTACACCATCAGTATGGCAGAAAGTAATTCT
AAATCGTCAGAATGGCACACGGTAAACCCTGACGAGaacattccatTCTG
GCCGACGAAACTTCCTTTGGTCAACCTTTACATTAACATCAATGGGCAAG
ATTCAGTGAAATTCAACCCTGAAGTTGGAAAAACTTTACTGTTGAAGTTC
CAGAATGAGGTTGGAGGAGTTTGCGTGGATTACCAAGAAAAGGACTCGTC
CTCAGTCCTTTCGTTTAATCCGTACTTCGCAGGTGCAGCTCCTGTGCGGC
ttgaaaatctttgcaaaaaGATCGGCATGATCGCTTATAAACAAGCAGGT
TCGGTAATGGGTCACGTGTTAACACATGACCAATCAGTGTTGTACACGTG
GGATGATCCAACCATGGAACAAGAATTGATTTGTTCCATTGTCAATGATG
AAGCCAGTGAAACAAGGATCAAACTCGATGCCAACGATTTCGGACGAATG
AGAGTTGGAGATGGTGCAATTTATTGGGTTTCCTTTCTGGATGGTCTTCA
ACGTGTTCTATTGTTCACTGATAACTTCAAATCTGCTTACTGCGCATGTC
AGgaGCAAAATTTACGCCCAACCATGGAAGTTGACTTTGAGATTGAGAGT
TTTGGTTTGTCTCTGGTCAATGTTGATAAGAGAATGGAGATTGGCTACTT
AGCTATCCGACAAAGCAAGACTGTATGGGAGCAACGCAAGAAAAAGAACC
GCTGGAAAGCTTTACCGCTTGCCATGTGTGAAGCTCTCGAAGAAGGTTAT
CTCAATTATCAAAACAGAAAAGGTGCAGTCAAAGAGAAAGTTCTGGATAA
GGAGGTGGATTACGAGAAGATGTTTATTACGAAACCTGAGAAGATTAAGA
TCAGAAGAACGTACCACAGCGGTCTTGGTTTCAAATACACAATCTCACCC
AATGAAATGCGTGTGCATGCTTCTATCAGCTCAATACAGTTGGATAGCCA
TGTTCCAGGTTCGACCTTTCCAACAGTCTTGCATATGGTTGAACCACCAA
AATCTGTTGCTTCAGAAAACGCTCCAAAGCCATTCTttgaattgagttta
atgaCAAGGATCGGTGATAAAAATGTGGTCAATGAAGTcagCTATTGTCA
CGTGTTGATTCAAGAGATGGATGTGAGGGTTGATATTGGATTTTTATTGG
CTCTGATGGAACTCTTCAGTCATGCAAGAGCTCGAACAACCGAGAAAGAA
CAATACGCGCTTGATATTGGCCAAGCAGCAACAAAGTTTGAAGAAAGCGC
TGAATTTCAGGCAGCCAAACAAGATCGATATTACGTTTTGAACGACTTTC
ATTTATCACCGCTAAAGATTCACGTCAGTTTCTCTTTGACGGGTGGTTCC
AAAGATGAAAATGCTATTGCTTCATTACATGGTAACGTGTTGAACTTGTT
GTTACAAAGTGTCGGACTGGCCTTCACTGAAATACAAGACGTACAATTCA
AATTAGCATGTTACGAAGTGCATAAGTCCATGCAGAGTAATTCGCAGCTC
GGTGATGGAATAACTAAACATTATCAAACACAGGCTATCAAGCAACTTTA
TGTGTTGGTACTCGGGCTAGACGTTCTTGGTAATCCGTATGGTTTGATAT
CTGGTGTTGGAACCGGAGCAAAGAATTTCTTCTACGAACCTTACCAGGGA
TTAATTCAAGGACCAGAAGAATTTGCGGAAGGATTGGCGTATGGGGTGAA
GAGTCTTGTTGGTGGAACCGTGGGTGGAGTATCAGGAGCTGTGAGTAAGA
TTACCGGTACCTTCGGTAAAGGTTTGGCTGCATTGACCTTGGATGAAGAA
TATCAACAAAAGAGACGTGAAAACATGAGCCAACGCCCAACTAACCTCGG
TGAAGGTCTCGCCAAAGGTGGTAAAGGCCTTGTAAAGGGTATCGTGTCTG
GTGTTACAGGGATCGTTACCAAACCCTATGAAGGTGCCAAGAATGATGGT
GCAGGTGGCTTTTTTAAGGGCGTTGGAAAAGGCCTGATTGGCGTGGTTGC
ACGCCCTGTTGGTGGAGTGGTAGATATGGCCAGTAACACGTTTGATGGTT
TGAAAAGCACGACATCTGGCGTGAAAGCGATCGAGTTGAGCCGTGTTACT
CGCGTCTTCCACGCAGATAAGGTTTTACGACCTTTCAATCTGTACGAAGC
AGATGGAAACAAAATTCTTATGCAATGTAACAAAGGAGAATACGCCAAGA
AGAATTTTTATATCACTCATGTAGTGGACAAGAAGAACTATCTCATCCTC
ACTCAATCaaacATTTTGTATGTTGGAAAGAACGAGTTGAAAATGGGTGA
ATGGGAATCggtttgggttatcgagttcaATGAGCTAAAACGTGAACCAG
AAGTGAAAGAGACAAAGATTATTTTCCATATCCATAATACGGACACGCGA
CGTTCAATTTTCAAGAAATCGACGAACACACGTGAAGTGATATTGGAGTC
TAGTGCTGTTGCAGACTGGTTTATCTTAAAGCTTAGAGATGCTAAAATGT
TATAGatggtatttgaaTCTTTGGTTGCTGACCTCTTGAACAAGTATCTG
GGTCAATATGTGAAAAATCTTGATGCTTCTCAATTGAAGATTGGCATTTG
GGGAGGAAATGTTGTCCTGACAGAACTTGAACTGAAAGATACAGCTCTGG
ATGATCTTGACTTACCCATAAAAGTTGTTCGTGGATATTTGGgtAAATTG
GTCTTGTCCATCCCATGGAAAAATCTTTACACTGAATCAACTGTTGTCGA
TATTCAAGATCTCCACCTTGTCGCTAAGCCTAATTTTGACATCAAATACA
ATGAAGAACgcgaagaaaaatcaaaacatgacAAGAAACAACAACAGATT
CACAATATCGAAGAAGCGAGGCAAAGAGAAGAAGACAAAAAGAAAGGCGC
CAAGAAAGAAGAGAGTGACGGTTTTGCTGAGAAACTTGCAACAAACGTCA
TAAAAAATCTACAGGTTACGATCAAGAACATACATGTTCGATATGAAGAC
TCAATCAGTGATGTGAATGGACCCTTTTCAGTCGGTCTTACAATGGAAAG
TTTAACAGCACAAACCACAGATGAAGATTTTGTTCCAAAGATTATCAAAG
AATCTGTCTCATTAATTCATAAGatggTGAAATTAGACAATTTGGCTTTA
TATTGGAATCCAGGAGACGAACTGATTGATCCTTCACTTGATACCAAGCA
ATGGTTGgaagtTTCAACGAAGCAAATTTCAACACACCAATCGAAGCCAG
AGAAAACGAAATATATTTTGAGTCCCATGGTTGCAACGAAGAAATTGAAG
CTGAACACCAAACCAGGTTCCAACCTTGACATCCCGAAGatgttTTTGAA
CTTGGTTTTGGAAGAACTTGGTATCATCGTGGCAAGAAGTCAATATCATG
GCGTGGTGCAACTGATTGAATCATTTGAACGAATGAATAGGAACCAACCT
TTTCGTAAATACAGACCACATACCTCCGTTCTTGGGAACGAAAGTATTTG
GTGGAAGTACTGCATGTCCAGCATACTGGAGGTGGATGTCAAAAGACGAT
CTCAAATGTGGAGCTGGAAGCATATTCAAAAACATCGAGTTCTTTGCAAA
GCTTACAAAGTGAAGTAcaaggaaaaattgaaacagaaaaATCCATCCAA
ACAAATTCTCACTGAACTAGAGaGCATGGAGGATGAGTTGAATATTGCAA
GCATCACCATTTTTCGACAGCTTGCAGCTACAGAGGTTTTAACGGAACAA
AAGAAGAAAGGCACTAAAGGAAGTTTCTTCAGTTTCTTCTCCAGATCAAA
AGAACCAGAAAAGTCTGCTGCTAATAAAATTGGAGATTTAATGGGTGATG
ACCAGGAGAAGGAAATGCAGAAATTGTATGACGCAATCGGTTATACTGAA
AATGAAGTCATCACTCCCTTTCCTAAAGAGTACGTGGCGATGTCAGTGGA
ATCGATTCTCCAGAAATTATTCATCAGCCTCATCGATGACACAGATAAGG
CGAAAGAATTCAAAGTGTTGGATTTTTCACTCAACAACATCATTGTAGAA
GTTTTCCAAAGACCTTCTGCTCAAGCTCTCAAATTATGTGCAAAGATAGG
AGAGATGAAGTTATTTGGTACAGCTTCTGCTCAATGTACACCTCtcatca
tcaaaaacatgttaCAAGGTCGAGGTATGGAATTTCTGCCGTTGGTGGAC
TTCATCTTTGAGACGAATCCTTTGAAGAAACCGGACATTGACCAATGTAT
CACTGCTATTTGTCAACCCTTAGAAATCATCTATGATGCTAACACGATCA
ACCATATCATTAGTTTCTTCAAACCTCCTGAACATGTTATCTTGCAAGAT
TTACAAGACAAAGCGTATTCTACTTTCGAAGATTTTAAAGTTTCAAGTAC
GGCTGGTCTTCTACATGCTATGGAACAAAGAACGGTTATGGACATCGACA
TTGATGTTGGAGCATCTCATTTGATCATCCCTGAAAAAGGTTCTTACAAT
GGTTGTACAGATATGCTGGTGATCGACTTTGGTAAAATCACGATGAGCAG
CGATCCTAGTCAAATCAGACACCTTGACCCTAAGGACATTGAGGATGTGA
ATGAAGTACAAAGCAAAGCTTATGATCGATTCTTGTTGTCGCTTCAAGCT
CTTCAAATATTACTCGTTAGAGAAGGTGAAGATTTAAAGAGTGCTAAAAG
CAACGTCAGTAAAGCTTCATCACACATTTTGCATCCCATCAATTTCGATG
GCAAACTTGCCAAAGCTATACTTCCACAAGATCCACGTTTAAAACAGATA
TGTGTCTCTGGTGAATTATCTTCGCTGTTTGTTTCTGTATCGGATGATAA
AGTCAGTCGTCTCATCAAGCTAGCAGACTCGATACCACTCCCTCAATCAC
CTTCTCACGATAACATCGACGGAGAAGAAAAACCTGAAGGACTCTTCACC
AAGGCGTTGTCAATGATAAGCTTGACAGGTGACAATGACACAGGGGTGGA
CATCGGAGGATTTTCCATCCCTGTACCGACATCTCCAACATCAGTGACGT
CAGATGAAGATGAATACGGGACACCACCTGATGGCTCCATATTACAGTTA
CAACAAGAAGCTGGTCCGGACTTTTCATCAGGAGTGGCGAACCAAGTCAA
AGTGGACTTGAACTTTAAAATCCATAAAGTGATGATCGCCATTGGTTTGA
CTGACAAAGCATTGAAACAGGAAAAAGAATGTCTGAAATTCATCGTGGAC
GACATCAATACAGAGgtGATACTACGAAGATGGGATTTGTTCGTCAATGC
AGAAGTTGGTCGTCTGGTGTTGAATGAAATGACATGGGGTGTTGATGGAG
AACCTTTCGCCATCATGAGTACacccaaaaacaccaaaatgttGAAATTC
AGCTATCGGAGGTGTGAATTCAACGAAAGTTTGAATCTCGGTCCAAGTTA
CTTTTATTCCAAAGAAGCGCAAGTCAGAGCTTTACATTTCAAAGATGAAT
TTGGCGCCACGGATCAGATTTTAGATGTACAAGTGGCTACTTTATTTCTG
ATGCTTCATCAAGAAGCACTTTTGAGCATCATGTCATTGATCTACCAAGT
ACTGGAACCACTCAACAAACATGATAAGGAAGCCACACAGAAGATCAAAC
GGAGTTTGAGTACGGCAGGTAGTCGTTTGAGTCTCTCCatcgaagaaaaa
gaaaaggagaGACAGATACAACGAAAATTAGCCAACCCTAAAGCACTGGA
AGCTGCCAACGAACTTAAGCAACAGGTTGGcttagaagaagaaaaaaaga
tgaGAGTGACCGCCCACCTGGATGGTGTTGGTATCATGATTTGTTCAGCC
AAAGTTGACCTTGCACAAGCCTTCGTTAAAGGGTTATCTGCTAAAGTACT
GATGAAAGATGACTTATTAGAAGTGAAAGCCAGCATGAAAGATATGCAAG
TACAAGATAATGTTGGCGAAACAAAGTACAAAGACATCATTAGCATGCGA
TCTGATGAAGTGTTCGATTTAGAGTTGGCTATTTACGAGAATGGATCTTC
TGGTAGCAAGCAATACGATATGTCGTGTGTCGACACCAGTGTCAAACTGA
ACTTCGGTCAAATGCGCGTTGTTTTCTTGTATAGATTCATACAAGACTTA
ATGTCATTCACCGAAAACTTCGAAGAAGCACAGAAAGCAGTTGTGGAAGC
TGGTAAAGCTGCCAAGGATAAAGCTCTGGAAACAGCGACCGATTTGAATA
GACATTCTTCTCGTGTCAAACTAAATGTGGTTCTGAAAGCACCGACTATT
ATCATTCCAGTTGGATCAAACAATGAATTGGCTTTACTGGTGGATCTGGG
TGAATTGCGTATTTACAACACATTCAAACTCCTCAACGATGATCAATACC
ATAAGAAATCTATCATCACTGATAACATGACCATTAAGTTATCCAATCTG
AAATTGTTAAAAGCACTTATTCAAGATGGTAAAGATTTCTTGCATCAACG
AGCCATTATTGAACCTATGATGCTACAAATAACTATTGTTCGTAATTTAA
CGAAAGGTAACCATTCCATACCGGATGTTTCAGTTCAAGCAAAGATGCCA
GCTATTCTGTTATCAATCAGTGAAGAAGATGTGACCGTAGCTCTAAAGAT
TGTCCAAGGGAATCTCGCCGAAGGTGAGTCACATGCGCCGAAGAAGCAAG
CCAAGCCTGCCAAACAAACGTTAAACGTGCCACAAGATCGTTTAGCAGAC
ATTTACGAGGAGcctgaagatgaagatgagaaTCGACAAGGATATCTTCA
AACCAAACTATCCTTCGATCTGGCTAAAATTGACATCAAGCTTTACTTGA
AACCATCTGATATGACATTTGAAGATGAATTTTTAGCGAGGACGGATGAT
TTGTTGTTAGCTTTGTTCACTATTGGTAACCTGTGTGTTGATGGAGACAT
CATGTCCACGCAAGCTATGAAGATGAGCGTTCGATTGGACACTTTGGTGT
TGGATGATATGAGACCTATCGAGGAGCATGAAGGTGTTAAACGTATGATC
AACTACAGTCCCGAGCCACTCCTTGAAGAAGTCAAAACCTCTTCTCATAA
ACGACCAATCGACAACTCACGAATGATCGAAATCCAAttcgatcaaactt
catcgcaagataaaaatatcgacATCAAACTTTGTAACATGCTTTGTATA
TTCAACGTTGAGTTTATCATGGTCCTGTTGAAAACGTTGCAAGCTGCCAT
ACCTAAAGATGATAGTCTGCAACATGGCCATTCAATGAGTAGTCTAGACT
CGGCGGCAGGGTCTGGCGGCAGCGATGACGAGGACTCTTTAGAAGCCAGC
GAGATTGTCCTCTGCACTGGTGATCAAGAAAGACCTGAGACTAAAGTCTC
TATCTTCGTCCATAACCCGCAAATTGTTTTACTAGCAGATGCAAAGGATG
TCAAAACAAATGCACTCTTTCTTACAACCGagatcaattttcaatatttc
gaaTTGCGAGATACTCAAAAAATGATTGGCGCTGTTTCTAACACCGCTAT
TTTGTCAACTGCTTTCAAGAATGACCATCGGAGTGATATATCAACAGTGT
TGTCATTAGATTCCATCAATCTCCACTCGTCATCACCCATCAATGGTAAA
CCTCATATGAGTGTCAGCACAACTTTGATCAAACTGAATATCTCACCCAA
AACCATCCGAACTTTATCAGCGTGTGCTGGTTACATCTCCAATGATCCAA
CAGATGAAGAAATCAAAGAAGCTCGAAAAGCCATGCGTGATTTATGGCAA
ATTCAAACGTTCACCAATAAGCGACCGTGGTATTTAAACCACCCACCACA
ACAAGTCTTAAGTGCTGGCAGCTTCGTCCTTGCGCGAACGAGAACAGGAG
AATATAAGCATGGTTTCTTAGCTAAAAAGGATGTCTCGTATCAAGTCTAT
TTTTCAGAGGAGCGAGGAACAGCCAGTCACCGAGCCATGGATATCTCATC
TGTTGTTTTGGATATCGTACCGCTGATCGGTGATCTATGTGTTGGATGTA
ATGTTTTAGCTGTGGAATCGAAAGAACATGGATATCGTACTGGTCGAATT
ACTCAGGTTTGGGATTCGAATGTGGATAAAGATTCTTCGGATGGCGCCAA
ACAATCTGTTTCTGTCAAGACAACTGCTATTGCTCCAATCAAATACCTTG
TCAATTTCTATGACAACCAAACGGAGAACTTCTTCCCGCCTGATGAACTT
CGTATCATTGGTAAACCCATCAAGGGGGTTGTCCCTGGACTAGGGGCGTG
TGTTTACGCCCGCTTTAATGATGGTTTTTACTATCGGGGCAAAGTTGATG
ACATCGAGGATTATCGAATCCGAGTGCAATTGGATGAGATCAGTGGAGAA
ATCGAACACGACATCGATGATCCGTCAGCCGTTATTTTGAACCTGACGCC
TCAATACCGTCAAGTCAAAAAGCATTTCAAAGTCATTGCATCCAAAGGAA
GCACAACTAAAGGATATCATCCGGGGAAAGTGACCGCCATCCAAGGTGAA
GGAAATAACCGATTGTATTCGATACGCTTCGAAGACGGTACAATTAACCA
AGTACCCATCacgaaattgattttgatgccAAAAGCACCTTTTGATGCTT
TACCTGAAGTTGGCACATACGTTTATTCCCGAGTGTCACGCGACGCTCCT
TTATACGAGAAGGGTATCGTAGCAGAGAAGAACACAATGATCTGCGTTAA
ACATTTAAATGGACGGAAATTGGCTCACGAAATACAAAACATTCATTTTG
TTGTCCGAAATATCGTTCCTCTCGTGTCATCAttgaagGTTGGTTTGGAC
GTCATAGTGCAACCTGACAATGACGATCAGAAAATGTATTTGGCTGTCAT
TAGGGAAGTCACCAAAAAAGAAGGTGACAAAACGAACCGTTATCTAGTGG
AGTTTACGGATGGATCCAAGAAGAGAGTGACGCCCAGCCGGATCCGTATA
CTTTCTCAATACGGAAGTGCAGAAACGAGTGAAGAAAATGCTGACATTAT
CACAACAAGACAGGAGGAACTAGTTCTCGATGTGCAAGGTATCTCATTAC
GTGTGGAAGGTTACTTGGGAGGCGTGTTGACACCCATGCTCAAAATGGAT
TCCAAAATCACAGCTAACTTGAAGGATTGGTCAAGCCAAATGAATGCACA
CGCTACTGTATCATTAGAAGCCAGTTATTATAACGAAAACGTTGCCGAAT
GGGAGCCAGTTATTGAACCTTTGATGGAGAAACGGAGGGAAAGACCGTGG
CAACTCTCTGTCAATTACACGATGGAAGGTGACGACAATTCTGCTTCATC
CACTTCCAACGAACTCGTTTTACAAAAACCGGAATCCAACCTGAAAATCA
AATCTCAAGATAATCTTGAATTGACAATTTCAAAATCATGTCTTGCTTTA
CTCGGTGAATTGGGACAGGTGTTTGGAGATGCAGTAGAATCTGTGGACGT
TTTACCACAAGTCCTGGTCGAAAAAGAACCTTTCATGATCGAAAACTTGC
TCTCCAAGAAGGTGACAGTAACATTGAATGAACTTCTGCAGGGACCAAAT
GGAGATTCGACAATCGAGCTAGCATCTTCTTCGAATCCTGTTGGCATTAC
TTTTGCTCCCAagaaatttgagaaacgaaAGACCAACGATCTATACACAA
TCAATTTAtcgGTGGACGGTTTTCATGACATTAAAGACATTGTGGTTCAA
AGAAAGCGAAGCGTTATCTATGATCTTGTACCAATAAAACTATTATCAGC
ACAGTCTTCATATTCGATAGTGGTACAAGTGAAGACAACAGACGGACAAC
GTATCATCGTACTCCGATCACCATTGCAGTTGAAAAATCACTTTCCAATG
CCGTTGGATGTCAGCTACATTTCCAAAGAAAACCAACCAGTTAAACTGAC
AACAGTGGGATCGGGAGATATCTATTCCTTCCCTTTGTTGTTAACCTACC
ACAGTGTTTTTCATCTCAAACCTGCTGGTTTCGACTACGGTGATTGCACA
GAAGCTCTCAATTGGAGTGATTTGAAGACGAGCAACGAAAAACAGTTCTC
CTGCCCTTCACCTGACAAAAGTGCTGACCCTTTCTACATGCAGGTGGTGA
TGAAAGAGGAGACGTACTCTTCCGTACACGGCATGTTGGACTGTGTACCA
CGTTACACGTTGGAGTGCTTTCCCGTCATCACGCTGCATAATTACCTACC
TTGCACTATTAATTATAAGATCAAGGGTATGGCGAAATCGGAAAGTCTAC
CAGGCGGACACAATTGGCCTTTGTTTACCGTCAACTTCAGTGATAAACCT
TCCATCTATATCGAGATTGAGTCGTATAACAACCAAAGATGGGAAGGAGG
TTTGACATTACCAACAAAACCGGTAGATTCTTTGAACAAACCATCATTAT
CTTTCGTCATGATGTCTGGTGAACGCAAAATGGAATTGGGTGTTTATTAC
CAGTTAGACGGTTCATTGAACATCACCTTATATTCGCCTTACTGGCTTCT
CAATAAAACTGGAAAACCACTTGTCTATCAGCCAGCGGGGAGCAGCATCC
AGCAAGTTCACCAAGAGAACGATGTAAATGCTCTTATGATGCTCGTCAAA
GGGAAACATAAAAAGgcgaaagtgaaagtgaaaaataGCGAGTCATGGTC
AAATGAATTTTCATTGGATACTGTTGGCAGTGGTGGTTCCTTGAAATGCA
ATGGTCCAAGAGATCGAGTTTATGAGATTGGTTTGAACATCAGTTTGTCA
TACTTTGGATTGACGAAGATTGTGACGTTCACGCCACTCCGAATGTTATC
TAACCACACCAAGTACACCATCAGTATGGCAGAAAGTAATTCTAAATCGT
CAGAATGGCACACGGTAAACCCTGACGAGaacattccatTCTGGCCGACG
AAACTTCCTTTGGTCAACCTTTACATTAACATCAATGGGCAAGATTCAGT
GAAATTCAACCCTGAAGTTGGAAAAACTTTACTGTTGAAGTTCCAGAATG
AGGTTGGAGGAGTTTGCGTGGATTACCAAGAAAAGGACTCGTCCTCAGTC
CTTTCGTTTAATCCGTACTTCGCAGGTGCAGCTCCTGTGCGGCttgaaaa
tctttgcaaaaaGATCGGCATGATCGCTTATAAACAAGCAGGTTCGGTAA
TGGGTCACGTGTTAACACATGACCAATCAGTGTTGTACACGTGGGATGAT
CCAACCATGGAACAAGAATTGATTTGTTCCATTGTCAATGATGAAGCCAG
TGAAACAAGGATCAAACTCGATGCCAACGATTTCGGACGAATGAGAGTTG
GAGATGGTGCAATTTATTGGGTTTCCTTTCTGGATGGTCTTCAACGTGTT
CTATTGTTCACTGATAACTTCAAATCTGCTTACTGCGCATGTCAGgaGCA
AAATTTACGCCCAACCATGGAAGTTGACTTTGAGATTGAGAGTTTTGGTT
TGTCTCTGGTCAATGTTGATAAGAGAATGGAGATTGGCTACTTAGCTATC
CGACAAAGCAAGACTGTATGGGAGCAACGCAAGAAAAAGAACCGCTGGAA
AGCTTTACCGCTTGCCATGTGTGAAGCTCTCGAAGAAGGTTATCTCAATT
ATCAAAACAGAAAAGGTGCAGTCAAAGAGAAAGTTCTGGATAAGGAGGTG
GATTACGAGAAGATGTTTATTACGAAACCTGAGAAGATTAAGATCAGAAG
AACGTACCACAGCGGTCTTGGTTTCAAATACACAATCTCACCCAATGAAA
TGCGTGTGCATGCTTCTATCAGCTCAATACAGTTGGATAGCCATGTTCCA
GGTTCGACCTTTCCAACAGTCTTGCATATGGTTGAACCACCAAAATCTGT
TGCTTCAGAAAACGCTCCAAAGCCATTCTttgaattgagtttaatgaCAA
GGATCGGTGATAAAAATGTGGTCAATGAAGTcagCTATTGTCACGTGTTG
ATTCAAGAGATGGATGTGAGGGTTGATATTGGATTTTTATTGGCTCTGAT
GGAACTCTTCAGTCATGCAAGAGCTCGAACAACCGAGAAAGAACAATACG
CGCTTGATATTGGCCAAGCAGCAACAAAGTTTGAAGAAAGCGCTGAATTT
CAGGCAGCCAAACAAGATCGATATTACGTTTTGAACGACTTTCATTTATC
ACCGCTAAAGATTCACGTCAGTTTCTCTTTGACGGGTGGTTCCAAAGATG
AAAATGCTATTGCTTCATTACATGGTAACGTGTTGAACTTGTTGTTACAA
AGTGTCGGACTGGCCTTCACTGAAATACAAGACGTACAATTCAAATTAGC
ATGTTACGAAGTGCATAAGTCCATGCAGAGTAATTCGCAGCTCGGTGATG
GAATAACTAAACATTATCAAACACAGGCTATCAAGCAACTTTATGTGTTG
GTACTCGGGCTAGACGTTCTTGGTAATCCGTATGGTTTGATATCTGGTGT
TGGAACCGGAGCAAAGAATTTCTTCTACGAACCTTACCAGGGATTAATTC
AAGGACCAGAAGAATTTGCGGAAGGATTGGCGTATGGGGTGAAGAGTCTT
GTTGGTGGAACCGTGGGTGGAGTATCAGGAGCTGTGAGTAAGATTACCGG
TACCTTCGGTAAAGGTTTGGCTGCATTGACCTTGGATGAAGAATATCAAC
AAAAGAGACGTGAAAACATGAGCCAACGCCCAACTAACCTCGGTGAAGGT
CTCGCCAAAGGTGGTAAAGGCCTTGTAAAGGGTATCGTGTCTGGTGTTAC
AGGGATCGTTACCAAACCCTATGAAGGTGCCAAGAATGATGGTGCAGGTG
GCTTTTTTAAGGGCGTTGGAAAAGGCCTGATTGGCGTGGTTGCACGCCCT
GTTGGTGGAGTGGTAGATATGGCCAGTAACACGTTTGATGGTTTGAAAAG
CACGACATCTGGCGTGAAAGCGATCGAGTTGAGCCGTGTTACTCGCGTCT
TCCACGCAGATAAGGTTTTACGACCTTTCAATCTGTACGAAGCAGATGGA
AACAAAATTCTTATGCAATGTAACAAAGGAGAATACGCCAAGAAGAATTT
TTATATCACTCATGTAGTGGACAAGAAGAACTATCTCATCCTCACTCAAT
CaaacATTTTGTATGTTGGAAAGAACGAGTTGAAAATGGGTGAATGGGAA
TCggtttgggttatcgagttcaATGAGCTAAAACGTGAACCAGAAGTGAA
AGAGACAAAGATTATTTTCCATATCCATAATACGGACACGCGACGTTCAA
TTTTCAAGAAATCGACGAACACACGTGAAGTGATATTGGAGTCTAGTGCT
GTTGCAGACTGGTTTATCTTAAAGCTTAGAGATGCTAAAATGTTATAGat
ggtatttgaaTCTTTGGTTGCTGACCTCTTGAACAAGTATCTGGGTCAAT
ATGTGAAAAATCTTGATGCTTCTCAATTGAAGATTGGCATTTGGGGAGGA
AATGTTGTCCTGACAGAACTTGAACTGAAAGATACAGCTCTGGATGATCT
TGACTTACCCATAAAAGTTGTTCGTGGATATTTGGgtAAATTGGTCTTGT
CCATCCCATGGAAAAATCTTTACACTGAATCAACTGTTGTCGATATTCAA
GATCTCCACCTTGTCGCTAAGCCTAATTTTGACATCAAATACAATGAAGA
ACgcgaagaaaaatcaaaacatgacAAGAAACAACAACAGATTCACAATA
TCGAAGAAGCGAGGCAAAGAGAAGAAGACAAAAAGAAAGGCGCCAAGAAA
GAAGAGAGTGACGGTTTTGCTGAGAAACTTGCAACAAACGTCATAAAAAA
TCTACAGGTTACGATCAAGAACATACATGTTCGATATGAAGACTCAATCA
GTGATGTGAATGGACCCTTTTCAGTCGGTCTTACAATGGAAAGTTTAACA
GCACAAACCACAGATGAAGATTTTGTTCCAAAGATTATCAAAGAATCTGT
CTCATTAATTCATAAGatggTGAAATTAGACAATTTGGCTTTATATTGGA
ATCCAGGAGACGAACTGATTGATCCTTCACTTGATACCAAGCAATGGTTG
gaagtTTCAACGAAGCAAATTTCAACACACCAATCGAAGCCAGAGAAAAC
GAAATATATTTTGAGTCCCATGGTTGCAACGAAGAAATTGAAGCTGAACA
CCAAACCAGGTTCCAACCTTGACATCCCGAAGatgttTTTGAACTTGGTT
TTGGAAGAACTTGGTATCATCGTGGCAAGAAGTCAATATCATGGCGTGGT
GCAACTGATTGAATCATTTGAACGAATGAATAGGAACCAACCTTTTCGTA
AATACAGACCACATACCTCCGTTCTTGGGAACGAAAGTATTTGGTGGAAG
TACTGCATGTCCAGCATACTGGAGGTGGATGTCAAAAGACGATCTCAAAT
GTGGAGCTGGAAGCATATTCAAAAACATCGAGTTCTTTGCAAAGCTTACA
AAGTGAAGTAcaaggaaaaattgaaacagaaaaATCCATCCAAACAAATT
CTCACTGAACTAGAGaGCATGGAGGATGAGTTGAATATTGCAAGCATCAC
CATTTTTCGACAGCTTGCAGCTACAGAGGTTTTAACGGAACAAAAGAAGA
AAGGCACTAAAGGAAGTTTCTTCAGTTTCTTCTCCAGATCAAAAGAACCA
GAAAAGTCTGCTGCTAATAAAATTGGAGATTTAATGGGTGATGACCAGGA
GAAGGAAATGCAGAAATTGTATGACGCAATCGGTTATACTGAAAATGAAG
TCATCACTCCCTTTCCTAAAGAGTACGTGGCGATGTCAGTGGAATCGATT
CTCCAGAAATTATTCATCAGCCTCATCGATGACACAGATAAGGCGAAAGA
ATTCAAAGTGTTGGATTTTTCACTCAACAACATCATTGTAGAAGTTTTCC
AAAGACCTTCTGCTCAAGCTCTCAAATTATGTGCAAAGATAGGAGAGATG
AAGTTATTTGGTACAGCTTCTGCTCAATGTACACCTCtcatcatcaaaaa
catgttaCAAGGTCGAGGTATGGAATTTCTGCCGTTGGTGGACTTCATCT
TTGAGACGAATCCTTTGAAGAAACCGGACATTGACCAATGTATCACTGCT
ATTTGTCAACCCTTAGAAATCATCTATGATGCTAACACGATCAACCATAT
CATTAGTTTCTTCAAACCTCCTGAACATGTTATCTTGCAAGATTTACAAG
ACAAAGCGTATTCTACTTTCGAAGATTTTAAAGTTTCAAGTACGGCTGGT
CTTCTACATGCTATGGAACAAAGAACGGTTATGGACATCGACATTGATGT
TGGAGCATCTCATTTGATCATCCCTGAAAAAGGTTCTTACAATGGTTGTA
CAGATATGCTGGTGATCGACTTTGGTAAAATCACGATGAGCAGCGATCCT
AGTCAAATCAGACACCTTGACCCTAAGGACATTGAGGATGTGAATGAAGT
ACAAAGCAAAGCTTATGATCGATTCTTGTTGTCGCTTCAAGCTCTTCAAA
TATTACTCGTTAGAGAAGGTGAAGATTTAAAGAGTGCTAAAAGCAACGTC
AGTAAAGCTTCATCACACATTTTGCATCCCATCAATTTCGATGGCAAACT
TGCCAAAGCTATACTTCCACAAGATCCACGTTTAAAACAGATATGTGTCT
CTGGTGAATTATCTTCGCTGTTTGTTTCTGTATCGGATGATAAAGTCAGT
CGTCTCATCAAGCTAGCAGACTCGATACCACTCCCTCAATCACCTTCTCA
CGATAACATCGACGGAGAAGAAAAACCTGAAGGACTCTTCACCAAGGCGT
TGTCAATGATAAGCTTGACAGGTGACAATGACACAGGGGTGGACATCGGA
GGATTTTCCATCCCTGTACCGACATCTCCAACATCAGTGACGTCAGATGA
AGATGAATACGGGACACCACCTGATGGCTCCATATTACAGTTACAACAAG
AAGCTGGTCCGGACTTTTCATCAGGAGTGGCGAACCAAGTCAAAGTGGAC
TTGAACTTTAAAATCCATAAAGTGATGATCGCCATTGGTTTGACTGACAA
AGCATTGAAACAGGAAAAAGAATGTCTGAAATTCATCGTGGACGACATCA
ATACAGAGgtGATACTACGAAGATGGGATTTGTTCGTCAATGCAGAAGTT
GGTCGTCTGGTGTTGAATGAAATGACATGGGGTGTTGATGGAGAACCTTT
CGCCATCATGAGTACacccaaaaacaccaaaatgttGAAATTCAGCTATC
GGAGGTGTGAATTCAACGAAAGTTTGAATCTCGGTCCAAGTTACTTTTAT
TCCAAAGAAGCGCAAGTCAGAGCTTTACATTTCAAAGATGAATTTGGCGC
CACGGATCAGATTTTAGATGTACAAGTGGCTACTTTATTTCTGATGCTTC
ATCAAGAAGCACTTTTGAGCATCATGTCATTGATCTACCAAGTACTGGAA
CCACTCAACAAACATGATAAGGAAGCCACACAGAAGATCAAACGGAGTTT
GAGTACGGCAGGTAGTCGTTTGAGTCTCTCCatcgaagaaaaagaaaagg
agaGACAGATACAACGAAAATTAGCCAACCCTAAAGCACTGGAAGCTGCC
AACGAACTTAAGCAACAGGTTGGcttagaagaagaaaaaaagatgaGAGT
GACCGCCCACCTGGATGGTGTTGGTATCATGATTTGTTCAGCCAAAGTTG
ACCTTGCACAAGCCTTCGTTAAAGGGTTATCTGCTAAAGTACTGATGAAA
GATGACTTATTAGAAGTGAAAGCCAGCATGAAAGATATGCAAGTACAAGA
TAATGTTGGCGAAACAAAGTACAAAGACATCATTAGCATGCGATCTGATG
AAGTGTTCGATTTAGAGTTGGCTATTTACGAGAATGGATCTTCTGGTAGC
AAGCAATACGATATGTCGTGTGTCGACACCAGTGTCAAACTGAACTTCGG
TCAAATGCGCGTTGTTTTCTTGTATAGATTCATACAAGACTTAATGTCAT
TCACCGAAAACTTCGAAGAAGCACAGAAAGCAGTTGTGGAAGCTGGTAAA
GCTGCCAAGGATAAAGCTCTGGAAACAGCGACCGATTTGAATAGACATTC
TTCTCGTGTCAAACTAAATGTGGTTCTGAAAGCACCGACTATTATCATTC
CAGTTGGATCAAACAATGAATTGGCTTTACTGGTGGATCTGGGTGAATTG
CGTATTTACAACACATTCAAACTCCTCAACGATGATCAATACCATAAGAA
ATCTATCATCACTGATAACATGACCATTAAGTTATCCAATCTGAAATTGT
TAAAAGCACTTATTCAAGATGGTAAAGATTTCTTGCATCAACGAGCCATT
ATTGAACCTATGATGCTACAAATAACTATTGTTCGTAATTTAACGAAAGG
TAACCATTCCATACCGGATGTTTCAGTTCAAGCAAAGATGCCAGCTATTC
TGTTATCAATCAGTGAAGAAGATGTGACCGTAGCTCTAAAGATTGTCCAA
GGGAATCTCGCCGAAGGTGAGTCACATGCGCCGAAGAAGCAAGCCAAGCC
TGCCAAACAAACGTTAAACGTGCCACAAGATCGTTTAGCAGACATTTACG
AGGAGcctgaagatgaagatgagaaTCGACAAGGATATCTTCAAACCAAA
CTATCCTTCGATCTGGCTAAAATTGACATCAAGCTTTACTTGAAACCATC
TGATATGACATTTGAAGATGAATTTTTAGCGAGGACGGATGATTTGTTGT
TAGCTTTGTTCACTATTGGTAACCTGTGTGTTGATGGAGACATCATGTCC
ACGCAAGCTATGAAGATGAGCGTTCGATTGGACACTTTGGTGTTGGATGA
TATGAGACCTATCGAGGAGCATGAAGGTGTTAAACGTATGATCAACTACA
GTCCCGAGCCACTCCTTGAAGAAGTCAAAACCTCTTCTCATAAACGACCA
ATCGACAACTCACGAATGATCGAAATCCAAttcgatcaaacttcatcgca
agataaaaatatcgacATCAAACTTTGTAACATGCTTTGTATATTCAACG
TTGAGTTTATCATGGTCCTGTTGAAAACGTTGCAAGCTGCCATACCTAAA
GATGATAGTCTGCAACATGGCCATTCAATGAGTAGTCTAGACTCGGCGGC
AGGGTCTGGCGGCAGCGATGACGAGGACTCTTTAGAAGCCAGCGAGATTG
TCCTCTGCACTGGTGATCAAGAAAGACCTGAGACTAAAGTCTCTATCTTC
GTCCATAACCCGCAAATTGTTTTACTAGCAGATGCAAAGGATGTCAAAAC
AAATGCACTCTTTCTTACAACCGagatcaattttcaatatttcgaaTTGC
GAGATACTCAAAAAATGATTGGCGCTGTTTCTAACACCGCTATTTTGTCA
ACTGCTTTCAAGAATGACCATCGGAGTGATATATCAACAGTGTTGTCATT
AGATTCCATCAATCTCCACTCGTCATCACCCATCAATGGTAAACCTCATA
TGAGTGTCAGCACAACTTTGATCAAACTGAATATCTCACCCAAAACCATC
CGAACTTTATCAGCGTGTGCTGGTTACATCTCCAATGATCCAACAGATGA
AGAAATCAAAGAAGCTCGAAAAGCCATGCGTGATTTATGGCAAATTCAAA
CGTTCACCAATAAGCGACCGTGGTATTTAAACCACCCACCACAACAAGTC
TTAAGTGCTGGCAGCTTCGTCCTTGCGCGAACGAGAACAGGAGAATATAA
GCATGGTTTCTTAGCTAAAAAGGATGTCTCGTATCAAGTCTATTTTTCAG
AGGAGCGAGGAACAGCCAGTCACCGAGCCATGGATATCTCATCTGTTGTT
TTGGATATCGTACCGCTGATCGGTGATCTATGTGTTGGATGTAATGTTTT
AGCTGTGGAATCGAAAGAACATGGATATCGTACTGGTCGAATTACTCAGG
TTTGGGATTCGAATGTGGATAAAGATTCTTCGGATGGCGCCAAACAATCT
GTTTCTGTCAAGACAACTGCTATTGCTCCAATCAAATACCTTGTCAATTT
CTATGACAACCAAACGGAGAACTTCTTCCCGCCTGATGAACTTCGTATCA
TTGGTAAACCCATCAAGGGGGTTGTCCCTGGACTAGGGGCGTGTGTTTAC
GCCCGCTTTAATGATGGTTTTTACTATCGGGGCAAAGTTGATGACATCGA
GGATTATCGAATCCGAGTGCAATTGGATGAGATCAGTGGAGAAATCGAAC
ACGACATCGATGATCCGTCAGCCGTTATTTTGAACCTGACGCCTCAATAC
CGTCAAGTCAAAAAGCATTTCAAAGTCATTGCATCCAAAGGAAGCACAAC
TAAAGGATATCATCCGGGGAAAGTGACCGCCATCCAAGGTGAAGGAAATA
ACCGATTGTATTCGATACGCTTCGAAGACGGTACAATTAACCAAGTACCC
ATCacgaaattgattttgatgccAAAAGCACCTTTTGATGCTTTACCTGA
AGTTGGCACATACGTTTATTCCCGAGTGTCACGCGACGCTCCTTTATACG
AGAAGGGTATCGTAGCAGAGAAGAACACAATGATCTGCGTTAAACATTTA
AATGGACGGAAATTGGCTCACGAAATACAAAACATTCATTTTGTTGTCCG
AAATATCGTTCCTCTCGTGTCATCAttgaagGTTGGTTTGGACGTCATAG
TGCAACCTGACAATGACGATCAGAAAATGTATTTGGCTGTCATTAGGGAA
GTCACCAAAAAAGAAGGTGACAAAACGAACCGTTATCTAGTGGAGTTTAC
GGATGGATCCAAGAAGAGAGTGACGCCCAGCCGGATCCGTATACTTTCTC
AATACGGAAGTGCAGAAACGAGTGAAGAAAATGCTGACATTATCACAACA
AGACAGGAGGAACTAGTTCTCGATGTGCAAGGTATCTCATTACGTGTGGA
AGGTTACTTGGGAGGCGTGTTGACACCCATGCTCAAAATGGATTCCAAAA
TCACAGCTAACTTGAAGGATTGGTCAAGCCAAATGAATGCACACGCTACT
GTATCATTAGAAGCCAGTTATTATAACGAAAACGTTGCCGAATGGGAGCC
AGTTATTGAACCTTTGATGGAGAAACGGAGGGAAAGACCGTGGCAACTCT
CTGTCAATTACACGATGGAAGGTGACGACAATTCTGCTTCATCCACTTCC
AACGAACTCGTTTTACAAAAACCGGAATCCAACCTGAAAATCAAATCTCA
AGATAATCTTGAATTGACAATTTCAAAATCATGTCTTGCTTTACTCGGTG
AATTGGGACAGGTGTTTGGAGATGCAGTAGAATCTGTGGACGTTTTACCA
CAAGTCCTGGTCGAAAAAGAACCTTTCATGATCGAAAACTTGCTCTCCAA
GAAGGTGACAGTAACATTGAATGAACTTCTGCAGGGACCAAATGGAGATT
CGACAATCGAGCTAGCATCTTCTTCGAATCCTGTTGGCATTACTTTTGCT
CCCAagaaatttgagaaacgaaAGACCAACGATCTATACACAATCAATTT
AtcgGTGGACGGTTTTCATGACATTAAAGACATTGTGGTTCAAAGAAAGC
GAAGCGTTATCTATGATCTTGTACCAATAAAACTATTATCAGCACAGTCT
TCATATTCGATAGTGGTACAAGTGAAGACAACAGACGGACAACGTATCAT
CGTACTCCGATCACCATTGCAGTTGAAAAATCACTTTCCAATGCCGTTGG
ATGTCAGCTACATTTCCAAAGAAAACCAACCAGTTAAACTGACAACAGTG
GGATCGGGAGATATCTATTCCTTCCCTTTGTTGTTAACCTACCACAGTGT
TTTTCATCTCAAACCTGCTGGTTTCGACTACGGTGATTGCACAGAAGCTC
TCAATTGGAGTGATTTGAAGACGAGCAACGAAAAACAGTTCTCCTGCCCT
TCACCTGACAAAAGTGCTGACCCTTTCTACATGCAGGTGGTGATGAAAGA
GGAGACGTACTCTTCCGTACACGGCATGTTGGACTGTGTACCACGTTACA
CGTTGGAGTGCTTTCCCGTCATCACGCTGCATAATTACCTACCTTGCACT
ATTAATTATAAGATCAAGGGTATGGCGAAATCGGAAAGTCTACCAGGCGG
ACACAATTGGCCTTTGTTTACCGTCAACTTCAGTGATAAACCTTCCATCT
ATATCGAGATTGAGTCGTATAACAACCAAAGATGGGAAGGAGGTTTGACA
TTACCAACAAAACCGGTAGATTCTTTGAACAAACCATCATTATCTTTCGT
CATGATGTCTGGTGAACGCAAAATGGAATTGGGTGTTTATTACCAGTTAG
ACGGTTCATTGAACATCACCTTATATTCGCCTTACTGGCTTCTCAATAAA
ACTGGAAAACCACTTGTCTATCAGCCAGCGGGGAGCAGCATCCAGCAAGT
TCACCAAGAGAACGATGTAAATGCTCTTATGATGCTCGTCAAAGGGAAAC
ATAAAAAGgcgaaagtgaaagtgaaaaataGCGAGTCATGGTCAAATGAA
TTTTCATTGGATACTGTTGGCAGTGGTGGTTCCTTGAAATGCAATGGTCC
AAGAGATCGAGTTTATGAGATTGGTTTGAACATCAGTTTGTCATACTTTG
GATTGACGAAGATTGTGACGTTCACGCCACTCCGAATGTTATCTAACCAC
ACCAAGTACACCATCAGTATGGCAGAAAGTAATTCTAAATCGTCAGAATG
GCACACGGTAAACCCTGACGAGaacattccatTCTGGCCGACGAAACTTC
CTTTGGTCAACCTTTACATTAACATCAATGGGCAAGATTCAGTGAAATTC
AACCCTGAAGTTGGAAAAACTTTACTGTTGAAGTTCCAGAATGAGGTTGG
AGGAGTTTGCGTGGATTACCAAGAAAAGGACTCGTCCTCAGTCCTTTCGT
TTAATCCGTACTTCGCAGGTGCAGCTCCTGTGCGGCttgaaaatctttgc
aaaaaGATCGGCATGATCGCTTATAAACAAGCAGGTTCGGTAATGGGTCA
CGTGTTAACACATGACCAATCAGTGTTGTACACGTGGGATGATCCAACCA
TGGAACAAGAATTGATTTGTTCCATTGTCAATGATGAAGCCAGTGAAACA
AGGATCAAACTCGATGCCAACGATTTCGGACGAATGAGAGTTGGAGATGG
TGCAATTTATTGGGTTTCCTTTCTGGATGGTCTTCAACGTGTTCTATTGT
TCACTGATAACTTCAAATCTGCTTACTGCGCATGTCAGgaGCAAAATTTA
CGCCCAACCATGGAAGTTGACTTTGAGATTGAGAGTTTTGGTTTGTCTCT
GGTCAATGTTGATAAGAGAATGGAGATTGGCTACTTAGCTATCCGACAAA
GCAAGACTGTATGGGAGCAACGCAAGAAAAAGAACCGCTGGAAAGCTTTA
CCGCTTGCCATGTGTGAAGCTCTCGAAGAAGGTTATCTCAATTATCAAAA
CAGAAAAGGTGCAGTCAAAGAGAAAGTTCTGGATAAGGAGGTGGATTACG
AGAAGATGTTTATTACGAAACCTGAGAAGATTAAGATCAGAAGAACGTAC
CACAGCGGTCTTGGTTTCAAATACACAATCTCACCCAATGAAATGCGTGT
GCATGCTTCTATCAGCTCAATACAGTTGGATAGCCATGTTCCAGGTTCGA
CCTTTCCAACAGTCTTGCATATGGTTGAACCACCAAAATCTGTTGCTTCA
GAAAACGCTCCAAAGCCATTCTttgaattgagtttaatgaCAAGGATCGG
TGATAAAAATGTGGTCAATGAAGTcagCTATTGTCACGTGTTGATTCAAG
AGATGGATGTGAGGGTTGATATTGGATTTTTATTGGCTCTGATGGAACTC
TTCAGTCATGCAAGAGCTCGAACAACCGAGAAAGAACAATACGCGCTTGA
TATTGGCCAAGCAGCAACAAAGTTTGAAGAAAGCGCTGAATTTCAGGCAG
CCAAACAAGATCGATATTACGTTTTGAACGACTTTCATTTATCACCGCTA
AAGATTCACGTCAGTTTCTCTTTGACGGGTGGTTCCAAAGATGAAAATGC
TATTGCTTCATTACATGGTAACGTGTTGAACTTGTTGTTACAAAGTGTCG
GACTGGCCTTCACTGAAATACAAGACGTACAATTCAAATTAGCATGTTAC
GAAGTGCATAAGTCCATGCAGAGTAATTCGCAGCTCGGTGATGGAATAAC
TAAACATTATCAAACACAGGCTATCAAGCAACTTTATGTGTTGGTACTCG
GGCTAGACGTTCTTGGTAATCCGTATGGTTTGATATCTGGTGTTGGAACC
GGAGCAAAGAATTTCTTCTACGAACCTTACCAGGGATTAATTCAAGGACC
AGAAGAATTTGCGGAAGGATTGGCGTATGGGGTGAAGAGTCTTGTTGGTG
GAACCGTGGGTGGAGTATCAGGAGCTGTGAGTAAGATTACCGGTACCTTC
GGTAAAGGTTTGGCTGCATTGACCTTGGATGAAGAATATCAACAAAAGAG
ACGTGAAAACATGAGCCAACGCCCAACTAACCTCGGTGAAGGTCTCGCCA
AAGGTGGTAAAGGCCTTGTAAAGGGTATCGTGTCTGGTGTTACAGGGATC
GTTACCAAACCCTATGAAGGTGCCAAGAATGATGGTGCAGGTGGCTTTTT
TAAGGGCGTTGGAAAAGGCCTGATTGGCGTGGTTGCACGCCCTGTTGGTG
GAGTGGTAGATATGGCCAGTAACACGTTTGATGGTTTGAAAAGCACGACA
TCTGGCGTGAAAGCGATCGAGTTGAGCCGTGTTACTCGCGTCTTCCACGC
AGATAAGGTTTTACGACCTTTCAATCTGTACGAAGCAGATGGAAACAAAA
TTCTTATGCAATGTAACAAAGGAGAATACGCCAAGAAGAATTTTTATATC
ACTCATGTAGTGGACAAGAAGAACTATCTCATCCTCACTCAATCaaacAT
TTTGTATGTTGGAAAGAACGAGTTGAAAATGGGTGAATGGGAATCggttt
gggttatcgagttcaATGAGCTAAAACGTGAACCAGAAGTGAAAGAGACA
AAGATTATTTTCCATATCCATAATACGGACACGCGACGTTCAATTTTCAA
GAAATCGACGAACACACGTGAAGTGATATTGGAGTCTAGTGCTGTTGCAG
ACTGGTTTATCTTAAAGCTTAGAGATGCTAAAATGTTATAGatggtattt
gaaTCTTTGGTTGCTGACCTCTTGAACAAGTATCTGGGTCAATATGTGAA
AAATCTTGATGCTTCTCAATTGAAGATTGGCATTTGGGGAGGAAATGTTG
TCCTGACAGAACTTGAACTGAAAGATACAGCTCTGGATGATCTTGACTTA
CCCATAAAAGTTGTTCGTGGATATTTGGgtAAATTGGTCTTGTCCATCCC
ATGGAAAAATCTTTACACTGAATCAACTGTTGTCGATATTCAAGATCTCC
ACCTTGTCGCTAAGCCTAATTTTGACATCAAATACAATGAAGAACgcgaa
gaaaaatcaaaacatgacAAGAAACAACAACAGATTCACAATATCGAAGA
AGCGAGGCAAAGAGAAGAAGACAAAAAGAAAGGCGCCAAGAAAGAAGAGA
GTGACGGTTTTGCTGAGAAACTTGCAACAAACGTCATAAAAAATCTACAG
GTTACGATCAAGAACATACATGTTCGATATGAAGACTCAATCAGTGATGT
GAATGGACCCTTTTCAGTCGGTCTTACAATGGAAAGTTTAACAGCACAAA
CCACAGATGAAGATTTTGTTCCAAAGATTATCAAAGAATCTGTCTCATTA
ATTCATAAGatggTGAAATTAGACAATTTGGCTTTATATTGGAATCCAGG
AGACGAACTGATTGATCCTTCACTTGATACCAAGCAATGGTTGgaagtTT
CAACGAAGCAAATTTCAACACACCAATCGAAGCCAGAGAAAACGAAATAT
ATTTTGAGTCCCATGGTTGCAACGAAGAAATTGAAGCTGAACACCAAACC
AGGTTCCAACCTTGACATCCCGAAGatgttTTTGAACTTGGTTTTGGAAG
AACTTGGTATCATCGTGGCAAGAAGTCAATATCATGGCGTGGTGCAACTG
ATTGAATCATTTGAACGAATGAATAGGAACCAACCTTTTCGTAAATACAG
ACCACATACCTCCGTTCTTGGGAACGAAAGTATTTGGTGGAAGTACTGCA
TGTCCAGCATACTGGAGGTGGATGTCAAAAGACGATCTCAAATGTGGAGC
TGGAAGCATATTCAAAAACATCGAGTTCTTTGCAAAGCTTACAAAGTGAA
GTAcaaggaaaaattgaaacagaaaaATCCATCCAAACAAATTCTCACTG
AACTAGAGaGCATGGAGGATGAGTTGAATATTGCAAGCATCACCATTTTT
CGACAGCTTGCAGCTACAGAGGTTTTAACGGAACAAAAGAAGAAAGGCAC
TAAAGGAAGTTTCTTCAGTTTCTTCTCCAGATCAAAAGAACCAGAAAAGT
CTGCTGCTAATAAAATTGGAGATTTAATGGGTGATGACCAGGAGAAGGAA
ATGCAGAAATTGTATGACGCAATCGGTTATACTGAAAATGAAGTCATCAC
TCCCTTTCCTAAAGAGTACGTGGCGATGTCAGTGGAATCGATTCTCCAGA
AATTATTCATCAGCCTCATCGATGACACAGATAAGGCGAAAGAATTCAAA
GTGTTGGATTTTTCACTCAACAACATCATTGTAGAAGTTTTCCAAAGACC
TTCTGCTCAAGCTCTCAAATTATGTGCAAAGATAGGAGAGATGAAGTTAT
TTGGTACAGCTTCTGCTCAATGTACACCTCtcatcatcaaaaacatgtta
CAAGGTCGAGGTATGGAATTTCTGCCGTTGGTGGACTTCATCTTTGAGAC
GAATCCTTTGAAGAAACCGGACATTGACCAATGTATCACTGCTATTTGTC
AACCCTTAGAAATCATCTATGATGCTAACACGATCAACCATATCATTAGT
TTCTTCAAACCTCCTGAACATGTTATCTTGCAAGATTTACAAGACAAAGC
GTATTCTACTTTCGAAGATTTTAAAGTTTCAAGTACGGCTGGTCTTCTAC
ATGCTATGGAACAAAGAACGGTTATGGACATCGACATTGATGTTGGAGCA
TCTCATTTGATCATCCCTGAAAAAGGTTCTTACAATGGTTGTACAGATAT
GCTGGTGATCGACTTTGGTAAAATCACGATGAGCAGCGATCCTAGTCAAA
TCAGACACCTTGACCCTAAGGACATTGAGGATGTGAATGAAGTACAAAGC
AAAGCTTATGATCGATTCTTGTTGTCGCTTCAAGCTCTTCAAATATTACT
CGTTAGAGAAGGTGAAGATTTAAAGAGTGCTAAAAGCAACGTCAGTAAAG
CTTCATCACACATTTTGCATCCCATCAATTTCGATGGCAAACTTGCCAAA
GCTATACTTCCACAAGATCCACGTTTAAAACAGATATGTGTCTCTGGTGA
ATTATCTTCGCTGTTTGTTTCTGTATCGGATGATAAAGTCAGTCGTCTCA
TCAAGCTAGCAGACTCGATACCACTCCCTCAATCACCTTCTCACGATAAC
ATCGACGGAGAAGAAAAACCTGAAGGACTCTTCACCAAGGCGTTGTCAAT
GATAAGCTTGACAGGTGACAATGACACAGGGGTGGACATCGGAGGATTTT
CCATCCCTGTACCGACATCTCCAACATCAGTGACGTCAGATGAAGATGAA
TACGGGACACCACCTGATGGCTCCATATTACAGTTACAACAAGAAGCTGG
TCCGGACTTTTCATCAGGAGTGGCGAACCAAGTCAAAGTGGACTTGAACT
TTAAAATCCATAAAGTGATGATCGCCATTGGTTTGACTGACAAAGCATTG
AAACAGGAAAAAGAATGTCTGAAATTCATCGTGGACGACATCAATACAGA
GgtGATACTACGAAGATGGGATTTGTTCGTCAATGCAGAAGTTGGTCGTC
TGGTGTTGAATGAAATGACATGGGGTGTTGATGGAGAACCTTTCGCCATC
ATGAGTACacccaaaaacaccaaaatgttGAAATTCAGCTATCGGAGGTG
TGAATTCAACGAAAGTTTGAATCTCGGTCCAAGTTACTTTTATTCCAAAG
AAGCGCAAGTCAGAGCTTTACATTTCAAAGATGAATTTGGCGCCACGGAT
CAGATTTTAGATGTACAAGTGGCTACTTTATTTCTGATGCTTCATCAAGA
AGCACTTTTGAGCATCATGTCATTGATCTACCAAGTACTGGAACCACTCA
ACAAACATGATAAGGAAGCCACACAGAAGATCAAACGGAGTTTGAGTACG
GCAGGTAGTCGTTTGAGTCTCTCCatcgaagaaaaagaaaaggagaGACA
GATACAACGAAAATTAGCCAACCCTAAAGCACTGGAAGCTGCCAACGAAC
TTAAGCAACAGGTTGGcttagaagaagaaaaaaagatgaGAGTGACCGCC
CACCTGGATGGTGTTGGTATCATGATTTGTTCAGCCAAAGTTGACCTTGC
ACAAGCCTTCGTTAAAGGGTTATCTGCTAAAGTACTGATGAAAGATGACT
TATTAGAAGTGAAAGCCAGCATGAAAGATATGCAAGTACAAGATAATGTT
GGCGAAACAAAGTACAAAGACATCATTAGCATGCGATCTGATGAAGTGTT
CGATTTAGAGTTGGCTATTTACGAGAATGGATCTTCTGGTAGCAAGCAAT
ACGATATGTCGTGTGTCGACACCAGTGTCAAACTGAACTTCGGTCAAATG
CGCGTTGTTTTCTTGTATAGATTCATACAAGACTTAATGTCATTCACCGA
AAACTTCGAAGAAGCACAGAAAGCAGTTGTGGAAGCTGGTAAAGCTGCCA
AGGATAAAGCTCTGGAAACAGCGACCGATTTGAATAGACATTCTTCTCGT
GTCAAACTAAATGTGGTTCTGAAAGCACCGACTATTATCATTCCAGTTGG
ATCAAACAATGAATTGGCTTTACTGGTGGATCTGGGTGAATTGCGTATTT
ACAACACATTCAAACTCCTCAACGATGATCAATACCATAAGAAATCTATC
ATCACTGATAACATGACCATTAAGTTATCCAATCTGAAATTGTTAAAAGC
ACTTATTCAAGATGGTAAAGATTTCTTGCATCAACGAGCCATTATTGAAC
CTATGATGCTACAAATAACTATTGTTCGTAATTTAACGAAAGGTAACCAT
TCCATACCGGATGTTTCAGTTCAAGCAAAGATGCCAGCTATTCTGTTATC
AATCAGTGAAGAAGATGTGACCGTAGCTCTAAAGATTGTCCAAGGGAATC
TCGCCGAAGGTGAGTCACATGCGCCGAAGAAGCAAGCCAAGCCTGCCAAA
CAAACGTTAAACGTGCCACAAGATCGTTTAGCAGACATTTACGAGGAGcc
tgaagatgaagatgagaaTCGACAAGGATATCTTCAAACCAAACTATCCT
TCGATCTGGCTAAAATTGACATCAAGCTTTACTTGAAACCATCTGATATG
ACATTTGAAGATGAATTTTTAGCGAGGACGGATGATTTGTTGTTAGCTTT
GTTCACTATTGGTAACCTGTGTGTTGATGGAGACATCATGTCCACGCAAG
CTATGAAGATGAGCGTTCGATTGGACACTTTGGTGTTGGATGATATGAGA
CCTATCGAGGAGCATGAAGGTGTTAAACGTATGATCAACTACAGTCCCGA
GCCACTCCTTGAAGAAGTCAAAACCTCTTCTCATAAACGACCAATCGACA
ACTCACGAATGATCGAAATCCAAttcgatcaaacttcatcgcaagataaa
aatatcgacATCAAACTTTGTAACATGCTTTGTATATTCAACGTTGAGTT
TATCATGGTCCTGTTGAAAACGTTGCAAGCTGCCATACCTAAAGATGATA
GTCTGCAACATGGCCATTCAATGAGTAGTCTAGACTCGGCGGCAGGGTCT
GGCGGCAGCGATGACGAGGACTCTTTAGAAGCCAGCGAGATTGTCCTCTG
CACTGGTGATCAAGAAAGACCTGAGACTAAAGTCTCTATCTTCGTCCATA
ACCCGCAAATTGTTTTACTAGCAGATGCAAAGGATGTCAAAACAAATGCA
CTCTTTCTTACAACCGagatcaattttcaatatttcgaaTTGCGAGATAC
TCAAAAAATGATTGGCGCTGTTTCTAACACCGCTATTTTGTCAACTGCTT
TCAAGAATGACCATCGGAGTGATATATCAACAGTGTTGTCATTAGATTCC
ATCAATCTCCACTCGTCATCACCCATCAATGGTAAACCTCATATGAGTGT
CAGCACAACTTTGATCAAACTGAATATCTCACCCAAAACCATCCGAACTT
TATCAGCGTGTGCTGGTTACATCTCCAATGATCCAACAGATGAAGAAATC
AAAGAAGCTCGAAAAGCCATGCGTGATTTATGGCAAATTCAAACGTTCAC
CAATAAGCGACCGTGGTATTTAAACCACCCACCACAACAAGTCTTAAGTG
CTGGCAGCTTCGTCCTTGCGCGAACGAGAACAGGAGAATATAAGCATGGT
TTCTTAGCTAAAAAGGATGTCTCGTATCAAGTCTATTTTTCAGAGGAGCG
AGGAACAGCCAGTCACCGAGCCATGGATATCTCATCTGTTGTTTTGGATA
TCGTACCGCTGATCGGTGATCTATGTGTTGGATGTAATGTTTTAGCTGTG
GAATCGAAAGAACATGGATATCGTACTGGTCGAATTACTCAGGTTTGGGA
TTCGAATGTGGATAAAGATTCTTCGGATGGCGCCAAACAATCTGTTTCTG
TCAAGACAACTGCTATTGCTCCAATCAAATACCTTGTCAATTTCTATGAC
AACCAAACGGAGAACTTCTTCCCGCCTGATGAACTTCGTATCATTGGTAA
ACCCATCAAGGGGGTTGTCCCTGGACTAGGGGCGTGTGTTTACGCCCGCT
TTAATGATGGTTTTTACTATCGGGGCAAAGTTGATGACATCGAGGATTAT
CGAATCCGAGTGCAATTGGATGAGATCAGTGGAGAAATCGAACACGACAT
CGATGATCCGTCAGCCGTTATTTTGAACCTGACGCCTCAATACCGTCAAG
TCAAAAAGCATTTCAAAGTCATTGCATCCAAAGGAAGCACAACTAAAGGA
TATCATCCGGGGAAAGTGACCGCCATCCAAGGTGAAGGAAATAACCGATT
GTATTCGATACGCTTCGAAGACGGTACAATTAACCAAGTACCCATCacga
aattgattttgatgccAAAAGCACCTTTTGATGCTTTACCTGAAGTTGGC
ACATACGTTTATTCCCGAGTGTCACGCGACGCTCCTTTATACGAGAAGGG
TATCGTAGCAGAGAAGAACACAATGATCTGCGTTAAACATTTAAATGGAC
GGAAATTGGCTCACGAAATACAAAACATTCATTTTGTTGTCCGAAATATC
GTTCCTCTCGTGTCATCAttgaagGTTGGTTTGGACGTCATAGTGCAACC
TGACAATGACGATCAGAAAATGTATTTGGCTGTCATTAGGGAAGTCACCA
AAAAAGAAGGTGACAAAACGAACCGTTATCTAGTGGAGTTTACGGATGGA
TCCAAGAAGAGAGTGACGCCCAGCCGGATCCGTATACTTTCTCAATACGG
AAGTGCAGAAACGAGTGAAGAAAATGCTGACATTATCACAACAAGACAGG
AGGAACTAGTTCTCGATGTGCAAGGTATCTCATTACGTGTGGAAGGTTAC
TTGGGAGGCGTGTTGACACCCATGCTCAAAATGGATTCCAAAATCACAGC
TAACTTGAAGGATTGGTCAAGCCAAATGAATGCACACGCTACTGTATCAT
TAGAAGCCAGTTATTATAACGAAAACGTTGCCGAATGGGAGCCAGTTATT
GAACCTTTGATGGAGAAACGGAGGGAAAGACCGTGGCAACTCTCTGTCAA
TTACACGATGGAAGGTGACGACAATTCTGCTTCATCCACTTCCAACGAAC
TCGTTTTACAAAAACCGGAATCCAACCTGAAAATCAAATCTCAAGATAAT
CTTGAATTGACAATTTCAAAATCATGTCTTGCTTTACTCGGTGAATTGGG
ACAGGTGTTTGGAGATGCAGTAGAATCTGTGGACGTTTTACCACAAGTCC
TGGTCGAAAAAGAACCTTTCATGATCGAAAACTTGCTCTCCAAGAAGGTG
ACAGTAACATTGAATGAACTTCTGCAGGGACCAAATGGAGATTCGACAAT
CGAGCTAGCATCTTCTTCGAATCCTGTTGGCATTACTTTTGCTCCCAaga
aatttgagaaacgaaAGACCAACGATCTATACACAATCAATTTAtcgGTG
GACGGTTTTCATGACATTAAAGACATTGTGGTTCAAAGAAAGCGAAGCGT
TATCTATGATCTTGTACCAATAAAACTATTATCAGCACAGTCTTCATATT
CGATAGTGGTACAAGTGAAGACAACAGACGGACAACGTATCATCGTACTC
CGATCACCATTGCAGTTGAAAAATCACTTTCCAATGCCGTTGGATGTCAG
CTACATTTCCAAAGAAAACCAACCAGTTAAACTGACAACAGTGGGATCGG
GAGATATCTATTCCTTCCCTTTGTTGTTAACCTACCACAGTGTTTTTCAT
CTCAAACCTGCTGGTTTCGACTACGGTGATTGCACAGAAGCTCTCAATTG
GAGTGATTTGAAGACGAGCAACGAAAAACAGTTCTCCTGCCCTTCACCTG
ACAAAAGTGCTGACCCTTTCTACATGCAGGTGGTGATGAAAGAGGAGACG
TACTCTTCCGTACACGGCATGTTGGACTGTGTACCACGTTACACGTTGGA
GTGCTTTCCCGTCATCACGCTGCATAATTACCTACCTTGCACTATTAATT
ATAAGATCAAGGGTATGGCGAAATCGGAAAGTCTACCAGGCGGACACAAT
TGGCCTTTGTTTACCGTCAACTTCAGTGATAAACCTTCCATCTATATCGA
GATTGAGTCGTATAACAACCAAAGATGGGAAGGAGGTTTGACATTACCAA
CAAAACCGGTAGATTCTTTGAACAAACCATCATTATCTTTCGTCATGATG
TCTGGTGAACGCAAAATGGAATTGGGTGTTTATTACCAGTTAGACGGTTC
ATTGAACATCACCTTATATTCGCCTTACTGGCTTCTCAATAAAACTGGAA
AACCACTTGTCTATCAGCCAGCGGGGAGCAGCATCCAGCAAGTTCACCAA
GAGAACGATGTAAATGCTCTTATGATGCTCGTCAAAGGGAAACATAAAAA
GgcgaaagtgaaagtgaaaaataGCGAGTCATGGTCAAATGAATTTTCAT
TGGATACTGTTGGCAGTGGTGGTTCCTTGAAATGCAATGGTCCAAGAGAT
CGAGTTTATGAGATTGGTTTGAACATCAGTTTGTCATACTTTGGATTGAC
GAAGATTGTGACGTTCACGCCACTCCGAATGTTATCTAACCACACCAAGT
ACACCATCAGTATGGCAGAAAGTAATTCTAAATCGTCAGAATGGCACACG
GTAAACCCTGACGAGaacattccatTCTGGCCGACGAAACTTCCTTTGGT
CAACCTTTACATTAACATCAATGGGCAAGATTCAGTGAAATTCAACCCTG
AAGTTGGAAAAACTTTACTGTTGAAGTTCCAGAATGAGGTTGGAGGAGTT
TGCGTGGATTACCAAGAAAAGGACTCGTCCTCAGTCCTTTCGTTTAATCC
GTACTTCGCAGGTGCAGCTCCTGTGCGGCttgaaaatctttgcaaaaaGA
TCGGCATGATCGCTTATAAACAAGCAGGTTCGGTAATGGGTCACGTGTTA
ACACATGACCAATCAGTGTTGTACACGTGGGATGATCCAACCATGGAACA
AGAATTGATTTGTTCCATTGTCAATGATGAAGCCAGTGAAACAAGGATCA
AACTCGATGCCAACGATTTCGGACGAATGAGAGTTGGAGATGGTGCAATT
TATTGGGTTTCCTTTCTGGATGGTCTTCAACGTGTTCTATTGTTCACTGA
TAACTTCAAATCTGCTTACTGCGCATGTCAGgaGCAAAATTTACGCCCAA
CCATGGAAGTTGACTTTGAGATTGAGAGTTTTGGTTTGTCTCTGGTCAAT
GTTGATAAGAGAATGGAGATTGGCTACTTAGCTATCCGACAAAGCAAGAC
TGTATGGGAGCAACGCAAGAAAAAGAACCGCTGGAAAGCTTTACCGCTTG
CCATGTGTGAAGCTCTCGAAGAAGGTTATCTCAATTATCAAAACAGAAAA
GGTGCAGTCAAAGAGAAAGTTCTGGATAAGGAGGTGGATTACGAGAAGAT
GTTTATTACGAAACCTGAGAAGATTAAGATCAGAAGAACGTACCACAGCG
GTCTTGGTTTCAAATACACAATCTCACCCAATGAAATGCGTGTGCATGCT
TCTATCAGCTCAATACAGTTGGATAGCCATGTTCCAGGTTCGACCTTTCC
AACAGTCTTGCATATGGTTGAACCACCAAAATCTGTTGCTTCAGAAAACG
CTCCAAAGCCATTCTttgaattgagtttaatgaCAAGGATCGGTGATAAA
AATGTGGTCAATGAAGTcagCTATTGTCACGTGTTGATTCAAGAGATGGA
TGTGAGGGTTGATATTGGATTTTTATTGGCTCTGATGGAACTCTTCAGTC
ATGCAAGAGCTCGAACAACCGAGAAAGAACAATACGCGCTTGATATTGGC
CAAGCAGCAACAAAGTTTGAAGAAAGCGCTGAATTTCAGGCAGCCAAACA
AGATCGATATTACGTTTTGAACGACTTTCATTTATCACCGCTAAAGATTC
ACGTCAGTTTCTCTTTGACGGGTGGTTCCAAAGATGAAAATGCTATTGCT
TCATTACATGGTAACGTGTTGAACTTGTTGTTACAAAGTGTCGGACTGGC
CTTCACTGAAATACAAGACGTACAATTCAAATTAGCATGTTACGAAGTGC
ATAAGTCCATGCAGAGTAATTCGCAGCTCGGTGATGGAATAACTAAACAT
TATCAAACACAGGCTATCAAGCAACTTTATGTGTTGGTACTCGGGCTAGA
CGTTCTTGGTAATCCGTATGGTTTGATATCTGGTGTTGGAACCGGAGCAA
AGAATTTCTTCTACGAACCTTACCAGGGATTAATTCAAGGACCAGAAGAA
TTTGCGGAAGGATTGGCGTATGGGGTGAAGAGTCTTGTTGGTGGAACCGT
GGGTGGAGTATCAGGAGCTGTGAGTAAGATTACCGGTACCTTCGGTAAAG
GTTTGGCTGCATTGACCTTGGATGAAGAATATCAACAAAAGAGACGTGAA
AACATGAGCCAACGCCCAACTAACCTCGGTGAAGGTCTCGCCAAAGGTGG
TAAAGGCCTTGTAAAGGGTATCGTGTCTGGTGTTACAGGGATCGTTACCA
AACCCTATGAAGGTGCCAAGAATGATGGTGCAGGTGGCTTTTTTAAGGGC
GTTGGAAAAGGCCTGATTGGCGTGGTTGCACGCCCTGTTGGTGGAGTGGT
AGATATGGCCAGTAACACGTTTGATGGTTTGAAAAGCACGACATCTGGCG
TGAAAGCGATCGAGTTGAGCCGTGTTACTCGCGTCTTCCACGCAGATAAG
GTTTTACGACCTTTCAATCTGTACGAAGCAGATGGAAACAAAATTCTTAT
GCAATGTAACAAAGGAGAATACGCCAAGAAGAATTTTTATATCACTCATG
TAGTGGACAAGAAGAACTATCTCATCCTCACTCAATCaaacATTTTGTAT
GTTGGAAAGAACGAGTTGAAAATGGGTGAATGGGAATCggtttgggttat
cgagttcaATGAGCTAAAACGTGAACCAGAAGTGAAAGAGACAAAGATTA
TTTTCCATATCCATAATACGGACACGCGACGTTCAATTTTCAAGAAATCG
ACGAACACACGTGAAGTGATATTGGAGTCTAGTGCTGTTGCAGACTGGTT
TATCTTAAAGCTTAGAGATGCTAAAATGTTATAGatggtatttgaaTCTT
TGGTTGCTGACCTCTTGAACAAGTATCTGGGTCAATATGTGAAAAATCTT
GATGCTTCTCAATTGAAGATTGGCATTTGGGGAGGAAATGTTGTCCTGAC
AGAACTTGAACTGAAAGATACAGCTCTGGATGATCTTGACTTACCCATAA
AAGTTGTTCGTGGATATTTGGgtAAATTGGTCTTGTCCATCCCATGGAAA
AATCTTTACACTGAATCAACTGTTGTCGATATTCAAGATCTCCACCTTGT
CGCTAAGCCTAATTTTGACATCAAATACAATGAAGAACgcgaagaaaaat
caaaacatgacAAGAAACAACAACAGATTCACAATATCGAAGAAGCGAGG
CAAAGAGAAGAAGACAAAAAGAAAGGCGCCAAGAAAGAAGAGAGTGACGG
TTTTGCTGAGAAACTTGCAACAAACGTCATAAAAAATCTACAGGTTACGA
TCAAGAACATACATGTTCGATATGAAGACTCAATCAGTGATGTGAATGGA
CCCTTTTCAGTCGGTCTTACAATGGAAAGTTTAACAGCACAAACCACAGA
TGAAGATTTTGTTCCAAAGATTATCAAAGAATCTGTCTCATTAATTCATA
AGatggTGAAATTAGACAATTTGGCTTTATATTGGAATCCAGGAGACGAA
CTGATTGATCCTTCACTTGATACCAAGCAATGGTTGgaagtTTCAACGAA
GCAAATTTCAACACACCAATCGAAGCCAGAGAAAACGAAATATATTTTGA
GTCCCATGGTTGCAACGAAGAAATTGAAGCTGAACACCAAACCAGGTTCC
AACCTTGACATCCCGAAGatgttTTTGAACTTGGTTTTGGAAGAACTTGG
TATCATCGTGGCAAGAAGTCAATATCATGGCGTGGTGCAACTGATTGAAT
CATTTGAACGAATGAATAGGAACCAACCTTTTCGTAAATACAGACCACAT
ACCTCCGTTCTTGGGAACGAAAGTATTTGGTGGAAGTACTGCATGTCCAG
CATACTGGAGGTGGATGTCAAAAGACGATCTCAAATGTGGAGCTGGAAGC
ATATTCAAAAACATCGAGTTCTTTGCAAAGCTTACAAAGTGAAGTAcaag
gaaaaattgaaacagaaaaATCCATCCAAACAAATTCTCACTGAACTAGA
GaGCATGGAGGATGAGTTGAATATTGCAAGCATCACCATTTTTCGACAGC
TTGCAGCTACAGAGGTTTTAACGGAACAAAAGAAGAAAGGCACTAAAGGA
AGTTTCTTCAGTTTCTTCTCCAGATCAAAAGAACCAGAAAAGTCTGCTGC
TAATAAAATTGGAGATTTAATGGGTGATGACCAGGAGAAGGAAATGCAGA
AATTGTATGACGCAATCGGTTATACTGAAAATGAAGTCATCACTCCCTTT
CCTAAAGAGTACGTGGCGATGTCAGTGGAATCGATTCTCCAGAAATTATT
CATCAGCCTCATCGATGACACAGATAAGGCGAAAGAATTCAAAGTGTTGG
ATTTTTCACTCAACAACATCATTGTAGAAGTTTTCCAAAGACCTTCTGCT
CAAGCTCTCAAATTATGTGCAAAGATAGGAGAGATGAAGTTATTTGGTAC
AGCTTCTGCTCAATGTACACCTCtcatcatcaaaaacatgttaCAAGGTC
GAGGTATGGAATTTCTGCCGTTGGTGGACTTCATCTTTGAGACGAATCCT
TTGAAGAAACCGGACATTGACCAATGTATCACTGCTATTTGTCAACCCTT
AGAAATCATCTATGATGCTAACACGATCAACCATATCATTAGTTTCTTCA
AACCTCCTGAACATGTTATCTTGCAAGATTTACAAGACAAAGCGTATTCT
ACTTTCGAAGATTTTAAAGTTTCAAGTACGGCTGGTCTTCTACATGCTAT
GGAACAAAGAACGGTTATGGACATCGACATTGATGTTGGAGCATCTCATT
TGATCATCCCTGAAAAAGGTTCTTACAATGGTTGTACAGATATGCTGGTG
ATCGACTTTGGTAAAATCACGATGAGCAGCGATCCTAGTCAAATCAGACA
CCTTGACCCTAAGGACATTGAGGATGTGAATGAAGTACAAAGCAAAGCTT
ATGATCGATTCTTGTTGTCGCTTCAAGCTCTTCAAATATTACTCGTTAGA
GAAGGTGAAGATTTAAAGAGTGCTAAAAGCAACGTCAGTAAAGCTTCATC
ACACATTTTGCATCCCATCAATTTCGATGGCAAACTTGCCAAAGCTATAC
TTCCACAAGATCCACGTTTAAAACAGATATGTGTCTCTGGTGAATTATCT
TCGCTGTTTGTTTCTGTATCGGATGATAAAGTCAGTCGTCTCATCAAGCT
AGCAGACTCGATACCACTCCCTCAATCACCTTCTCACGATAACATCGACG
GAGAAGAAAAACCTGAAGGACTCTTCACCAAGGCGTTGTCAATGATAAGC
TTGACAGGTGACAATGACACAGGGGTGGACATCGGAGGATTTTCCATCCC
TGTACCGACATCTCCAACATCAGTGACGTCAGATGAAGATGAATACGGGA
CACCACCTGATGGCTCCATATTACAGTTACAACAAGAAGCTGGTCCGGAC
TTTTCATCAGGAGTGGCGAACCAAGTCAAAGTGGACTTGAACTTTAAAAT
CCATAAAGTGATGATCGCCATTGGTTTGACTGACAAAGCATTGAAACAGG
AAAAAGAATGTCTGAAATTCATCGTGGACGACATCAATACAGAGgtGATA
CTACGAAGATGGGATTTGTTCGTCAATGCAGAAGTTGGTCGTCTGGTGTT
GAATGAAATGACATGGGGTGTTGATGGAGAACCTTTCGCCATCATGAGTA
CacccaaaaacaccaaaatgttGAAATTCAGCTATCGGAGGTGTGAATTC
AACGAAAGTTTGAATCTCGGTCCAAGTTACTTTTATTCCAAAGAAGCGCA
AGTCAGAGCTTTACATTTCAAAGATGAATTTGGCGCCACGGATCAGATTT
TAGATGTACAAGTGGCTACTTTATTTCTGATGCTTCATCAAGAAGCACTT
TTGAGCATCATGTCATTGATCTACCAAGTACTGGAACCACTCAACAAACA
TGATAAGGAAGCCACACAGAAGATCAAACGGAGTTTGAGTACGGCAGGTA
GTCGTTTGAGTCTCTCCatcgaagaaaaagaaaaggagaGACAGATACAA
CGAAAATTAGCCAACCCTAAAGCACTGGAAGCTGCCAACGAACTTAAGCA
ACAGGTTGGcttagaagaagaaaaaaagatgaGAGTGACCGCCCACCTGG
ATGGTGTTGGTATCATGATTTGTTCAGCCAAAGTTGACCTTGCACAAGCC
TTCGTTAAAGGGTTATCTGCTAAAGTACTGATGAAAGATGACTTATTAGA
AGTGAAAGCCAGCATGAAAGATATGCAAGTACAAGATAATGTTGGCGAAA
CAAAGTACAAAGACATCATTAGCATGCGATCTGATGAAGTGTTCGATTTA
GAGTTGGCTATTTACGAGAATGGATCTTCTGGTAGCAAGCAATACGATAT
GTCGTGTGTCGACACCAGTGTCAAACTGAACTTCGGTCAAATGCGCGTTG
TTTTCTTGTATAGATTCATACAAGACTTAATGTCATTCACCGAAAACTTC
GAAGAAGCACAGAAAGCAGTTGTGGAAGCTGGTAAAGCTGCCAAGGATAA
AGCTCTGGAAACAGCGACCGATTTGAATAGACATTCTTCTCGTGTCAAAC
TAAATGTGGTTCTGAAAGCACCGACTATTATCATTCCAGTTGGATCAAAC
AATGAATTGGCTTTACTGGTGGATCTGGGTGAATTGCGTATTTACAACAC
ATTCAAACTCCTCAACGATGATCAATACCATAAGAAATCTATCATCACTG
ATAACATGACCATTAAGTTATCCAATCTGAAATTGTTAAAAGCACTTATT
CAAGATGGTAAAGATTTCTTGCATCAACGAGCCATTATTGAACCTATGAT
GCTACAAATAACTATTGTTCGTAATTTAACGAAAGGTAACCATTCCATAC
CGGATGTTTCAGTTCAAGCAAAGATGCCAGCTATTCTGTTATCAATCAGT
GAAGAAGATGTGACCGTAGCTCTAAAGATTGTCCAAGGGAATCTCGCCGA
AGGTGAGTCACATGCGCCGAAGAAGCAAGCCAAGCCTGCCAAACAAACGT
TAAACGTGCCACAAGATCGTTTAGCAGACATTTACGAGGAGcctgaagat
gaagatgagaaTCGACAAGGATATCTTCAAACCAAACTATCCTTCGATCT
GGCTAAAATTGACATCAAGCTTTACTTGAAACCATCTGATATGACATTTG
AAGATGAATTTTTAGCGAGGACGGATGATTTGTTGTTAGCTTTGTTCACT
ATTGGTAACCTGTGTGTTGATGGAGACATCATGTCCACGCAAGCTATGAA
GATGAGCGTTCGATTGGACACTTTGGTGTTGGATGATATGAGACCTATCG
AGGAGCATGAAGGTGTTAAACGTATGATCAACTACAGTCCCGAGCCACTC
CTTGAAGAAGTCAAAACCTCTTCTCATAAACGACCAATCGACAACTCACG
AATGATCGAAATCCAAttcgatcaaacttcatcgcaagataaaaatatcg
acATCAAACTTTGTAACATGCTTTGTATATTCAACGTTGAGTTTATCATG
GTCCTGTTGAAAACGTTGCAAGCTGCCATACCTAAAGATGATAGTCTGCA
ACATGGCCATTCAATGAGTAGTCTAGACTCGGCGGCAGGGTCTGGCGGCA
GCGATGACGAGGACTCTTTAGAAGCCAGCGAGATTGTCCTCTGCACTGGT
GATCAAGAAAGACCTGAGACTAAAGTCTCTATCTTCGTCCATAACCCGCA
AATTGTTTTACTAGCAGATGCAAAGGATGTCAAAACAAATGCACTCTTTC
TTACAACCGagatcaattttcaatatttcgaaTTGCGAGATACTCAAAAA
ATGATTGGCGCTGTTTCTAACACCGCTATTTTGTCAACTGCTTTCAAGAA
TGACCATCGGAGTGATATATCAACAGTGTTGTCATTAGATTCCATCAATC
TCCACTCGTCATCACCCATCAATGGTAAACCTCATATGAGTGTCAGCACA
ACTTTGATCAAACTGAATATCTCACCCAAAACCATCCGAACTTTATCAGC
GTGTGCTGGTTACATCTCCAATGATCCAACAGATGAAGAAATCAAAGAAG
CTCGAAAAGCCATGCGTGATTTATGGCAAATTCAAACGTTCACCAATAAG
CGACCGTGGTATTTAAACCACCCACCACAACAAGTCTTAAGTGCTGGCAG
CTTCGTCCTTGCGCGAACGAGAACAGGAGAATATAAGCATGGTTTCTTAG
CTAAAAAGGATGTCTCGTATCAAGTCTATTTTTCAGAGGAGCGAGGAACA
GCCAGTCACCGAGCCATGGATATCTCATCTGTTGTTTTGGATATCGTACC
GCTGATCGGTGATCTATGTGTTGGATGTAATGTTTTAGCTGTGGAATCGA
AAGAACATGGATATCGTACTGGTCGAATTACTCAGGTTTGGGATTCGAAT
GTGGATAAAGATTCTTCGGATGGCGCCAAACAATCTGTTTCTGTCAAGAC
AACTGCTATTGCTCCAATCAAATACCTTGTCAATTTCTATGACAACCAAA
CGGAGAACTTCTTCCCGCCTGATGAACTTCGTATCATTGGTAAACCCATC
AAGGGGGTTGTCCCTGGACTAGGGGCGTGTGTTTACGCCCGCTTTAATGA
TGGTTTTTACTATCGGGGCAAAGTTGATGACATCGAGGATTATCGAATCC
GAGTGCAATTGGATGAGATCAGTGGAGAAATCGAACACGACATCGATGAT
CCGTCAGCCGTTATTTTGAACCTGACGCCTCAATACCGTCAAGTCAAAAA
GCATTTCAAAGTCATTGCATCCAAAGGAAGCACAACTAAAGGATATCATC
CGGGGAAAGTGACCGCCATCCAAGGTGAAGGAAATAACCGATTGTATTCG
ATACGCTTCGAAGACGGTACAATTAACCAAGTACCCATCacgaaattgat
tttgatgccAAAAGCACCTTTTGATGCTTTACCTGAAGTTGGCACATACG
TTTATTCCCGAGTGTCACGCGACGCTCCTTTATACGAGAAGGGTATCGTA
GCAGAGAAGAACACAATGATCTGCGTTAAACATTTAAATGGACGGAAATT
GGCTCACGAAATACAAAACATTCATTTTGTTGTCCGAAATATCGTTCCTC
TCGTGTCATCAttgaagGTTGGTTTGGACGTCATAGTGCAACCTGACAAT
GACGATCAGAAAATGTATTTGGCTGTCATTAGGGAAGTCACCAAAAAAGA
AGGTGACAAAACGAACCGTTATCTAGTGGAGTTTACGGATGGATCCAAGA
AGAGAGTGACGCCCAGCCGGATCCGTATACTTTCTCAATACGGAAGTGCA
GAAACGAGTGAAGAAAATGCTGACATTATCACAACAAGACAGGAGGAACT
AGTTCTCGATGTGCAAGGTATCTCATTACGTGTGGAAGGTTACTTGGGAG
GCGTGTTGACACCCATGCTCAAAATGGATTCCAAAATCACAGCTAACTTG
AAGGATTGGTCAAGCCAAATGAATGCACACGCTACTGTATCATTAGAAGC
CAGTTATTATAACGAAAACGTTGCCGAATGGGAGCCAGTTATTGAACCTT
TGATGGAGAAACGGAGGGAAAGACCGTGGCAACTCTCTGTCAATTACACG
ATGGAAGGTGACGACAATTCTGCTTCATCCACTTCCAACGAACTCGTTTT
ACAAAAACCGGAATCCAACCTGAAAATCAAATCTCAAGATAATCTTGAAT
TGACAATTTCAAAATCATGTCTTGCTTTACTCGGTGAATTGGGACAGGTG
TTTGGAGATGCAGTAGAATCTGTGGACGTTTTACCACAAGTCCTGGTCGA
AAAAGAACCTTTCATGATCGAAAACTTGCTCTCCAAGAAGGTGACAGTAA
CATTGAATGAACTTCTGCAGGGACCAAATGGAGATTCGACAATCGAGCTA
GCATCTTCTTCGAATCCTGTTGGCATTACTTTTGCTCCCAagaaatttga
gaaacgaaAGACCAACGATCTATACACAATCAATTTAtcgGTGGACGGTT
TTCATGACATTAAAGACATTGTGGTTCAAAGAAAGCGAAGCGTTATCTAT
GATCTTGTACCAATAAAACTATTATCAGCACAGTCTTCATATTCGATAGT
GGTACAAGTGAAGACAACAGACGGACAACGTATCATCGTACTCCGATCAC
CATTGCAGTTGAAAAATCACTTTCCAATGCCGTTGGATGTCAGCTACATT
TCCAAAGAAAACCAACCAGTTAAACTGACAACAGTGGGATCGGGAGATAT
CTATTCCTTCCCTTTGTTGTTAACCTACCACAGTGTTTTTCATCTCAAAC
CTGCTGGTTTCGACTACGGTGATTGCACAGAAGCTCTCAATTGGAGTGAT
TTGAAGACGAGCAACGAAAAACAGTTCTCCTGCCCTTCACCTGACAAAAG
TGCTGACCCTTTCTACATGCAGGTGGTGATGAAAGAGGAGACGTACTCTT
CCGTACACGGCATGTTGGACTGTGTACCACGTTACACGTTGGAGTGCTTT
CCCGTCATCACGCTGCATAATTACCTACCTTGCACTATTAATTATAAGAT
CAAGGGTATGGCGAAATCGGAAAGTCTACCAGGCGGACACAATTGGCCTT
TGTTTACCGTCAACTTCAGTGATAAACCTTCCATCTATATCGAGATTGAG
TCGTATAACAACCAAAGATGGGAAGGAGGTTTGACATTACCAACAAAACC
GGTAGATTCTTTGAACAAACCATCATTATCTTTCGTCATGATGTCTGGTG
AACGCAAAATGGAATTGGGTGTTTATTACCAGTTAGACGGTTCATTGAAC
ATCACCTTATATTCGCCTTACTGGCTTCTCAATAAAACTGGAAAACCACT
TGTCTATCAGCCAGCGGGGAGCAGCATCCAGCAAGTTCACCAAGAGAACG
ATGTAAATGCTCTTATGATGCTCGTCAAAGGGAAACATAAAAAGgcgaaa
gtgaaagtgaaaaataGCGAGTCATGGTCAAATGAATTTTCATTGGATAC
TGTTGGCAGTGGTGGTTCCTTGAAATGCAATGGTCCAAGAGATCGAGTTT
ATGAGATTGGTTTGAACATCAGTTTGTCATACTTTGGATTGACGAAGATT
GTGACGTTCACGCCACTCCGAATGTTATCTAACCACACCAAGTACACCAT
CAGTATGGCAGAAAGTAATTCTAAATCGTCAGAATGGCACACGGTAAACC
CTGACGAGaacattccatTCTGGCCGACGAAACTTCCTTTGGTCAACCTT
TACATTAACATCAATGGGCAAGATTCAGTGAAATTCAACCCTGAAGTTGG
AAAAACTTTACTGTTGAAGTTCCAGAATGAGGTTGGAGGAGTTTGCGTGG
ATTACCAAGAAAAGGACTCGTCCTCAGTCCTTTCGTTTAATCCGTACTTC
GCAGGTGCAGCTCCTGTGCGGCttgaaaatctttgcaaaaaGATCGGCAT
GATCGCTTATAAACAAGCAGGTTCGGTAATGGGTCACGTGTTAACACATG
ACCAATCAGTGTTGTACACGTGGGATGATCCAACCATGGAACAAGAATTG
ATTTGTTCCATTGTCAATGATGAAGCCAGTGAAACAAGGATCAAACTCGA
TGCCAACGATTTCGGACGAATGAGAGTTGGAGATGGTGCAATTTATTGGG
TTTCCTTTCTGGATGGTCTTCAACGTGTTCTATTGTTCACTGATAACTTC
AAATCTGCTTACTGCGCATGTCAGgaGCAAAATTTACGCCCAACCATGGA
AGTTGACTTTGAGATTGAGAGTTTTGGTTTGTCTCTGGTCAATGTTGATA
AGAGAATGGAGATTGGCTACTTAGCTATCCGACAAAGCAAGACTGTATGG
GAGCAACGCAAGAAAAAGAACCGCTGGAAAGCTTTACCGCTTGCCATGTG
TGAAGCTCTCGAAGAAGGTTATCTCAATTATCAAAACAGAAAAGGTGCAG
TCAAAGAGAAAGTTCTGGATAAGGAGGTGGATTACGAGAAGATGTTTATT
ACGAAACCTGAGAAGATTAAGATCAGAAGAACGTACCACAGCGGTCTTGG
TTTCAAATACACAATCTCACCCAATGAAATGCGTGTGCATGCTTCTATCA
GCTCAATACAGTTGGATAGCCATGTTCCAGGTTCGACCTTTCCAACAGTC
TTGCATATGGTTGAACCACCAAAATCTGTTGCTTCAGAAAACGCTCCAAA
GCCATTCTttgaattgagtttaatgaCAAGGATCGGTGATAAAAATGTGG
TCAATGAAGTcagCTATTGTCACGTGTTGATTCAAGAGATGGATGTGAGG
GTTGATATTGGATTTTTATTGGCTCTGATGGAACTCTTCAGTCATGCAAG
AGCTCGAACAACCGAGAAAGAACAATACGCGCTTGATATTGGCCAAGCAG
CAACAAAGTTTGAAGAAAGCGCTGAATTTCAGGCAGCCAAACAAGATCGA
TATTACGTTTTGAACGACTTTCATTTATCACCGCTAAAGATTCACGTCAG
TTTCTCTTTGACGGGTGGTTCCAAAGATGAAAATGCTATTGCTTCATTAC
ATGGTAACGTGTTGAACTTGTTGTTACAAAGTGTCGGACTGGCCTTCACT
GAAATACAAGACGTACAATTCAAATTAGCATGTTACGAAGTGCATAAGTC
CATGCAGAGTAATTCGCAGCTCGGTGATGGAATAACTAAACATTATCAAA
CACAGGCTATCAAGCAACTTTATGTGTTGGTACTCGGGCTAGACGTTCTT
GGTAATCCGTATGGTTTGATATCTGGTGTTGGAACCGGAGCAAAGAATTT
CTTCTACGAACCTTACCAGGGATTAATTCAAGGACCAGAAGAATTTGCGG
AAGGATTGGCGTATGGGGTGAAGAGTCTTGTTGGTGGAACCGTGGGTGGA
GTATCAGGAGCTGTGAGTAAGATTACCGGTACCTTCGGTAAAGGTTTGGC
TGCATTGACCTTGGATGAAGAATATCAACAAAAGAGACGTGAAAACATGA
GCCAACGCCCAACTAACCTCGGTGAAGGTCTCGCCAAAGGTGGTAAAGGC
CTTGTAAAGGGTATCGTGTCTGGTGTTACAGGGATCGTTACCAAACCCTA
TGAAGGTGCCAAGAATGATGGTGCAGGTGGCTTTTTTAAGGGCGTTGGAA
AAGGCCTGATTGGCGTGGTTGCACGCCCTGTTGGTGGAGTGGTAGATATG
GCCAGTAACACGTTTGATGGTTTGAAAAGCACGACATCTGGCGTGAAAGC
GATCGAGTTGAGCCGTGTTACTCGCGTCTTCCACGCAGATAAGGTTTTAC
GACCTTTCAATCTGTACGAAGCAGATGGAAACAAAATTCTTATGCAATGT
AACAAAGGAGAATACGCCAAGAAGAATTTTTATATCACTCATGTAGTGGA
CAAGAAGAACTATCTCATCCTCACTCAATCaaacATTTTGTATGTTGGAA
AGAACGAGTTGAAAATGGGTGAATGGGAATCggtttgggttatcgagttc
aATGAGCTAAAACGTGAACCAGAAGTGAAAGAGACAAAGATTATTTTCCA
TATCCATAATACGGACACGCGACGTTCAATTTTCAAGAAATCGACGAACA
CACGTGAAGTGATATTGGAGTCTAGTGCTGTTGCAGACTGGTTTATCTTA
AAGCTTAGAGATGCTAAAATGTTATAGatggtatttgaaTCTTTGGTTGC
TGACCTCTTGAACAAGTATCTGGGTCAATATGTGAAAAATCTTGATGCTT
CTCAATTGAAGATTGGCATTTGGGGAGGAAATGTTGTCCTGACAGAACTT
GAACTGAAAGATACAGCTCTGGATGATCTTGACTTACCCATAAAAGTTGT
TCGTGGATATTTGGgtAAATTGGTCTTGTCCATCCCATGGAAAAATCTTT
ACACTGAATCAACTGTTGTCGATATTCAAGATCTCCACCTTGTCGCTAAG
CCTAATTTTGACATCAAATACAATGAAGAACgcgaagaaaaatcaaaaca
tgacAAGAAACAACAACAGATTCACAATATCGAAGAAGCGAGGCAAAGAG
AAGAAGACAAAAAGAAAGGCGCCAAGAAAGAAGAGAGTGACGGTTTTGCT
GAGAAACTTGCAACAAACGTCATAAAAAATCTACAGGTTACGATCAAGAA
CATACATGTTCGATATGAAGACTCAATCAGTGATGTGAATGGACCCTTTT
CAGTCGGTCTTACAATGGAAAGTTTAACAGCACAAACCACAGATGAAGAT
TTTGTTCCAAAGATTATCAAAGAATCTGTCTCATTAATTCATAAGatggT
GAAATTAGACAATTTGGCTTTATATTGGAATCCAGGAGACGAACTGATTG
ATCCTTCACTTGATACCAAGCAATGGTTGgaagtTTCAACGAAGCAAATT
TCAACACACCAATCGAAGCCAGAGAAAACGAAATATATTTTGAGTCCCAT
GGTTGCAACGAAGAAATTGAAGCTGAACACCAAACCAGGTTCCAACCTTG
ACATCCCGAAGatgttTTTGAACTTGGTTTTGGAAGAACTTGGTATCATC
GTGGCAAGAAGTCAATATCATGGCGTGGTGCAACTGATTGAATCATTTGA
ACGAATGAATAGGAACCAACCTTTTCGTAAATACAGACCACATACCTCCG
TTCTTGGGAACGAAAGTATTTGGTGGAAGTACTGCATGTCCAGCATACTG
GAGGTGGATGTCAAAAGACGATCTCAAATGTGGAGCTGGAAGCATATTCA
AAAACATCGAGTTCTTTGCAAAGCTTACAAAGTGAAGTAcaaggaaaaat
tgaaacagaaaaATCCATCCAAACAAATTCTCACTGAACTAGAGaGCATG
GAGGATGAGTTGAATATTGCAAGCATCACCATTTTTCGACAGCTTGCAGC
TACAGAGGTTTTAACGGAACAAAAGAAGAAAGGCACTAAAGGAAGTTTCT
TCAGTTTCTTCTCCAGATCAAAAGAACCAGAAAAGTCTGCTGCTAATAAA
ATTGGAGATTTAATGGGTGATGACCAGGAGAAGGAAATGCAGAAATTGTA
TGACGCAATCGGTTATACTGAAAATGAAGTCATCACTCCCTTTCCTAAAG
AGTACGTGGCGATGTCAGTGGAATCGATTCTCCAGAAATTATTCATCAGC
CTCATCGATGACACAGATAAGGCGAAAGAATTCAAAGTGTTGGATTTTTC
ACTCAACAACATCATTGTAGAAGTTTTCCAAAGACCTTCTGCTCAAGCTC
TCAAATTATGTGCAAAGATAGGAGAGATGAAGTTATTTGGTACAGCTTCT
GCTCAATGTACACCTCtcatcatcaaaaacatgttaCAAGGTCGAGGTAT
GGAATTTCTGCCGTTGGTGGACTTCATCTTTGAGACGAATCCTTTGAAGA
AACCGGACATTGACCAATGTATCACTGCTATTTGTCAACCCTTAGAAATC
ATCTATGATGCTAACACGATCAACCATATCATTAGTTTCTTCAAACCTCC
TGAACATGTTATCTTGCAAGATTTACAAGACAAAGCGTATTCTACTTTCG
AAGATTTTAAAGTTTCAAGTACGGCTGGTCTTCTACATGCTATGGAACAA
AGAACGGTTATGGACATCGACATTGATGTTGGAGCATCTCATTTGATCAT
CCCTGAAAAAGGTTCTTACAATGGTTGTACAGATATGCTGGTGATCGACT
TTGGTAAAATCACGATGAGCAGCGATCCTAGTCAAATCAGACACCTTGAC
CCTAAGGACATTGAGGATGTGAATGAAGTACAAAGCAAAGCTTATGATCG
ATTCTTGTTGTCGCTTCAAGCTCTTCAAATATTACTCGTTAGAGAAGGTG
AAGATTTAAAGAGTGCTAAAAGCAACGTCAGTAAAGCTTCATCACACATT
TTGCATCCCATCAATTTCGATGGCAAACTTGCCAAAGCTATACTTCCACA
AGATCCACGTTTAAAACAGATATGTGTCTCTGGTGAATTATCTTCGCTGT
TTGTTTCTGTATCGGATGATAAAGTCAGTCGTCTCATCAAGCTAGCAGAC
TCGATACCACTCCCTCAATCACCTTCTCACGATAACATCGACGGAGAAGA
AAAACCTGAAGGACTCTTCACCAAGGCGTTGTCAATGATAAGCTTGACAG
GTGACAATGACACAGGGGTGGACATCGGAGGATTTTCCATCCCTGTACCG
ACATCTCCAACATCAGTGACGTCAGATGAAGATGAATACGGGACACCACC
TGATGGCTCCATATTACAGTTACAACAAGAAGCTGGTCCGGACTTTTCAT
CAGGAGTGGCGAACCAAGTCAAAGTGGACTTGAACTTTAAAATCCATAAA
GTGATGATCGCCATTGGTTTGACTGACAAAGCATTGAAACAGGAAAAAGA
ATGTCTGAAATTCATCGTGGACGACATCAATACAGAGgtGATACTACGAA
GATGGGATTTGTTCGTCAATGCAGAAGTTGGTCGTCTGGTGTTGAATGAA
ATGACATGGGGTGTTGATGGAGAACCTTTCGCCATCATGAGTACacccaa
aaacaccaaaatgttGAAATTCAGCTATCGGAGGTGTGAATTCAACGAAA
GTTTGAATCTCGGTCCAAGTTACTTTTATTCCAAAGAAGCGCAAGTCAGA
GCTTTACATTTCAAAGATGAATTTGGCGCCACGGATCAGATTTTAGATGT
ACAAGTGGCTACTTTATTTCTGATGCTTCATCAAGAAGCACTTTTGAGCA
TCATGTCATTGATCTACCAAGTACTGGAACCACTCAACAAACATGATAAG
GAAGCCACACAGAAGATCAAACGGAGTTTGAGTACGGCAGGTAGTCGTTT
GAGTCTCTCCatcgaagaaaaagaaaaggagaGACAGATACAACGAAAAT
TAGCCAACCCTAAAGCACTGGAAGCTGCCAACGAACTTAAGCAACAGGTT
GGcttagaagaagaaaaaaagatgaGAGTGACCGCCCACCTGGATGGTGT
TGGTATCATGATTTGTTCAGCCAAAGTTGACCTTGCACAAGCCTTCGTTA
AAGGGTTATCTGCTAAAGTACTGATGAAAGATGACTTATTAGAAGTGAAA
GCCAGCATGAAAGATATGCAAGTACAAGATAATGTTGGCGAAACAAAGTA
CAAAGACATCATTAGCATGCGATCTGATGAAGTGTTCGATTTAGAGTTGG
CTATTTACGAGAATGGATCTTCTGGTAGCAAGCAATACGATATGTCGTGT
GTCGACACCAGTGTCAAACTGAACTTCGGTCAAATGCGCGTTGTTTTCTT
GTATAGATTCATACAAGACTTAATGTCATTCACCGAAAACTTCGAAGAAG
CACAGAAAGCAGTTGTGGAAGCTGGTAAAGCTGCCAAGGATAAAGCTCTG
GAAACAGCGACCGATTTGAATAGACATTCTTCTCGTGTCAAACTAAATGT
GGTTCTGAAAGCACCGACTATTATCATTCCAGTTGGATCAAACAATGAAT
TGGCTTTACTGGTGGATCTGGGTGAATTGCGTATTTACAACACATTCAAA
CTCCTCAACGATGATCAATACCATAAGAAATCTATCATCACTGATAACAT
GACCATTAAGTTATCCAATCTGAAATTGTTAAAAGCACTTATTCAAGATG
GTAAAGATTTCTTGCATCAACGAGCCATTATTGAACCTATGATGCTACAA
ATAACTATTGTTCGTAATTTAACGAAAGGTAACCATTCCATACCGGATGT
TTCAGTTCAAGCAAAGATGCCAGCTATTCTGTTATCAATCAGTGAAGAAG
ATGTGACCGTAGCTCTAAAGATTGTCCAAGGGAATCTCGCCGAAGGTGAG
TCACATGCGCCGAAGAAGCAAGCCAAGCCTGCCAAACAAACGTTAAACGT
GCCACAAGATCGTTTAGCAGACATTTACGAGGAGcctgaagatgaagatg
agaaTCGACAAGGATATCTTCAAACCAAACTATCCTTCGATCTGGCTAAA
ATTGACATCAAGCTTTACTTGAAACCATCTGATATGACATTTGAAGATGA
ATTTTTAGCGAGGACGGATGATTTGTTGTTAGCTTTGTTCACTATTGGTA
ACCTGTGTGTTGATGGAGACATCATGTCCACGCAAGCTATGAAGATGAGC
GTTCGATTGGACACTTTGGTGTTGGATGATATGAGACCTATCGAGGAGCA
TGAAGGTGTTAAACGTATGATCAACTACAGTCCCGAGCCACTCCTTGAAG
AAGTCAAAACCTCTTCTCATAAACGACCAATCGACAACTCACGAATGATC
GAAATCCAAttcgatcaaacttcatcgcaagataaaaatatcgacATCAA
ACTTTGTAACATGCTTTGTATATTCAACGTTGAGTTTATCATGGTCCTGT
TGAAAACGTTGCAAGCTGCCATACCTAAAGATGATAGTCTGCAACATGGC
CATTCAATGAGTAGTCTAGACTCGGCGGCAGGGTCTGGCGGCAGCGATGA
CGAGGACTCTTTAGAAGCCAGCGAGATTGTCCTCTGCACTGGTGATCAAG
AAAGACCTGAGACTAAAGTCTCTATCTTCGTCCATAACCCGCAAATTGTT
TTACTAGCAGATGCAAAGGATGTCAAAACAAATGCACTCTTTCTTACAAC
CGagatcaattttcaatatttcgaaTTGCGAGATACTCAAAAAATGATTG
GCGCTGTTTCTAACACCGCTATTTTGTCAACTGCTTTCAAGAATGACCAT
CGGAGTGATATATCAACAGTGTTGTCATTAGATTCCATCAATCTCCACTC
GTCATCACCCATCAATGGTAAACCTCATATGAGTGTCAGCACAACTTTGA
TCAAACTGAATATCTCACCCAAAACCATCCGAACTTTATCAGCGTGTGCT
GGTTACATCTCCAATGATCCAACAGATGAAGAAATCAAAGAAGCTCGAAA
AGCCATGCGTGATTTATGGCAAATTCAAACGTTCACCAATAAGCGACCGT
GGTATTTAAACCACCCACCACAACAAGTCTTAAGTGCTGGCAGCTTCGTC
CTTGCGCGAACGAGAACAGGAGAATATAAGCATGGTTTCTTAGCTAAAAA
GGATGTCTCGTATCAAGTCTATTTTTCAGAGGAGCGAGGAACAGCCAGTC
ACCGAGCCATGGATATCTCATCTGTTGTTTTGGATATCGTACCGCTGATC
GGTGATCTATGTGTTGGATGTAATGTTTTAGCTGTGGAATCGAAAGAACA
TGGATATCGTACTGGTCGAATTACTCAGGTTTGGGATTCGAATGTGGATA
AAGATTCTTCGGATGGCGCCAAACAATCTGTTTCTGTCAAGACAACTGCT
ATTGCTCCAATCAAATACCTTGTCAATTTCTATGACAACCAAACGGAGAA
CTTCTTCCCGCCTGATGAACTTCGTATCATTGGTAAACCCATCAAGGGGG
TTGTCCCTGGACTAGGGGCGTGTGTTTACGCCCGCTTTAATGATGGTTTT
TACTATCGGGGCAAAGTTGATGACATCGAGGATTATCGAATCCGAGTGCA
ATTGGATGAGATCAGTGGAGAAATCGAACACGACATCGATGATCCGTCAG
CCGTTATTTTGAACCTGACGCCTCAATACCGTCAAGTCAAAAAGCATTTC
AAAGTCATTGCATCCAAAGGAAGCACAACTAAAGGATATCATCCGGGGAA
AGTGACCGCCATCCAAGGTGAAGGAAATAACCGATTGTATTCGATACGCT
TCGAAGACGGTACAATTAACCAAGTACCCATCacgaaattgattttgatg
ccAAAAGCACCTTTTGATGCTTTACCTGAAGTTGGCACATACGTTTATTC
CCGAGTGTCACGCGACGCTCCTTTATACGAGAAGGGTATCGTAGCAGAGA
AGAACACAATGATCTGCGTTAAACATTTAAATGGACGGAAATTGGCTCAC
GAAATACAAAACATTCATTTTGTTGTCCGAAATATCGTTCCTCTCGTGTC
ATCAttgaagGTTGGTTTGGACGTCATAGTGCAACCTGACAATGACGATC
AGAAAATGTATTTGGCTGTCATTAGGGAAGTCACCAAAAAAGAAGGTGAC
AAAACGAACCGTTATCTAGTGGAGTTTACGGATGGATCCAAGAAGAGAGT
GACGCCCAGCCGGATCCGTATACTTTCTCAATACGGAAGTGCAGAAACGA
GTGAAGAAAATGCTGACATTATCACAACAAGACAGGAGGAACTAGTTCTC
GATGTGCAAGGTATCTCATTACGTGTGGAAGGTTACTTGGGAGGCGTGTT
GACACCCATGCTCAAAATGGATTCCAAAATCACAGCTAACTTGAAGGATT
GGTCAAGCCAAATGAATGCACACGCTACTGTATCATTAGAAGCCAGTTAT
TATAACGAAAACGTTGCCGAATGGGAGCCAGTTATTGAACCTTTGATGGA
GAAACGGAGGGAAAGACCGTGGCAACTCTCTGTCAATTACACGATGGAAG
GTGACGACAATTCTGCTTCATCCACTTCCAACGAACTCGTTTTACAAAAA
CCGGAATCCAACCTGAAAATCAAATCTCAAGATAATCTTGAATTGACAAT
TTCAAAATCATGTCTTGCTTTACTCGGTGAATTGGGACAGGTGTTTGGAG
ATGCAGTAGAATCTGTGGACGTTTTACCACAAGTCCTGGTCGAAAAAGAA
CCTTTCATGATCGAAAACTTGCTCTCCAAGAAGGTGACAGTAACATTGAA
TGAACTTCTGCAGGGACCAAATGGAGATTCGACAATCGAGCTAGCATCTT
CTTCGAATCCTGTTGGCATTACTTTTGCTCCCAagaaatttgagaaacga
aAGACCAACGATCTATACACAATCAATTTAtcgGTGGACGGTTTTCATGA
CATTAAAGACATTGTGGTTCAAAGAAAGCGAAGCGTTATCTATGATCTTG
TACCAATAAAACTATTATCAGCACAGTCTTCATATTCGATAGTGGTACAA
GTGAAGACAACAGACGGACAACGTATCATCGTACTCCGATCACCATTGCA
GTTGAAAAATCACTTTCCAATGCCGTTGGATGTCAGCTACATTTCCAAAG
AAAACCAACCAGTTAAACTGACAACAGTGGGATCGGGAGATATCTATTCC
TTCCCTTTGTTGTTAACCTACCACAGTGTTTTTCATCTCAAACCTGCTGG
TTTCGACTACGGTGATTGCACAGAAGCTCTCAATTGGAGTGATTTGAAGA
CGAGCAACGAAAAACAGTTCTCCTGCCCTTCACCTGACAAAAGTGCTGAC
CCTTTCTACATGCAGGTGGTGATGAAAGAGGAGACGTACTCTTCCGTACA
CGGCATGTTGGACTGTGTACCACGTTACACGTTGGAGTGCTTTCCCGTCA
TCACGCTGCATAATTACCTACCTTGCACTATTAATTATAAGATCAAGGGT
ATGGCGAAATCGGAAAGTCTACCAGGCGGACACAATTGGCCTTTGTTTAC
CGTCAACTTCAGTGATAAACCTTCCATCTATATCGAGATTGAGTCGTATA
ACAACCAAAGATGGGAAGGAGGTTTGACATTACCAACAAAACCGGTAGAT
TCTTTGAACAAACCATCATTATCTTTCGTCATGATGTCTGGTGAACGCAA
AATGGAATTGGGTGTTTATTACCAGTTAGACGGTTCATTGAACATCACCT
TATATTCGCCTTACTGGCTTCTCAATAAAACTGGAAAACCACTTGTCTAT
CAGCCAGCGGGGAGCAGCATCCAGCAAGTTCACCAAGAGAACGATGTAAA
TGCTCTTATGATGCTCGTCAAAGGGAAACATAAAAAGgcgaaagtgaaag
tgaaaaataGCGAGTCATGGTCAAATGAATTTTCATTGGATACTGTTGGC
AGTGGTGGTTCCTTGAAATGCAATGGTCCAAGAGATCGAGTTTATGAGAT
TGGTTTGAACATCAGTTTGTCATACTTTGGATTGACGAAGATTGTGACGT
TCACGCCACTCCGAATGTTATCTAACCACACCAAGTACACCATCAGTATG
GCAGAAAGTAATTCTAAATCGTCAGAATGGCACACGGTAAACCCTGACGA
GaacattccatTCTGGCCGACGAAACTTCCTTTGGTCAACCTTTACATTA
ACATCAATGGGCAAGATTCAGTGAAATTCAACCCTGAAGTTGGAAAAACT
TTACTGTTGAAGTTCCAGAATGAGGTTGGAGGAGTTTGCGTGGATTACCA
AGAAAAGGACTCGTCCTCAGTCCTTTCGTTTAATCCGTACTTCGCAGGTG
CAGCTCCTGTGCGGCttgaaaatctttgcaaaaaGATCGGCATGATCGCT
TATAAACAAGCAGGTTCGGTAATGGGTCACGTGTTAACACATGACCAATC
AGTGTTGTACACGTGGGATGATCCAACCATGGAACAAGAATTGATTTGTT
CCATTGTCAATGATGAAGCCAGTGAAACAAGGATCAAACTCGATGCCAAC
GATTTCGGACGAATGAGAGTTGGAGATGGTGCAATTTATTGGGTTTCCTT
TCTGGATGGTCTTCAACGTGTTCTATTGTTCACTGATAACTTCAAATCTG
CTTACTGCGCATGTCAGgaGCAAAATTTACGCCCAACCATGGAAGTTGAC
TTTGAGATTGAGAGTTTTGGTTTGTCTCTGGTCAATGTTGATAAGAGAAT
GGAGATTGGCTACTTAGCTATCCGACAAAGCAAGACTGTATGGGAGCAAC
GCAAGAAAAAGAACCGCTGGAAAGCTTTACCGCTTGCCATGTGTGAAGCT
CTCGAAGAAGGTTATCTCAATTATCAAAACAGAAAAGGTGCAGTCAAAGA
GAAAGTTCTGGATAAGGAGGTGGATTACGAGAAGATGTTTATTACGAAAC
CTGAGAAGATTAAGATCAGAAGAACGTACCACAGCGGTCTTGGTTTCAAA
TACACAATCTCACCCAATGAAATGCGTGTGCATGCTTCTATCAGCTCAAT
ACAGTTGGATAGCCATGTTCCAGGTTCGACCTTTCCAACAGTCTTGCATA
TGGTTGAACCACCAAAATCTGTTGCTTCAGAAAACGCTCCAAAGCCATTC
TttgaattgagtttaatgaCAAGGATCGGTGATAAAAATGTGGTCAATGA
AGTcagCTATTGTCACGTGTTGATTCAAGAGATGGATGTGAGGGTTGATA
TTGGATTTTTATTGGCTCTGATGGAACTCTTCAGTCATGCAAGAGCTCGA
ACAACCGAGAAAGAACAATACGCGCTTGATATTGGCCAAGCAGCAACAAA
GTTTGAAGAAAGCGCTGAATTTCAGGCAGCCAAACAAGATCGATATTACG
TTTTGAACGACTTTCATTTATCACCGCTAAAGATTCACGTCAGTTTCTCT
TTGACGGGTGGTTCCAAAGATGAAAATGCTATTGCTTCATTACATGGTAA
CGTGTTGAACTTGTTGTTACAAAGTGTCGGACTGGCCTTCACTGAAATAC
AAGACGTACAATTCAAATTAGCATGTTACGAAGTGCATAAGTCCATGCAG
AGTAATTCGCAGCTCGGTGATGGAATAACTAAACATTATCAAACACAGGC
TATCAAGCAACTTTATGTGTTGGTACTCGGGCTAGACGTTCTTGGTAATC
CGTATGGTTTGATATCTGGTGTTGGAACCGGAGCAAAGAATTTCTTCTAC
GAACCTTACCAGGGATTAATTCAAGGACCAGAAGAATTTGCGGAAGGATT
GGCGTATGGGGTGAAGAGTCTTGTTGGTGGAACCGTGGGTGGAGTATCAG
GAGCTGTGAGTAAGATTACCGGTACCTTCGGTAAAGGTTTGGCTGCATTG
ACCTTGGATGAAGAATATCAACAAAAGAGACGTGAAAACATGAGCCAACG
CCCAACTAACCTCGGTGAAGGTCTCGCCAAAGGTGGTAAAGGCCTTGTAA
AGGGTATCGTGTCTGGTGTTACAGGGATCGTTACCAAACCCTATGAAGGT
GCCAAGAATGATGGTGCAGGTGGCTTTTTTAAGGGCGTTGGAAAAGGCCT
GATTGGCGTGGTTGCACGCCCTGTTGGTGGAGTGGTAGATATGGCCAGTA
ACACGTTTGATGGTTTGAAAAGCACGACATCTGGCGTGAAAGCGATCGAG
TTGAGCCGTGTTACTCGCGTCTTCCACGCAGATAAGGTTTTACGACCTTT
CAATCTGTACGAAGCAGATGGAAACAAAATTCTTATGCAATGTAACAAAG
GAGAATACGCCAAGAAGAATTTTTATATCACTCATGTAGTGGACAAGAAG
AACTATCTCATCCTCACTCAATCaaacATTTTGTATGTTGGAAAGAACGA
GTTGAAAATGGGTGAATGGGAATCggtttgggttatcgagttcaATGAGC
TAAAACGTGAACCAGAAGTGAAAGAGACAAAGATTATTTTCCATATCCAT
AATACGGACACGCGACGTTCAATTTTCAAGAAATCGACGAACACACGTGA
AGTGATATTGGAGTCTAGTGCTGTTGCAGACTGGTTTATCTTAAAGCTTA
GAGATGCTAAAATGTTATAGatggtatttgaaTCTTTGGTTGCTGACCTC
TTGAACAAGTATCTGGGTCAATATGTGAAAAATCTTGATGCTTCTCAATT
GAAGATTGGCATTTGGGGAGGAAATGTTGTCCTGACAGAACTTGAACTGA
AAGATACAGCTCTGGATGATCTTGACTTACCCATAAAAGTTGTTCGTGGA
TATTTGGgtAAATTGGTCTTGTCCATCCCATGGAAAAATCTTTACACTGA
ATCAACTGTTGTCGATATTCAAGATCTCCACCTTGTCGCTAAGCCTAATT
TTGACATCAAATACAATGAAGAACgcgaagaaaaatcaaaacatgacAAG
AAACAACAACAGATTCACAATATCGAAGAAGCGAGGCAAAGAGAAGAAGA
CAAAAAGAAAGGCGCCAAGAAAGAAGAGAGTGACGGTTTTGCTGAGAAAC
TTGCAACAAACGTCATAAAAAATCTACAGGTTACGATCAAGAACATACAT
GTTCGATATGAAGACTCAATCAGTGATGTGAATGGACCCTTTTCAGTCGG
TCTTACAATGGAAAGTTTAACAGCACAAACCACAGATGAAGATTTTGTTC
CAAAGATTATCAAAGAATCTGTCTCATTAATTCATAAGatggTGAAATTA
GACAATTTGGCTTTATATTGGAATCCAGGAGACGAACTGATTGATCCTTC
ACTTGATACCAAGCAATGGTTGgaagtTTCAACGAAGCAAATTTCAACAC
ACCAATCGAAGCCAGAGAAAACGAAATATATTTTGAGTCCCATGGTTGCA
ACGAAGAAATTGAAGCTGAACACCAAACCAGGTTCCAACCTTGACATCCC
GAAGatgttTTTGAACTTGGTTTTGGAAGAACTTGGTATCATCGTGGCAA
GAAGTCAATATCATGGCGTGGTGCAACTGATTGAATCATTTGAACGAATG
AATAGGAACCAACCTTTTCGTAAATACAGACCACATACCTCCGTTCTTGG
GAACGAAAGTATTTGGTGGAAGTACTGCATGTCCAGCATACTGGAGGTGG
ATGTCAAAAGACGATCTCAAATGTGGAGCTGGAAGCATATTCAAAAACAT
CGAGTTCTTTGCAAAGCTTACAAAGTGAAGTAcaaggaaaaattgaaaca
gaaaaATCCATCCAAACAAATTCTCACTGAACTAGAGaGCATGGAGGATG
AGTTGAATATTGCAAGCATCACCATTTTTCGACAGCTTGCAGCTACAGAG
GTTTTAACGGAACAAAAGAAGAAAGGCACTAAAGGAAGTTTCTTCAGTTT
CTTCTCCAGATCAAAAGAACCAGAAAAGTCTGCTGCTAATAAAATTGGAG
ATTTAATGGGTGATGACCAGGAGAAGGAAATGCAGAAATTGTATGACGCA
ATCGGTTATACTGAAAATGAAGTCATCACTCCCTTTCCTAAAGAGTACGT
GGCGATGTCAGTGGAATCGATTCTCCAGAAATTATTCATCAGCCTCATCG
ATGACACAGATAAGGCGAAAGAATTCAAAGTGTTGGATTTTTCACTCAAC
AACATCATTGTAGAAGTTTTCCAAAGACCTTCTGCTCAAGCTCTCAAATT
ATGTGCAAAGATAGGAGAGATGAAGTTATTTGGTACAGCTTCTGCTCAAT
GTACACCTCtcatcatcaaaaacatgttaCAAGGTCGAGGTATGGAATTT
CTGCCGTTGGTGGACTTCATCTTTGAGACGAATCCTTTGAAGAAACCGGA
CATTGACCAATGTATCACTGCTATTTGTCAACCCTTAGAAATCATCTATG
ATGCTAACACGATCAACCATATCATTAGTTTCTTCAAACCTCCTGAACAT
GTTATCTTGCAAGATTTACAAGACAAAGCGTATTCTACTTTCGAAGATTT
TAAAGTTTCAAGTACGGCTGGTCTTCTACATGCTATGGAACAAAGAACGG
TTATGGACATCGACATTGATGTTGGAGCATCTCATTTGATCATCCCTGAA
AAAGGTTCTTACAATGGTTGTACAGATATGCTGGTGATCGACTTTGGTAA
AATCACGATGAGCAGCGATCCTAGTCAAATCAGACACCTTGACCCTAAGG
ACATTGAGGATGTGAATGAAGTACAAAGCAAAGCTTATGATCGATTCTTG
TTGTCGCTTCAAGCTCTTCAAATATTACTCGTTAGAGAAGGTGAAGATTT
AAAGAGTGCTAAAAGCAACGTCAGTAAAGCTTCATCACACATTTTGCATC
CCATCAATTTCGATGGCAAACTTGCCAAAGCTATACTTCCACAAGATCCA
CGTTTAAAACAGATATGTGTCTCTGGTGAATTATCTTCGCTGTTTGTTTC
TGTATCGGATGATAAAGTCAGTCGTCTCATCAAGCTAGCAGACTCGATAC
CACTCCCTCAATCACCTTCTCACGATAACATCGACGGAGAAGAAAAACCT
GAAGGACTCTTCACCAAGGCGTTGTCAATGATAAGCTTGACAGGTGACAA
TGACACAGGGGTGGACATCGGAGGATTTTCCATCCCTGTACCGACATCTC
CAACATCAGTGACGTCAGATGAAGATGAATACGGGACACCACCTGATGGC
TCCATATTACAGTTACAACAAGAAGCTGGTCCGGACTTTTCATCAGGAGT
GGCGAACCAAGTCAAAGTGGACTTGAACTTTAAAATCCATAAAGTGATGA
TCGCCATTGGTTTGACTGACAAAGCATTGAAACAGGAAAAAGAATGTCTG
AAATTCATCGTGGACGACATCAATACAGAGgtGATACTACGAAGATGGGA
TTTGTTCGTCAATGCAGAAGTTGGTCGTCTGGTGTTGAATGAAATGACAT
GGGGTGTTGATGGAGAACCTTTCGCCATCATGAGTACacccaaaaacacc
aaaatgttGAAATTCAGCTATCGGAGGTGTGAATTCAACGAAAGTTTGAA
TCTCGGTCCAAGTTACTTTTATTCCAAAGAAGCGCAAGTCAGAGCTTTAC
ATTTCAAAGATGAATTTGGCGCCACGGATCAGATTTTAGATGTACAAGTG
GCTACTTTATTTCTGATGCTTCATCAAGAAGCACTTTTGAGCATCATGTC
ATTGATCTACCAAGTACTGGAACCACTCAACAAACATGATAAGGAAGCCA
CACAGAAGATCAAACGGAGTTTGAGTACGGCAGGTAGTCGTTTGAGTCTC
TCCatcgaagaaaaagaaaaggagaGACAGATACAACGAAAATTAGCCAA
CCCTAAAGCACTGGAAGCTGCCAACGAACTTAAGCAACAGGTTGGcttag
aagaagaaaaaaagatgaGAGTGACCGCCCACCTGGATGGTGTTGGTATC
ATGATTTGTTCAGCCAAAGTTGACCTTGCACAAGCCTTCGTTAAAGGGTT
ATCTGCTAAAGTACTGATGAAAGATGACTTATTAGAAGTGAAAGCCAGCA
TGAAAGATATGCAAGTACAAGATAATGTTGGCGAAACAAAGTACAAAGAC
ATCATTAGCATGCGATCTGATGAAGTGTTCGATTTAGAGTTGGCTATTTA
CGAGAATGGATCTTCTGGTAGCAAGCAATACGATATGTCGTGTGTCGACA
CCAGTGTCAAACTGAACTTCGGTCAAATGCGCGTTGTTTTCTTGTATAGA
TTCATACAAGACTTAATGTCATTCACCGAAAACTTCGAAGAAGCACAGAA
AGCAGTTGTGGAAGCTGGTAAAGCTGCCAAGGATAAAGCTCTGGAAACAG
CGACCGATTTGAATAGACATTCTTCTCGTGTCAAACTAAATGTGGTTCTG
AAAGCACCGACTATTATCATTCCAGTTGGATCAAACAATGAATTGGCTTT
ACTGGTGGATCTGGGTGAATTGCGTATTTACAACACATTCAAACTCCTCA
ACGATGATCAATACCATAAGAAATCTATCATCACTGATAACATGACCATT
AAGTTATCCAATCTGAAATTGTTAAAAGCACTTATTCAAGATGGTAAAGA
TTTCTTGCATCAACGAGCCATTATTGAACCTATGATGCTACAAATAACTA
TTGTTCGTAATTTAACGAAAGGTAACCATTCCATACCGGATGTTTCAGTT
CAAGCAAAGATGCCAGCTATTCTGTTATCAATCAGTGAAGAAGATGTGAC
CGTAGCTCTAAAGATTGTCCAAGGGAATCTCGCCGAAGGTGAGTCACATG
CGCCGAAGAAGCAAGCCAAGCCTGCCAAACAAACGTTAAACGTGCCACAA
GATCGTTTAGCAGACATTTACGAGGAGcctgaagatgaagatgagaaTCG
ACAAGGATATCTTCAAACCAAACTATCCTTCGATCTGGCTAAAATTGACA
TCAAGCTTTACTTGAAACCATCTGATATGACATTTGAAGATGAATTTTTA
GCGAGGACGGATGATTTGTTGTTAGCTTTGTTCACTATTGGTAACCTGTG
TGTTGATGGAGACATCATGTCCACGCAAGCTATGAAGATGAGCGTTCGAT
TGGACACTTTGGTGTTGGATGATATGAGACCTATCGAGGAGCATGAAGGT
GTTAAACGTATGATCAACTACAGTCCCGAGCCACTCCTTGAAGAAGTCAA
AACCTCTTCTCATAAACGACCAATCGACAACTCACGAATGATCGAAATCC
AAttcgatcaaacttcatcgcaagataaaaatatcgacATCAAACTTTGT
AACATGCTTTGTATATTCAACGTTGAGTTTATCATGGTCCTGTTGAAAAC
GTTGCAAGCTGCCATACCTAAAGATGATAGTCTGCAACATGGCCATTCAA
TGAGTAGTCTAGACTCGGCGGCAGGGTCTGGCGGCAGCGATGACGAGGAC
TCTTTAGAAGCCAGCGAGATTGTCCTCTGCACTGGTGATCAAGAAAGACC
TGAGACTAAAGTCTCTATCTTCGTCCATAACCCGCAAATTGTTTTACTAG
CAGATGCAAAGGATGTCAAAACAAATGCACTCTTTCTTACAACCGagatc
aattttcaatatttcgaaTTGCGAGATACTCAAAAAATGATTGGCGCTGT
TTCTAACACCGCTATTTTGTCAACTGCTTTCAAGAATGACCATCGGAGTG
ATATATCAACAGTGTTGTCATTAGATTCCATCAATCTCCACTCGTCATCA
CCCATCAATGGTAAACCTCATATGAGTGTCAGCACAACTTTGATCAAACT
GAATATCTCACCCAAAACCATCCGAACTTTATCAGCGTGTGCTGGTTACA
TCTCCAATGATCCAACAGATGAAGAAATCAAAGAAGCTCGAAAAGCCATG
CGTGATTTATGGCAAATTCAAACGTTCACCAATAAGCGACCGTGGTATTT
AAACCACCCACCACAACAAGTCTTAAGTGCTGGCAGCTTCGTCCTTGCGC
GAACGAGAACAGGAGAATATAAGCATGGTTTCTTAGCTAAAAAGGATGTC
TCGTATCAAGTCTATTTTTCAGAGGAGCGAGGAACAGCCAGTCACCGAGC
CATGGATATCTCATCTGTTGTTTTGGATATCGTACCGCTGATCGGTGATC
TATGTGTTGGATGTAATGTTTTAGCTGTGGAATCGAAAGAACATGGATAT
CGTACTGGTCGAATTACTCAGGTTTGGGATTCGAATGTGGATAAAGATTC
TTCGGATGGCGCCAAACAATCTGTTTCTGTCAAGACAACTGCTATTGCTC
CAATCAAATACCTTGTCAATTTCTATGACAACCAAACGGAGAACTTCTTC
CCGCCTGATGAACTTCGTATCATTGGTAAACCCATCAAGGGGGTTGTCCC
TGGACTAGGGGCGTGTGTTTACGCCCGCTTTAATGATGGTTTTTACTATC
GGGGCAAAGTTGATGACATCGAGGATTATCGAATCCGAGTGCAATTGGAT
GAGATCAGTGGAGAAATCGAACACGACATCGATGATCCGTCAGCCGTTAT
TTTGAACCTGACGCCTCAATACCGTCAAGTCAAAAAGCATTTCAAAGTCA
TTGCATCCAAAGGAAGCACAACTAAAGGATATCATCCGGGGAAAGTGACC
GCCATCCAAGGTGAAGGAAATAACCGATTGTATTCGATACGCTTCGAAGA
CGGTACAATTAACCAAGTACCCATCacgaaattgattttgatgccAAAAG
CACCTTTTGATGCTTTACCTGAAGTTGGCACATACGTTTATTCCCGAGTG
TCACGCGACGCTCCTTTATACGAGAAGGGTATCGTAGCAGAGAAGAACAC
AATGATCTGCGTTAAACATTTAAATGGACGGAAATTGGCTCACGAAATAC
AAAACATTCATTTTGTTGTCCGAAATATCGTTCCTCTCGTGTCATCAttg
aagGTTGGTTTGGACGTCATAGTGCAACCTGACAATGACGATCAGAAAAT
GTATTTGGCTGTCATTAGGGAAGTCACCAAAAAAGAAGGTGACAAAACGA
ACCGTTATCTAGTGGAGTTTACGGATGGATCCAAGAAGAGAGTGACGCCC
AGCCGGATCCGTATACTTTCTCAATACGGAAGTGCAGAAACGAGTGAAGA
AAATGCTGACATTATCACAACAAGACAGGAGGAACTAGTTCTCGATGTGC
AAGGTATCTCATTACGTGTGGAAGGTTACTTGGGAGGCGTGTTGACACCC
ATGCTCAAAATGGATTCCAAAATCACAGCTAACTTGAAGGATTGGTCAAG
CCAAATGAATGCACACGCTACTGTATCATTAGAAGCCAGTTATTATAACG
AAAACGTTGCCGAATGGGAGCCAGTTATTGAACCTTTGATGGAGAAACGG
AGGGAAAGACCGTGGCAACTCTCTGTCAATTACACGATGGAAGGTGACGA
CAATTCTGCTTCATCCACTTCCAACGAACTCGTTTTACAAAAACCGGAAT
CCAACCTGAAAATCAAATCTCAAGATAATCTTGAATTGACAATTTCAAAA
TCATGTCTTGCTTTACTCGGTGAATTGGGACAGGTGTTTGGAGATGCAGT
AGAATCTGTGGACGTTTTACCACAAGTCCTGGTCGAAAAAGAACCTTTCA
TGATCGAAAACTTGCTCTCCAAGAAGGTGACAGTAACATTGAATGAACTT
CTGCAGGGACCAAATGGAGATTCGACAATCGAGCTAGCATCTTCTTCGAA
TCCTGTTGGCATTACTTTTGCTCCCAagaaatttgagaaacgaaAGACCA
ACGATCTATACACAATCAATTTAtcgGTGGACGGTTTTCATGACATTAAA
GACATTGTGGTTCAAAGAAAGCGAAGCGTTATCTATGATCTTGTACCAAT
AAAACTATTATCAGCACAGTCTTCATATTCGATAGTGGTACAAGTGAAGA
CAACAGACGGACAACGTATCATCGTACTCCGATCACCATTGCAGTTGAAA
AATCACTTTCCAATGCCGTTGGATGTCAGCTACATTTCCAAAGAAAACCA
ACCAGTTAAACTGACAACAGTGGGATCGGGAGATATCTATTCCTTCCCTT
TGTTGTTAACCTACCACAGTGTTTTTCATCTCAAACCTGCTGGTTTCGAC
TACGGTGATTGCACAGAAGCTCTCAATTGGAGTGATTTGAAGACGAGCAA
CGAAAAACAGTTCTCCTGCCCTTCACCTGACAAAAGTGCTGACCCTTTCT
ACATGCAGGTGGTGATGAAAGAGGAGACGTACTCTTCCGTACACGGCATG
TTGGACTGTGTACCACGTTACACGTTGGAGTGCTTTCCCGTCATCACGCT
GCATAATTACCTACCTTGCACTATTAATTATAAGATCAAGGGTATGGCGA
AATCGGAAAGTCTACCAGGCGGACACAATTGGCCTTTGTTTACCGTCAAC
TTCAGTGATAAACCTTCCATCTATATCGAGATTGAGTCGTATAACAACCA
AAGATGGGAAGGAGGTTTGACATTACCAACAAAACCGGTAGATTCTTTGA
ACAAACCATCATTATCTTTCGTCATGATGTCTGGTGAACGCAAAATGGAA
TTGGGTGTTTATTACCAGTTAGACGGTTCATTGAACATCACCTTATATTC
GCCTTACTGGCTTCTCAATAAAACTGGAAAACCACTTGTCTATCAGCCAG
CGGGGAGCAGCATCCAGCAAGTTCACCAAGAGAACGATGTAAATGCTCTT
ATGATGCTCGTCAAAGGGAAACATAAAAAGgcgaaagtgaaagtgaaaaa
taGCGAGTCATGGTCAAATGAATTTTCATTGGATACTGTTGGCAGTGGTG
GTTCCTTGAAATGCAATGGTCCAAGAGATCGAGTTTATGAGATTGGTTTG
AACATCAGTTTGTCATACTTTGGATTGACGAAGATTGTGACGTTCACGCC
ACTCCGAATGTTATCTAACCACACCAAGTACACCATCAGTATGGCAGAAA
GTAATTCTAAATCGTCAGAATGGCACACGGTAAACCCTGACGAGaacatt
ccatTCTGGCCGACGAAACTTCCTTTGGTCAACCTTTACATTAACATCAA
TGGGCAAGATTCAGTGAAATTCAACCCTGAAGTTGGAAAAACTTTACTGT
TGAAGTTCCAGAATGAGGTTGGAGGAGTTTGCGTGGATTACCAAGAAAAG
GACTCGTCCTCAGTCCTTTCGTTTAATCCGTACTTCGCAGGTGCAGCTCC
TGTGCGGCttgaaaatctttgcaaaaaGATCGGCATGATCGCTTATAAAC
AAGCAGGTTCGGTAATGGGTCACGTGTTAACACATGACCAATCAGTGTTG
TACACGTGGGATGATCCAACCATGGAACAAGAATTGATTTGTTCCATTGT
CAATGATGAAGCCAGTGAAACAAGGATCAAACTCGATGCCAACGATTTCG
GACGAATGAGAGTTGGAGATGGTGCAATTTATTGGGTTTCCTTTCTGGAT
GGTCTTCAACGTGTTCTATTGTTCACTGATAACTTCAAATCTGCTTACTG
CGCATGTCAGgaGCAAAATTTACGCCCAACCATGGAAGTTGACTTTGAGA
TTGAGAGTTTTGGTTTGTCTCTGGTCAATGTTGATAAGAGAATGGAGATT
GGCTACTTAGCTATCCGACAAAGCAAGACTGTATGGGAGCAACGCAAGAA
AAAGAACCGCTGGAAAGCTTTACCGCTTGCCATGTGTGAAGCTCTCGAAG
AAGGTTATCTCAATTATCAAAACAGAAAAGGTGCAGTCAAAGAGAAAGTT
CTGGATAAGGAGGTGGATTACGAGAAGATGTTTATTACGAAACCTGAGAA
GATTAAGATCAGAAGAACGTACCACAGCGGTCTTGGTTTCAAATACACAA
TCTCACCCAATGAAATGCGTGTGCATGCTTCTATCAGCTCAATACAGTTG
GATAGCCATGTTCCAGGTTCGACCTTTCCAACAGTCTTGCATATGGTTGA
ACCACCAAAATCTGTTGCTTCAGAAAACGCTCCAAAGCCATTCTttgaat
tgagtttaatgaCAAGGATCGGTGATAAAAATGTGGTCAATGAAGTcagC
TATTGTCACGTGTTGATTCAAGAGATGGATGTGAGGGTTGATATTGGATT
TTTATTGGCTCTGATGGAACTCTTCAGTCATGCAAGAGCTCGAACAACCG
AGAAAGAACAATACGCGCTTGATATTGGCCAAGCAGCAACAAAGTTTGAA
GAAAGCGCTGAATTTCAGGCAGCCAAACAAGATCGATATTACGTTTTGAA
CGACTTTCATTTATCACCGCTAAAGATTCACGTCAGTTTCTCTTTGACGG
GTGGTTCCAAAGATGAAAATGCTATTGCTTCATTACATGGTAACGTGTTG
AACTTGTTGTTACAAAGTGTCGGACTGGCCTTCACTGAAATACAAGACGT
ACAATTCAAATTAGCATGTTACGAAGTGCATAAGTCCATGCAGAGTAATT
CGCAGCTCGGTGATGGAATAACTAAACATTATCAAACACAGGCTATCAAG
CAACTTTATGTGTTGGTACTCGGGCTAGACGTTCTTGGTAATCCGTATGG
TTTGATATCTGGTGTTGGAACCGGAGCAAAGAATTTCTTCTACGAACCTT
ACCAGGGATTAATTCAAGGACCAGAAGAATTTGCGGAAGGATTGGCGTAT
GGGGTGAAGAGTCTTGTTGGTGGAACCGTGGGTGGAGTATCAGGAGCTGT
GAGTAAGATTACCGGTACCTTCGGTAAAGGTTTGGCTGCATTGACCTTGG
ATGAAGAATATCAACAAAAGAGACGTGAAAACATGAGCCAACGCCCAACT
AACCTCGGTGAAGGTCTCGCCAAAGGTGGTAAAGGCCTTGTAAAGGGTAT
CGTGTCTGGTGTTACAGGGATCGTTACCAAACCCTATGAAGGTGCCAAGA
ATGATGGTGCAGGTGGCTTTTTTAAGGGCGTTGGAAAAGGCCTGATTGGC
GTGGTTGCACGCCCTGTTGGTGGAGTGGTAGATATGGCCAGTAACACGTT
TGATGGTTTGAAAAGCACGACATCTGGCGTGAAAGCGATCGAGTTGAGCC
GTGTTACTCGCGTCTTCCACGCAGATAAGGTTTTACGACCTTTCAATCTG
TACGAAGCAGATGGAAACAAAATTCTTATGCAATGTAACAAAGGAGAATA
CGCCAAGAAGAATTTTTATATCACTCATGTAGTGGACAAGAAGAACTATC
TCATCCTCACTCAATCaaacATTTTGTATGTTGGAAAGAACGAGTTGAAA
ATGGGTGAATGGGAATCggtttgggttatcgagttcaATGAGCTAAAACG
TGAACCAGAAGTGAAAGAGACAAAGATTATTTTCCATATCCATAATACGG
ACACGCGACGTTCAATTTTCAAGAAATCGACGAACACACGTGAAGTGATA
TTGGAGTCTAGTGCTGTTGCAGACTGGTTTATCTTAAAGCTTAGAGATGC
TAAAATGTTATAGatggtatttgaaTCTTTGGTTGCTGACCTCTTGAACA
AGTATCTGGGTCAATATGTGAAAAATCTTGATGCTTCTCAATTGAAGATT
GGCATTTGGGGAGGAAATGTTGTCCTGACAGAACTTGAACTGAAAGATAC
AGCTCTGGATGATCTTGACTTACCCATAAAAGTTGTTCGTGGATATTTGG
gtAAATTGGTCTTGTCCATCCCATGGAAAAATCTTTACACTGAATCAACT
GTTGTCGATATTCAAGATCTCCACCTTGTCGCTAAGCCTAATTTTGACAT
CAAATACAATGAAGAACgcgaagaaaaatcaaaacatgacAAGAAACAAC
AACAGATTCACAATATCGAAGAAGCGAGGCAAAGAGAAGAAGACAAAAAG
AAAGGCGCCAAGAAAGAAGAGAGTGACGGTTTTGCTGAGAAACTTGCAAC
AAACGTCATAAAAAATCTACAGGTTACGATCAAGAACATACATGTTCGAT
ATGAAGACTCAATCAGTGATGTGAATGGACCCTTTTCAGTCGGTCTTACA
ATGGAAAGTTTAACAGCACAAACCACAGATGAAGATTTTGTTCCAAAGAT
TATCAAAGAATCTGTCTCATTAATTCATAAGatggTGAAATTAGACAATT
TGGCTTTATATTGGAATCCAGGAGACGAACTGATTGATCCTTCACTTGAT
ACCAAGCAATGGTTGgaagtTTCAACGAAGCAAATTTCAACACACCAATC
GAAGCCAGAGAAAACGAAATATATTTTGAGTCCCATGGTTGCAACGAAGA
AATTGAAGCTGAACACCAAACCAGGTTCCAACCTTGACATCCCGAAGatg
ttTTTGAACTTGGTTTTGGAAGAACTTGGTATCATCGTGGCAAGAAGTCA
ATATCATGGCGTGGTGCAACTGATTGAATCATTTGAACGAATGAATAGGA
ACCAACCTTTTCGTAAATACAGACCACATACCTCCGTTCTTGGGAACGAA
AGTATTTGGTGGAAGTACTGCATGTCCAGCATACTGGAGGTGGATGTCAA
AAGACGATCTCAAATGTGGAGCTGGAAGCATATTCAAAAACATCGAGTTC
TTTGCAAAGCTTACAAAGTGAAGTAcaaggaaaaattgaaacagaaaaAT
CCATCCAAACAAATTCTCACTGAACTAGAGaGCATGGAGGATGAGTTGAA
TATTGCAAGCATCACCATTTTTCGACAGCTTGCAGCTACAGAGGTTTTAA
CGGAACAAAAGAAGAAAGGCACTAAAGGAAGTTTCTTCAGTTTCTTCTCC
AGATCAAAAGAACCAGAAAAGTCTGCTGCTAATAAAATTGGAGATTTAAT
GGGTGATGACCAGGAGAAGGAAATGCAGAAATTGTATGACGCAATCGGTT
ATACTGAAAATGAAGTCATCACTCCCTTTCCTAAAGAGTACGTGGCGATG
TCAGTGGAATCGATTCTCCAGAAATTATTCATCAGCCTCATCGATGACAC
AGATAAGGCGAAAGAATTCAAAGTGTTGGATTTTTCACTCAACAACATCA
TTGTAGAAGTTTTCCAAAGACCTTCTGCTCAAGCTCTCAAATTATGTGCA
AAGATAGGAGAGATGAAGTTATTTGGTACAGCTTCTGCTCAATGTACACC
TCtcatcatcaaaaacatgttaCAAGGTCGAGGTATGGAATTTCTGCCGT
TGGTGGACTTCATCTTTGAGACGAATCCTTTGAAGAAACCGGACATTGAC
CAATGTATCACTGCTATTTGTCAACCCTTAGAAATCATCTATGATGCTAA
CACGATCAACCATATCATTAGTTTCTTCAAACCTCCTGAACATGTTATCT
TGCAAGATTTACAAGACAAAGCGTATTCTACTTTCGAAGATTTTAAAGTT
TCAAGTACGGCTGGTCTTCTACATGCTATGGAACAAAGAACGGTTATGGA
CATCGACATTGATGTTGGAGCATCTCATTTGATCATCCCTGAAAAAGGTT
CTTACAATGGTTGTACAGATATGCTGGTGATCGACTTTGGTAAAATCACG
ATGAGCAGCGATCCTAGTCAAATCAGACACCTTGACCCTAAGGACATTGA
GGATGTGAATGAAGTACAAAGCAAAGCTTATGATCGATTCTTGTTGTCGC
TTCAAGCTCTTCAAATATTACTCGTTAGAGAAGGTGAAGATTTAAAGAGT
GCTAAAAGCAACGTCAGTAAAGCTTCATCACACATTTTGCATCCCATCAA
TTTCGATGGCAAACTTGCCAAAGCTATACTTCCACAAGATCCACGTTTAA
AACAGATATGTGTCTCTGGTGAATTATCTTCGCTGTTTGTTTCTGTATCG
GATGATAAAGTCAGTCGTCTCATCAAGCTAGCAGACTCGATACCACTCCC
TCAATCACCTTCTCACGATAACATCGACGGAGAAGAAAAACCTGAAGGAC
TCTTCACCAAGGCGTTGTCAATGATAAGCTTGACAGGTGACAATGACACA
GGGGTGGACATCGGAGGATTTTCCATCCCTGTACCGACATCTCCAACATC
AGTGACGTCAGATGAAGATGAATACGGGACACCACCTGATGGCTCCATAT
TACAGTTACAACAAGAAGCTGGTCCGGACTTTTCATCAGGAGTGGCGAAC
CAAGTCAAAGTGGACTTGAACTTTAAAATCCATAAAGTGATGATCGCCAT
TGGTTTGACTGACAAAGCATTGAAACAGGAAAAAGAATGTCTGAAATTCA
TCGTGGACGACATCAATACAGAGgtGATACTACGAAGATGGGATTTGTTC
GTCAATGCAGAAGTTGGTCGTCTGGTGTTGAATGAAATGACATGGGGTGT
TGATGGAGAACCTTTCGCCATCATGAGTACacccaaaaacaccaaaatgt
tGAAATTCAGCTATCGGAGGTGTGAATTCAACGAAAGTTTGAATCTCGGT
CCAAGTTACTTTTATTCCAAAGAAGCGCAAGTCAGAGCTTTACATTTCAA
AGATGAATTTGGCGCCACGGATCAGATTTTAGATGTACAAGTGGCTACTT
TATTTCTGATGCTTCATCAAGAAGCACTTTTGAGCATCATGTCATTGATC
TACCAAGTACTGGAACCACTCAACAAACATGATAAGGAAGCCACACAGAA
GATCAAACGGAGTTTGAGTACGGCAGGTAGTCGTTTGAGTCTCTCCatcg
aagaaaaagaaaaggagaGACAGATACAACGAAAATTAGCCAACCCTAAA
GCACTGGAAGCTGCCAACGAACTTAAGCAACAGGTTGGcttagaagaaga
aaaaaagatgaGAGTGACCGCCCACCTGGATGGTGTTGGTATCATGATTT
GTTCAGCCAAAGTTGACCTTGCACAAGCCTTCGTTAAAGGGTTATCTGCT
AAAGTACTGATGAAAGATGACTTATTAGAAGTGAAAGCCAGCATGAAAGA
TATGCAAGTACAAGATAATGTTGGCGAAACAAAGTACAAAGACATCATTA
GCATGCGATCTGATGAAGTGTTCGATTTAGAGTTGGCTATTTACGAGAAT
GGATCTTCTGGTAGCAAGCAATACGATATGTCGTGTGTCGACACCAGTGT
CAAACTGAACTTCGGTCAAATGCGCGTTGTTTTCTTGTATAGATTCATAC
AAGACTTAATGTCATTCACCGAAAACTTCGAAGAAGCACAGAAAGCAGTT
GTGGAAGCTGGTAAAGCTGCCAAGGATAAAGCTCTGGAAACAGCGACCGA
TTTGAATAGACATTCTTCTCGTGTCAAACTAAATGTGGTTCTGAAAGCAC
CGACTATTATCATTCCAGTTGGATCAAACAATGAATTGGCTTTACTGGTG
GATCTGGGTGAATTGCGTATTTACAACACATTCAAACTCCTCAACGATGA
TCAATACCATAAGAAATCTATCATCACTGATAACATGACCATTAAGTTAT
CCAATCTGAAATTGTTAAAAGCACTTATTCAAGATGGTAAAGATTTCTTG
CATCAACGAGCCATTATTGAACCTATGATGCTACAAATAACTATTGTTCG
TAATTTAACGAAAGGTAACCATTCCATACCGGATGTTTCAGTTCAAGCAA
AGATGCCAGCTATTCTGTTATCAATCAGTGAAGAAGATGTGACCGTAGCT
CTAAAGATTGTCCAAGGGAATCTCGCCGAAGGTGAGTCACATGCGCCGAA
GAAGCAAGCCAAGCCTGCCAAACAAACGTTAAACGTGCCACAAGATCGTT
TAGCAGACATTTACGAGGAGcctgaagatgaagatgagaaTCGACAAGGA
TATCTTCAAACCAAACTATCCTTCGATCTGGCTAAAATTGACATCAAGCT
TTACTTGAAACCATCTGATATGACATTTGAAGATGAATTTTTAGCGAGGA
CGGATGATTTGTTGTTAGCTTTGTTCACTATTGGTAACCTGTGTGTTGAT
GGAGACATCATGTCCACGCAAGCTATGAAGATGAGCGTTCGATTGGACAC
TTTGGTGTTGGATGATATGAGACCTATCGAGGAGCATGAAGGTGTTAAAC
GTATGATCAACTACAGTCCCGAGCCACTCCTTGAAGAAGTCAAAACCTCT
TCTCATAAACGACCAATCGACAACTCACGAATGATCGAAATCCAAttcga
tcaaacttcatcgcaagataaaaatatcgacATCAAACTTTGTAACATGC
TTTGTATATTCAACGTTGAGTTTATCATGGTCCTGTTGAAAACGTTGCAA
GCTGCCATACCTAAAGATGATAGTCTGCAACATGGCCATTCAATGAGTAG
TCTAGACTCGGCGGCAGGGTCTGGCGGCAGCGATGACGAGGACTCTTTAG
AAGCCAGCGAGATTGTCCTCTGCACTGGTGATCAAGAAAGACCTGAGACT
AAAGTCTCTATCTTCGTCCATAACCCGCAAATTGTTTTACTAGCAGATGC
AAAGGATGTCAAAACAAATGCACTCTTTCTTACAACCGagatcaattttc
aatatttcgaaTTGCGAGATACTCAAAAAATGATTGGCGCTGTTTCTAAC
ACCGCTATTTTGTCAACTGCTTTCAAGAATGACCATCGGAGTGATATATC
AACAGTGTTGTCATTAGATTCCATCAATCTCCACTCGTCATCACCCATCA
ATGGTAAACCTCATATGAGTGTCAGCACAACTTTGATCAAACTGAATATC
TCACCCAAAACCATCCGAACTTTATCAGCGTGTGCTGGTTACATCTCCAA
TGATCCAACAGATGAAGAAATCAAAGAAGCTCGAAAAGCCATGCGTGATT
TATGGCAAATTCAAACGTTCACCAATAAGCGACCGTGGTATTTAAACCAC
CCACCACAACAAGTCTTAAGTGCTGGCAGCTTCGTCCTTGCGCGAACGAG
AACAGGAGAATATAAGCATGGTTTCTTAGCTAAAAAGGATGTCTCGTATC
AAGTCTATTTTTCAGAGGAGCGAGGAACAGCCAGTCACCGAGCCATGGAT
ATCTCATCTGTTGTTTTGGATATCGTACCGCTGATCGGTGATCTATGTGT
TGGATGTAATGTTTTAGCTGTGGAATCGAAAGAACATGGATATCGTACTG
GTCGAATTACTCAGGTTTGGGATTCGAATGTGGATAAAGATTCTTCGGAT
GGCGCCAAACAATCTGTTTCTGTCAAGACAACTGCTATTGCTCCAATCAA
ATACCTTGTCAATTTCTATGACAACCAAACGGAGAACTTCTTCCCGCCTG
ATGAACTTCGTATCATTGGTAAACCCATCAAGGGGGTTGTCCCTGGACTA
GGGGCGTGTGTTTACGCCCGCTTTAATGATGGTTTTTACTATCGGGGCAA
AGTTGATGACATCGAGGATTATCGAATCCGAGTGCAATTGGATGAGATCA
GTGGAGAAATCGAACACGACATCGATGATCCGTCAGCCGTTATTTTGAAC
CTGACGCCTCAATACCGTCAAGTCAAAAAGCATTTCAAAGTCATTGCATC
CAAAGGAAGCACAACTAAAGGATATCATCCGGGGAAAGTGACCGCCATCC
AAGGTGAAGGAAATAACCGATTGTATTCGATACGCTTCGAAGACGGTACA
ATTAACCAAGTACCCATCacgaaattgattttgatgccAAAAGCACCTTT
TGATGCTTTACCTGAAGTTGGCACATACGTTTATTCCCGAGTGTCACGCG
ACGCTCCTTTATACGAGAAGGGTATCGTAGCAGAGAAGAACACAATGATC
TGCGTTAAACATTTAAATGGACGGAAATTGGCTCACGAAATACAAAACAT
TCATTTTGTTGTCCGAAATATCGTTCCTCTCGTGTCATCAttgaagGTTG
GTTTGGACGTCATAGTGCAACCTGACAATGACGATCAGAAAATGTATTTG
GCTGTCATTAGGGAAGTCACCAAAAAAGAAGGTGACAAAACGAACCGTTA
TCTAGTGGAGTTTACGGATGGATCCAAGAAGAGAGTGACGCCCAGCCGGA
TCCGTATACTTTCTCAATACGGAAGTGCAGAAACGAGTGAAGAAAATGCT
GACATTATCACAACAAGACAGGAGGAACTAGTTCTCGATGTGCAAGGTAT
CTCATTACGTGTGGAAGGTTACTTGGGAGGCGTGTTGACACCCATGCTCA
AAATGGATTCCAAAATCACAGCTAACTTGAAGGATTGGTCAAGCCAAATG
AATGCACACGCTACTGTATCATTAGAAGCCAGTTATTATAACGAAAACGT
TGCCGAATGGGAGCCAGTTATTGAACCTTTGATGGAGAAACGGAGGGAAA
GACCGTGGCAACTCTCTGTCAATTACACGATGGAAGGTGACGACAATTCT
GCTTCATCCACTTCCAACGAACTCGTTTTACAAAAACCGGAATCCAACCT
GAAAATCAAATCTCAAGATAATCTTGAATTGACAATTTCAAAATCATGTC
TTGCTTTACTCGGTGAATTGGGACAGGTGTTTGGAGATGCAGTAGAATCT
GTGGACGTTTTACCACAAGTCCTGGTCGAAAAAGAACCTTTCATGATCGA
AAACTTGCTCTCCAAGAAGGTGACAGTAACATTGAATGAACTTCTGCAGG
GACCAAATGGAGATTCGACAATCGAGCTAGCATCTTCTTCGAATCCTGTT
GGCATTACTTTTGCTCCCAagaaatttgagaaacgaaAGACCAACGATCT
ATACACAATCAATTTAtcgGTGGACGGTTTTCATGACATTAAAGACATTG
TGGTTCAAAGAAAGCGAAGCGTTATCTATGATCTTGTACCAATAAAACTA
TTATCAGCACAGTCTTCATATTCGATAGTGGTACAAGTGAAGACAACAGA
CGGACAACGTATCATCGTACTCCGATCACCATTGCAGTTGAAAAATCACT
TTCCAATGCCGTTGGATGTCAGCTACATTTCCAAAGAAAACCAACCAGTT
AAACTGACAACAGTGGGATCGGGAGATATCTATTCCTTCCCTTTGTTGTT
AACCTACCACAGTGTTTTTCATCTCAAACCTGCTGGTTTCGACTACGGTG
ATTGCACAGAAGCTCTCAATTGGAGTGATTTGAAGACGAGCAACGAAAAA
CAGTTCTCCTGCCCTTCACCTGACAAAAGTGCTGACCCTTTCTACATGCA
GGTGGTGATGAAAGAGGAGACGTACTCTTCCGTACACGGCATGTTGGACT
GTGTACCACGTTACACGTTGGAGTGCTTTCCCGTCATCACGCTGCATAAT
TACCTACCTTGCACTATTAATTATAAGATCAAGGGTATGGCGAAATCGGA
AAGTCTACCAGGCGGACACAATTGGCCTTTGTTTACCGTCAACTTCAGTG
ATAAACCTTCCATCTATATCGAGATTGAGTCGTATAACAACCAAAGATGG
GAAGGAGGTTTGACATTACCAACAAAACCGGTAGATTCTTTGAACAAACC
ATCATTATCTTTCGTCATGATGTCTGGTGAACGCAAAATGGAATTGGGTG
TTTATTACCAGTTAGACGGTTCATTGAACATCACCTTATATTCGCCTTAC
TGGCTTCTCAATAAAACTGGAAAACCACTTGTCTATCAGCCAGCGGGGAG
CAGCATCCAGCAAGTTCACCAAGAGAACGATGTAAATGCTCTTATGATGC
TCGTCAAAGGGAAACATAAAAAGgcgaaagtgaaagtgaaaaataGCGAG
TCATGGTCAAATGAATTTTCATTGGATACTGTTGGCAGTGGTGGTTCCTT
GAAATGCAATGGTCCAAGAGATCGAGTTTATGAGATTGGTTTGAACATCA
GTTTGTCATACTTTGGATTGACGAAGATTGTGACGTTCACGCCACTCCGA
ATGTTATCTAACCACACCAAGTACACCATCAGTATGGCAGAAAGTAATTC
TAAATCGTCAGAATGGCACACGGTAAACCCTGACGAGaacattccatTCT
GGCCGACGAAACTTCCTTTGGTCAACCTTTACATTAACATCAATGGGCAA
GATTCAGTGAAATTCAACCCTGAAGTTGGAAAAACTTTACTGTTGAAGTT
CCAGAATGAGGTTGGAGGAGTTTGCGTGGATTACCAAGAAAAGGACTCGT
CCTCAGTCCTTTCGTTTAATCCGTACTTCGCAGGTGCAGCTCCTGTGCGG
CttgaaaatctttgcaaaaaGATCGGCATGATCGCTTATAAACAAGCAGG
TTCGGTAATGGGTCACGTGTTAACACATGACCAATCAGTGTTGTACACGT
GGGATGATCCAACCATGGAACAAGAATTGATTTGTTCCATTGTCAATGAT
GAAGCCAGTGAAACAAGGATCAAACTCGATGCCAACGATTTCGGACGAAT
GAGAGTTGGAGATGGTGCAATTTATTGGGTTTCCTTTCTGGATGGTCTTC
AACGTGTTCTATTGTTCACTGATAACTTCAAATCTGCTTACTGCGCATGT
CAGgaGCAAAATTTACGCCCAACCATGGAAGTTGACTTTGAGATTGAGAG
TTTTGGTTTGTCTCTGGTCAATGTTGATAAGAGAATGGAGATTGGCTACT
TAGCTATCCGACAAAGCAAGACTGTATGGGAGCAACGCAAGAAAAAGAAC
CGCTGGAAAGCTTTACCGCTTGCCATGTGTGAAGCTCTCGAAGAAGGTTA
TCTCAATTATCAAAACAGAAAAGGTGCAGTCAAAGAGAAAGTTCTGGATA
AGGAGGTGGATTACGAGAAGATGTTTATTACGAAACCTGAGAAGATTAAG
ATCAGAAGAACGTACCACAGCGGTCTTGGTTTCAAATACACAATCTCACC
CAATGAAATGCGTGTGCATGCTTCTATCAGCTCAATACAGTTGGATAGCC
ATGTTCCAGGTTCGACCTTTCCAACAGTCTTGCATATGGTTGAACCACCA
AAATCTGTTGCTTCAGAAAACGCTCCAAAGCCATTCTttgaattgagttt
aatgaCAAGGATCGGTGATAAAAATGTGGTCAATGAAGTcagCTATTGTC
ACGTGTTGATTCAAGAGATGGATGTGAGGGTTGATATTGGATTTTTATTG
GCTCTGATGGAACTCTTCAGTCATGCAAGAGCTCGAACAACCGAGAAAGA
ACAATACGCGCTTGATATTGGCCAAGCAGCAACAAAGTTTGAAGAAAGCG
CTGAATTTCAGGCAGCCAAACAAGATCGATATTACGTTTTGAACGACTTT
CATTTATCACCGCTAAAGATTCACGTCAGTTTCTCTTTGACGGGTGGTTC
CAAAGATGAAAATGCTATTGCTTCATTACATGGTAACGTGTTGAACTTGT
TGTTACAAAGTGTCGGACTGGCCTTCACTGAAATACAAGACGTACAATTC
AAATTAGCATGTTACGAAGTGCATAAGTCCATGCAGAGTAATTCGCAGCT
CGGTGATGGAATAACTAAACATTATCAAACACAGGCTATCAAGCAACTTT
ATGTGTTGGTACTCGGGCTAGACGTTCTTGGTAATCCGTATGGTTTGATA
TCTGGTGTTGGAACCGGAGCAAAGAATTTCTTCTACGAACCTTACCAGGG
ATTAATTCAAGGACCAGAAGAATTTGCGGAAGGATTGGCGTATGGGGTGA
AGAGTCTTGTTGGTGGAACCGTGGGTGGAGTATCAGGAGCTGTGAGTAAG
ATTACCGGTACCTTCGGTAAAGGTTTGGCTGCATTGACCTTGGATGAAGA
ATATCAACAAAAGAGACGTGAAAACATGAGCCAACGCCCAACTAACCTCG
GTGAAGGTCTCGCCAAAGGTGGTAAAGGCCTTGTAAAGGGTATCGTGTCT
GGTGTTACAGGGATCGTTACCAAACCCTATGAAGGTGCCAAGAATGATGG
TGCAGGTGGCTTTTTTAAGGGCGTTGGAAAAGGCCTGATTGGCGTGGTTG
CACGCCCTGTTGGTGGAGTGGTAGATATGGCCAGTAACACGTTTGATGGT
TTGAAAAGCACGACATCTGGCGTGAAAGCGATCGAGTTGAGCCGTGTTAC
TCGCGTCTTCCACGCAGATAAGGTTTTACGACCTTTCAATCTGTACGAAG
CAGATGGAAACAAAATTCTTATGCAATGTAACAAAGGAGAATACGCCAAG
AAGAATTTTTATATCACTCATGTAGTGGACAAGAAGAACTATCTCATCCT
CACTCAATCaaacATTTTGTATGTTGGAAAGAACGAGTTGAAAATGGGTG
AATGGGAATCggtttgggttatcgagttcaATGAGCTAAAACGTGAACCA
GAAGTGAAAGAGACAAAGATTATTTTCCATATCCATAATACGGACACGCG
ACGTTCAATTTTCAAGAAATCGACGAACACACGTGAAGTGATATTGGAGT
CTAGTGCTGTTGCAGACTGGTTTATCTTAAAGCTTAGAGATGCTAAAATG
TTATAGatggtatttgaaTCTTTGGTTGCTGACCTCTTGAACAAGTATCT
GGGTCAATATGTGAAAAATCTTGATGCTTCTCAATTGAAGATTGGCATTT
GGGGAGGAAATGTTGTCCTGACAGAACTTGAACTGAAAGATACAGCTCTG
GATGATCTTGACTTACCCATAAAAGTTGTTCGTGGATATTTGGgtAAATT
GGTCTTGTCCATCCCATGGAAAAATCTTTACACTGAATCAACTGTTGTCG
ATATTCAAGATCTCCACCTTGTCGCTAAGCCTAATTTTGACATCAAATAC
AATGAAGAACgcgaagaaaaatcaaaacatgacAAGAAACAACAACAGAT
TCACAATATCGAAGAAGCGAGGCAAAGAGAAGAAGACAAAAAGAAAGGCG
CCAAGAAAGAAGAGAGTGACGGTTTTGCTGAGAAACTTGCAACAAACGTC
ATAAAAAATCTACAGGTTACGATCAAGAACATACATGTTCGATATGAAGA
CTCAATCAGTGATGTGAATGGACCCTTTTCAGTCGGTCTTACAATGGAAA
GTTTAACAGCACAAACCACAGATGAAGATTTTGTTCCAAAGATTATCAAA
GAATCTGTCTCATTAATTCATAAGatggTGAAATTAGACAATTTGGCTTT
ATATTGGAATCCAGGAGACGAACTGATTGATCCTTCACTTGATACCAAGC
AATGGTTGgaagtTTCAACGAAGCAAATTTCAACACACCAATCGAAGCCA
GAGAAAACGAAATATATTTTGAGTCCCATGGTTGCAACGAAGAAATTGAA
GCTGAACACCAAACCAGGTTCCAACCTTGACATCCCGAAGatgttTTTGA
ACTTGGTTTTGGAAGAACTTGGTATCATCGTGGCAAGAAGTCAATATCAT
GGCGTGGTGCAACTGATTGAATCATTTGAACGAATGAATAGGAACCAACC
TTTTCGTAAATACAGACCACATACCTCCGTTCTTGGGAACGAAAGTATTT
GGTGGAAGTACTGCATGTCCAGCATACTGGAGGTGGATGTCAAAAGACGA
TCTCAAATGTGGAGCTGGAAGCATATTCAAAAACATCGAGTTCTTTGCAA
AGCTTACAAAGTGAAGTAcaaggaaaaattgaaacagaaaaATCCATCCA
AACAAATTCTCACTGAACTAGAGaGCATGGAGGATGAGTTGAATATTGCA
AGCATCACCATTTTTCGACAGCTTGCAGCTACAGAGGTTTTAACGGAACA
AAAGAAGAAAGGCACTAAAGGAAGTTTCTTCAGTTTCTTCTCCAGATCAA
AAGAACCAGAAAAGTCTGCTGCTAATAAAATTGGAGATTTAATGGGTGAT
GACCAGGAGAAGGAAATGCAGAAATTGTATGACGCAATCGGTTATACTGA
AAATGAAGTCATCACTCCCTTTCCTAAAGAGTACGTGGCGATGTCAGTGG
AATCGATTCTCCAGAAATTATTCATCAGCCTCATCGATGACACAGATAAG
GCGAAAGAATTCAAAGTGTTGGATTTTTCACTCAACAACATCATTGTAGA
AGTTTTCCAAAGACCTTCTGCTCAAGCTCTCAAATTATGTGCAAAGATAG
GAGAGATGAAGTTATTTGGTACAGCTTCTGCTCAATGTACACCTCtcatc
atcaaaaacatgttaCAAGGTCGAGGTATGGAATTTCTGCCGTTGGTGGA
CTTCATCTTTGAGACGAATCCTTTGAAGAAACCGGACATTGACCAATGTA
TCACTGCTATTTGTCAACCCTTAGAAATCATCTATGATGCTAACACGATC
AACCATATCATTAGTTTCTTCAAACCTCCTGAACATGTTATCTTGCAAGA
TTTACAAGACAAAGCGTATTCTACTTTCGAAGATTTTAAAGTTTCAAGTA
CGGCTGGTCTTCTACATGCTATGGAACAAAGAACGGTTATGGACATCGAC
ATTGATGTTGGAGCATCTCATTTGATCATCCCTGAAAAAGGTTCTTACAA
TGGTTGTACAGATATGCTGGTGATCGACTTTGGTAAAATCACGATGAGCA
GCGATCCTAGTCAAATCAGACACCTTGACCCTAAGGACATTGAGGATGTG
AATGAAGTACAAAGCAAAGCTTATGATCGATTCTTGTTGTCGCTTCAAGC
TCTTCAAATATTACTCGTTAGAGAAGGTGAAGATTTAAAGAGTGCTAAAA
GCAACGTCAGTAAAGCTTCATCACACATTTTGCATCCCATCAATTTCGAT
GGCAAACTTGCCAAAGCTATACTTCCACAAGATCCACGTTTAAAACAGAT
ATGTGTCTCTGGTGAATTATCTTCGCTGTTTGTTTCTGTATCGGATGATA
AAGTCAGTCGTCTCATCAAGCTAGCAGACTCGATACCACTCCCTCAATCA
CCTTCTCACGATAACATCGACGGAGAAGAAAAACCTGAAGGACTCTTCAC
CAAGGCGTTGTCAATGATAAGCTTGACAGGTGACAATGACACAGGGGTGG
ACATCGGAGGATTTTCCATCCCTGTACCGACATCTCCAACATCAGTGACG
TCAGATGAAGATGAATACGGGACACCACCTGATGGCTCCATATTACAGTT
ACAACAAGAAGCTGGTCCGGACTTTTCATCAGGAGTGGCGAACCAAGTCA
AAGTGGACTTGAACTTTAAAATCCATAAAGTGATGATCGCCATTGGTTTG
ACTGACAAAGCATTGAAACAGGAAAAAGAATGTCTGAAATTCATCGTGGA
CGACATCAATACAGAGgtGATACTACGAAGATGGGATTTGTTCGTCAATG
CAGAAGTTGGTCGTCTGGTGTTGAATGAAATGACATGGGGTGTTGATGGA
GAACCTTTCGCCATCATGAGTACacccaaaaacaccaaaatgttGAAATT
CAGCTATCGGAGGTGTGAATTCAACGAAAGTTTGAATCTCGGTCCAAGTT
ACTTTTATTCCAAAGAAGCGCAAGTCAGAGCTTTACATTTCAAAGATGAA
TTTGGCGCCACGGATCAGATTTTAGATGTACAAGTGGCTACTTTATTTCT
GATGCTTCATCAAGAAGCACTTTTGAGCATCATGTCATTGATCTACCAAG
TACTGGAACCACTCAACAAACATGATAAGGAAGCCACACAGAAGATCAAA
CGGAGTTTGAGTACGGCAGGTAGTCGTTTGAGTCTCTCCatcgaagaaaa
agaaaaggagaGACAGATACAACGAAAATTAGCCAACCCTAAAGCACTGG
AAGCTGCCAACGAACTTAAGCAACAGGTTGGcttagaagaagaaaaaaag
atgaGAGTGACCGCCCACCTGGATGGTGTTGGTATCATGATTTGTTCAGC
CAAAGTTGACCTTGCACAAGCCTTCGTTAAAGGGTTATCTGCTAAAGTAC
TGATGAAAGATGACTTATTAGAAGTGAAAGCCAGCATGAAAGATATGCAA
GTACAAGATAATGTTGGCGAAACAAAGTACAAAGACATCATTAGCATGCG
ATCTGATGAAGTGTTCGATTTAGAGTTGGCTATTTACGAGAATGGATCTT
CTGGTAGCAAGCAATACGATATGTCGTGTGTCGACACCAGTGTCAAACTG
AACTTCGGTCAAATGCGCGTTGTTTTCTTGTATAGATTCATACAAGACTT
AATGTCATTCACCGAAAACTTCGAAGAAGCACAGAAAGCAGTTGTGGAAG
CTGGTAAAGCTGCCAAGGATAAAGCTCTGGAAACAGCGACCGATTTGAAT
AGACATTCTTCTCGTGTCAAACTAAATGTGGTTCTGAAAGCACCGACTAT
TATCATTCCAGTTGGATCAAACAATGAATTGGCTTTACTGGTGGATCTGG
GTGAATTGCGTATTTACAACACATTCAAACTCCTCAACGATGATCAATAC
CATAAGAAATCTATCATCACTGATAACATGACCATTAAGTTATCCAATCT
GAAATTGTTAAAAGCACTTATTCAAGATGGTAAAGATTTCTTGCATCAAC
GAGCCATTATTGAACCTATGATGCTACAAATAACTATTGTTCGTAATTTA
ACGAAAGGTAACCATTCCATACCGGATGTTTCAGTTCAAGCAAAGATGCC
AGCTATTCTGTTATCAATCAGTGAAGAAGATGTGACCGTAGCTCTAAAGA
TTGTCCAAGGGAATCTCGCCGAAGGTGAGTCACATGCGCCGAAGAAGCAA
GCCAAGCCTGCCAAACAAACGTTAAACGTGCCACAAGATCGTTTAGCAGA
CATTTACGAGGAGcctgaagatgaagatgagaaTCGACAAGGATATCTTC
AAACCAAACTATCCTTCGATCTGGCTAAAATTGACATCAAGCTTTACTTG
AAACCATCTGATATGACATTTGAAGATGAATTTTTAGCGAGGACGGATGA
TTTGTTGTTAGCTTTGTTCACTATTGGTAACCTGTGTGTTGATGGAGACA
TCATGTCCACGCAAGCTATGAAGATGAGCGTTCGATTGGACACTTTGGTG
TTGGATGATATGAGACCTATCGAGGAGCATGAAGGTGTTAAACGTATGAT
CAACTACAGTCCCGAGCCACTCCTTGAAGAAGTCAAAACCTCTTCTCATA
AACGACCAATCGACAACTCACGAATGATCGAAATCCAAttcgatcaaact
tcatcgcaagataaaaatatcgacATCAAACTTTGTAACATGCTTTGTAT
ATTCAACGTTGAGTTTATCATGGTCCTGTTGAAAACGTTGCAAGCTGCCA
TACCTAAAGATGATAGTCTGCAACATGGCCATTCAATGAGTAGTCTAGAC
TCGGCGGCAGGGTCTGGCGGCAGCGATGACGAGGACTCTTTAGAAGCCAG
CGAGATTGTCCTCTGCACTGGTGATCAAGAAAGACCTGAGACTAAAGTCT
CTATCTTCGTCCATAACCCGCAAATTGTTTTACTAGCAGATGCAAAGGAT
GTCAAAACAAATGCACTCTTTCTTACAACCGagatcaattttcaatattt
cgaaTTGCGAGATACTCAAAAAATGATTGGCGCTGTTTCTAACACCGCTA
TTTTGTCAACTGCTTTCAAGAATGACCATCGGAGTGATATATCAACAGTG
TTGTCATTAGATTCCATCAATCTCCACTCGTCATCACCCATCAATGGTAA
ACCTCATATGAGTGTCAGCACAACTTTGATCAAACTGAATATCTCACCCA
AAACCATCCGAACTTTATCAGCGTGTGCTGGTTACATCTCCAATGATCCA
ACAGATGAAGAAATCAAAGAAGCTCGAAAAGCCATGCGTGATTTATGGCA
AATTCAAACGTTCACCAATAAGCGACCGTGGTATTTAAACCACCCACCAC
AACAAGTCTTAAGTGCTGGCAGCTTCGTCCTTGCGCGAACGAGAACAGGA
GAATATAAGCATGGTTTCTTAGCTAAAAAGGATGTCTCGTATCAAGTCTA
TTTTTCAGAGGAGCGAGGAACAGCCAGTCACCGAGCCATGGATATCTCAT
CTGTTGTTTTGGATATCGTACCGCTGATCGGTGATCTATGTGTTGGATGT
AATGTTTTAGCTGTGGAATCGAAAGAACATGGATATCGTACTGGTCGAAT
TACTCAGGTTTGGGATTCGAATGTGGATAAAGATTCTTCGGATGGCGCCA
AACAATCTGTTTCTGTCAAGACAACTGCTATTGCTCCAATCAAATACCTT
GTCAATTTCTATGACAACCAAACGGAGAACTTCTTCCCGCCTGATGAACT
TCGTATCATTGGTAAACCCATCAAGGGGGTTGTCCCTGGACTAGGGGCGT
GTGTTTACGCCCGCTTTAATGATGGTTTTTACTATCGGGGCAAAGTTGAT
GACATCGAGGATTATCGAATCCGAGTGCAATTGGATGAGATCAGTGGAGA
AATCGAACACGACATCGATGATCCGTCAGCCGTTATTTTGAACCTGACGC
CTCAATACCGTCAAGTCAAAAAGCATTTCAAAGTCATTGCATCCAAAGGA
AGCACAACTAAAGGATATCATCCGGGGAAAGTGACCGCCATCCAAGGTGA
AGGAAATAACCGATTGTATTCGATACGCTTCGAAGACGGTACAATTAACC
AAGTACCCATCacgaaattgattttgatgccAAAAGCACCTTTTGATGCT
TTACCTGAAGTTGGCACATACGTTTATTCCCGAGTGTCACGCGACGCTCC
TTTATACGAGAAGGGTATCGTAGCAGAGAAGAACACAATGATCTGCGTTA
AACATTTAAATGGACGGAAATTGGCTCACGAAATACAAAACATTCATTTT
GTTGTCCGAAATATCGTTCCTCTCGTGTCATCAttgaagGTTGGTTTGGA
CGTCATAGTGCAACCTGACAATGACGATCAGAAAATGTATTTGGCTGTCA
TTAGGGAAGTCACCAAAAAAGAAGGTGACAAAACGAACCGTTATCTAGTG
GAGTTTACGGATGGATCCAAGAAGAGAGTGACGCCCAGCCGGATCCGTAT
ACTTTCTCAATACGGAAGTGCAGAAACGAGTGAAGAAAATGCTGACATTA
TCACAACAAGACAGGAGGAACTAGTTCTCGATGTGCAAGGTATCTCATTA
CGTGTGGAAGGTTACTTGGGAGGCGTGTTGACACCCATGCTCAAAATGGA
TTCCAAAATCACAGCTAACTTGAAGGATTGGTCAAGCCAAATGAATGCAC
ACGCTACTGTATCATTAGAAGCCAGTTATTATAACGAAAACGTTGCCGAA
TGGGAGCCAGTTATTGAACCTTTGATGGAGAAACGGAGGGAAAGACCGTG
GCAACTCTCTGTCAATTACACGATGGAAGGTGACGACAATTCTGCTTCAT
CCACTTCCAACGAACTCGTTTTACAAAAACCGGAATCCAACCTGAAAATC
AAATCTCAAGATAATCTTGAATTGACAATTTCAAAATCATGTCTTGCTTT
ACTCGGTGAATTGGGACAGGTGTTTGGAGATGCAGTAGAATCTGTGGACG
TTTTACCACAAGTCCTGGTCGAAAAAGAACCTTTCATGATCGAAAACTTG
CTCTCCAAGAAGGTGACAGTAACATTGAATGAACTTCTGCAGGGACCAAA
TGGAGATTCGACAATCGAGCTAGCATCTTCTTCGAATCCTGTTGGCATTA
CTTTTGCTCCCAagaaatttgagaaacgaaAGACCAACGATCTATACACA
ATCAATTTAtcgGTGGACGGTTTTCATGACATTAAAGACATTGTGGTTCA
AAGAAAGCGAAGCGTTATCTATGATCTTGTACCAATAAAACTATTATCAG
CACAGTCTTCATATTCGATAGTGGTACAAGTGAAGACAACAGACGGACAA
CGTATCATCGTACTCCGATCACCATTGCAGTTGAAAAATCACTTTCCAAT
GCCGTTGGATGTCAGCTACATTTCCAAAGAAAACCAACCAGTTAAACTGA
CAACAGTGGGATCGGGAGATATCTATTCCTTCCCTTTGTTGTTAACCTAC
CACAGTGTTTTTCATCTCAAACCTGCTGGTTTCGACTACGGTGATTGCAC
AGAAGCTCTCAATTGGAGTGATTTGAAGACGAGCAACGAAAAACAGTTCT
CCTGCCCTTCACCTGACAAAAGTGCTGACCCTTTCTACATGCAGGTGGTG
ATGAAAGAGGAGACGTACTCTTCCGTACACGGCATGTTGGACTGTGTACC
ACGTTACACGTTGGAGTGCTTTCCCGTCATCACGCTGCATAATTACCTAC
CTTGCACTATTAATTATAAGATCAAGGGTATGGCGAAATCGGAAAGTCTA
CCAGGCGGACACAATTGGCCTTTGTTTACCGTCAACTTCAGTGATAAACC
TTCCATCTATATCGAGATTGAGTCGTATAACAACCAAAGATGGGAAGGAG
GTTTGACATTACCAACAAAACCGGTAGATTCTTTGAACAAACCATCATTA
TCTTTCGTCATGATGTCTGGTGAACGCAAAATGGAATTGGGTGTTTATTA
CCAGTTAGACGGTTCATTGAACATCACCTTATATTCGCCTTACTGGCTTC
TCAATAAAACTGGAAAACCACTTGTCTATCAGCCAGCGGGGAGCAGCATC
CAGCAAGTTCACCAAGAGAACGATGTAAATGCTCTTATGATGCTCGTCAA
AGGGAAACATAAAAAGgcgaaagtgaaagtgaaaaataGCGAGTCATGGT
CAAATGAATTTTCATTGGATACTGTTGGCAGTGGTGGTTCCTTGAAATGC
AATGGTCCAAGAGATCGAGTTTATGAGATTGGTTTGAACATCAGTTTGTC
ATACTTTGGATTGACGAAGATTGTGACGTTCACGCCACTCCGAATGTTAT
CTAACCACACCAAGTACACCATCAGTATGGCAGAAAGTAATTCTAAATCG
TCAGAATGGCACACGGTAAACCCTGACGAGaacattccatTCTGGCCGAC
GAAACTTCCTTTGGTCAACCTTTACATTAACATCAATGGGCAAGATTCAG
TGAAATTCAACCCTGAAGTTGGAAAAACTTTACTGTTGAAGTTCCAGAAT
GAGGTTGGAGGAGTTTGCGTGGATTACCAAGAAAAGGACTCGTCCTCAGT
CCTTTCGTTTAATCCGTACTTCGCAGGTGCAGCTCCTGTGCGGCttgaaa
atctttgcaaaaaGATCGGCATGATCGCTTATAAACAAGCAGGTTCGGTA
ATGGGTCACGTGTTAACACATGACCAATCAGTGTTGTACACGTGGGATGA
TCCAACCATGGAACAAGAATTGATTTGTTCCATTGTCAATGATGAAGCCA
GTGAAACAAGGATCAAACTCGATGCCAACGATTTCGGACGAATGAGAGTT
GGAGATGGTGCAATTTATTGGGTTTCCTTTCTGGATGGTCTTCAACGTGT
TCTATTGTTCACTGATAACTTCAAATCTGCTTACTGCGCATGTCAGgaGC
AAAATTTACGCCCAACCATGGAAGTTGACTTTGAGATTGAGAGTTTTGGT
TTGTCTCTGGTCAATGTTGATAAGAGAATGGAGATTGGCTACTTAGCTAT
CCGACAAAGCAAGACTGTATGGGAGCAACGCAAGAAAAAGAACCGCTGGA
AAGCTTTACCGCTTGCCATGTGTGAAGCTCTCGAAGAAGGTTATCTCAAT
TATCAAAACAGAAAAGGTGCAGTCAAAGAGAAAGTTCTGGATAAGGAGGT
GGATTACGAGAAGATGTTTATTACGAAACCTGAGAAGATTAAGATCAGAA
GAACGTACCACAGCGGTCTTGGTTTCAAATACACAATCTCACCCAATGAA
ATGCGTGTGCATGCTTCTATCAGCTCAATACAGTTGGATAGCCATGTTCC
AGGTTCGACCTTTCCAACAGTCTTGCATATGGTTGAACCACCAAAATCTG
TTGCTTCAGAAAACGCTCCAAAGCCATTCTttgaattgagtttaatgaCA
AGGATCGGTGATAAAAATGTGGTCAATGAAGTcagCTATTGTCACGTGTT
GATTCAAGAGATGGATGTGAGGGTTGATATTGGATTTTTATTGGCTCTGA
TGGAACTCTTCAGTCATGCAAGAGCTCGAACAACCGAGAAAGAACAATAC
GCGCTTGATATTGGCCAAGCAGCAACAAAGTTTGAAGAAAGCGCTGAATT
TCAGGCAGCCAAACAAGATCGATATTACGTTTTGAACGACTTTCATTTAT
CACCGCTAAAGATTCACGTCAGTTTCTCTTTGACGGGTGGTTCCAAAGAT
GAAAATGCTATTGCTTCATTACATGGTAACGTGTTGAACTTGTTGTTACA
AAGTGTCGGACTGGCCTTCACTGAAATACAAGACGTACAATTCAAATTAG
CATGTTACGAAGTGCATAAGTCCATGCAGAGTAATTCGCAGCTCGGTGAT
GGAATAACTAAACATTATCAAACACAGGCTATCAAGCAACTTTATGTGTT
GGTACTCGGGCTAGACGTTCTTGGTAATCCGTATGGTTTGATATCTGGTG
TTGGAACCGGAGCAAAGAATTTCTTCTACGAACCTTACCAGGGATTAATT
CAAGGACCAGAAGAATTTGCGGAAGGATTGGCGTATGGGGTGAAGAGTCT
TGTTGGTGGAACCGTGGGTGGAGTATCAGGAGCTGTGAGTAAGATTACCG
GTACCTTCGGTAAAGGTTTGGCTGCATTGACCTTGGATGAAGAATATCAA
CAAAAGAGACGTGAAAACATGAGCCAACGCCCAACTAACCTCGGTGAAGG
TCTCGCCAAAGGTGGTAAAGGCCTTGTAAAGGGTATCGTGTCTGGTGTTA
CAGGGATCGTTACCAAACCCTATGAAGGTGCCAAGAATGATGGTGCAGGT
GGCTTTTTTAAGGGCGTTGGAAAAGGCCTGATTGGCGTGGTTGCACGCCC
TGTTGGTGGAGTGGTAGATATGGCCAGTAACACGTTTGATGGTTTGAAAA
GCACGACATCTGGCGTGAAAGCGATCGAGTTGAGCCGTGTTACTCGCGTC
TTCCACGCAGATAAGGTTTTACGACCTTTCAATCTGTACGAAGCAGATGG
AAACAAAATTCTTATGCAATGTAACAAAGGAGAATACGCCAAGAAGAATT
TTTATATCACTCATGTAGTGGACAAGAAGAACTATCTCATCCTCACTCAA
TCaaacATTTTGTATGTTGGAAAGAACGAGTTGAAAATGGGTGAATGGGA
ATCggtttgggttatcgagttcaATGAGCTAAAACGTGAACCAGAAGTGA
AAGAGACAAAGATTATTTTCCATATCCATAATACGGACACGCGACGTTCA
ATTTTCAAGAAATCGACGAACACACGTGAAGTGATATTGGAGTCTAGTGC
TGTTGCAGACTGGTTTATCTTAAAGCTTAGAGATGCTAAAATGTTATAGa
tggtatttgaaTCTTTGGTTGCTGACCTCTTGAACAAGTATCTGGGTCAA
TATGTGAAAAATCTTGATGCTTCTCAATTGAAGATTGGCATTTGGGGAGG
AAATGTTGTCCTGACAGAACTTGAACTGAAAGATACAGCTCTGGATGATC
TTGACTTACCCATAAAAGTTGTTCGTGGATATTTGGgtAAATTGGTCTTG
TCCATCCCATGGAAAAATCTTTACACTGAATCAACTGTTGTCGATATTCA
AGATCTCCACCTTGTCGCTAAGCCTAATTTTGACATCAAATACAATGAAG
AACgcgaagaaaaatcaaaacatgacAAGAAACAACAACAGATTCACAAT
ATCGAAGAAGCGAGGCAAAGAGAAGAAGACAAAAAGAAAGGCGCCAAGAA
AGAAGAGAGTGACGGTTTTGCTGAGAAACTTGCAACAAACGTCATAAAAA
ATCTACAGGTTACGATCAAGAACATACATGTTCGATATGAAGACTCAATC
AGTGATGTGAATGGACCCTTTTCAGTCGGTCTTACAATGGAAAGTTTAAC
AGCACAAACCACAGATGAAGATTTTGTTCCAAAGATTATCAAAGAATCTG
TCTCATTAATTCATAAGatggTGAAATTAGACAATTTGGCTTTATATTGG
AATCCAGGAGACGAACTGATTGATCCTTCACTTGATACCAAGCAATGGTT
GgaagtTTCAACGAAGCAAATTTCAACACACCAATCGAAGCCAGAGAAAA
CGAAATATATTTTGAGTCCCATGGTTGCAACGAAGAAATTGAAGCTGAAC
ACCAAACCAGGTTCCAACCTTGACATCCCGAAGatgttTTTGAACTTGGT
TTTGGAAGAACTTGGTATCATCGTGGCAAGAAGTCAATATCATGGCGTGG
TGCAACTGATTGAATCATTTGAACGAATGAATAGGAACCAACCTTTTCGT
AAATACAGACCACATACCTCCGTTCTTGGGAACGAAAGTATTTGGTGGAA
GTACTGCATGTCCAGCATACTGGAGGTGGATGTCAAAAGACGATCTCAAA
TGTGGAGCTGGAAGCATATTCAAAAACATCGAGTTCTTTGCAAAGCTTAC
AAAGTGAAGTAcaaggaaaaattgaaacagaaaaATCCATCCAAACAAAT
TCTCACTGAACTAGAGaGCATGGAGGATGAGTTGAATATTGCAAGCATCA
CCATTTTTCGACAGCTTGCAGCTACAGAGGTTTTAACGGAACAAAAGAAG
AAAGGCACTAAAGGAAGTTTCTTCAGTTTCTTCTCCAGATCAAAAGAACC
AGAAAAGTCTGCTGCTAATAAAATTGGAGATTTAATGGGTGATGACCAGG
AGAAGGAAATGCAGAAATTGTATGACGCAATCGGTTATACTGAAAATGAA
GTCATCACTCCCTTTCCTAAAGAGTACGTGGCGATGTCAGTGGAATCGAT
TCTCCAGAAATTATTCATCAGCCTCATCGATGACACAGATAAGGCGAAAG
AATTCAAAGTGTTGGATTTTTCACTCAACAACATCATTGTAGAAGTTTTC
CAAAGACCTTCTGCTCAAGCTCTCAAATTATGTGCAAAGATAGGAGAGAT
GAAGTTATTTGGTACAGCTTCTGCTCAATGTACACCTCtcatcatcaaaa
acatgttaCAAGGTCGAGGTATGGAATTTCTGCCGTTGGTGGACTTCATC
TTTGAGACGAATCCTTTGAAGAAACCGGACATTGACCAATGTATCACTGC
TATTTGTCAACCCTTAGAAATCATCTATGATGCTAACACGATCAACCATA
TCATTAGTTTCTTCAAACCTCCTGAACATGTTATCTTGCAAGATTTACAA
GACAAAGCGTATTCTACTTTCGAAGATTTTAAAGTTTCAAGTACGGCTGG
TCTTCTACATGCTATGGAACAAAGAACGGTTATGGACATCGACATTGATG
TTGGAGCATCTCATTTGATCATCCCTGAAAAAGGTTCTTACAATGGTTGT
ACAGATATGCTGGTGATCGACTTTGGTAAAATCACGATGAGCAGCGATCC
TAGTCAAATCAGACACCTTGACCCTAAGGACATTGAGGATGTGAATGAAG
TACAAAGCAAAGCTTATGATCGATTCTTGTTGTCGCTTCAAGCTCTTCAA
ATATTACTCGTTAGAGAAGGTGAAGATTTAAAGAGTGCTAAAAGCAACGT
CAGTAAAGCTTCATCACACATTTTGCATCCCATCAATTTCGATGGCAAAC
TTGCCAAAGCTATACTTCCACAAGATCCACGTTTAAAACAGATATGTGTC
TCTGGTGAATTATCTTCGCTGTTTGTTTCTGTATCGGATGATAAAGTCAG
TCGTCTCATCAAGCTAGCAGACTCGATACCACTCCCTCAATCACCTTCTC
ACGATAACATCGACGGAGAAGAAAAACCTGAAGGACTCTTCACCAAGGCG
TTGTCAATGATAAGCTTGACAGGTGACAATGACACAGGGGTGGACATCGG
AGGATTTTCCATCCCTGTACCGACATCTCCAACATCAGTGACGTCAGATG
AAGATGAATACGGGACACCACCTGATGGCTCCATATTACAGTTACAACAA
GAAGCTGGTCCGGACTTTTCATCAGGAGTGGCGAACCAAGTCAAAGTGGA
CTTGAACTTTAAAATCCATAAAGTGATGATCGCCATTGGTTTGACTGACA
AAGCATTGAAACAGGAAAAAGAATGTCTGAAATTCATCGTGGACGACATC
AATACAGAGgtGATACTACGAAGATGGGATTTGTTCGTCAATGCAGAAGT
TGGTCGTCTGGTGTTGAATGAAATGACATGGGGTGTTGATGGAGAACCTT
TCGCCATCATGAGTACacccaaaaacaccaaaatgttGAAATTCAGCTAT
CGGAGGTGTGAATTCAACGAAAGTTTGAATCTCGGTCCAAGTTACTTTTA
TTCCAAAGAAGCGCAAGTCAGAGCTTTACATTTCAAAGATGAATTTGGCG
CCACGGATCAGATTTTAGATGTACAAGTGGCTACTTTATTTCTGATGCTT
CATCAAGAAGCACTTTTGAGCATCATGTCATTGATCTACCAAGTACTGGA
ACCACTCAACAAACATGATAAGGAAGCCACACAGAAGATCAAACGGAGTT
TGAGTACGGCAGGTAGTCGTTTGAGTCTCTCCatcgaagaaaaagaaaag
gagaGACAGATACAACGAAAATTAGCCAACCCTAAAGCACTGGAAGCTGC
CAACGAACTTAAGCAACAGGTTGGcttagaagaagaaaaaaagatgaGAG
TGACCGCCCACCTGGATGGTGTTGGTATCATGATTTGTTCAGCCAAAGTT
GACCTTGCACAAGCCTTCGTTAAAGGGTTATCTGCTAAAGTACTGATGAA
AGATGACTTATTAGAAGTGAAAGCCAGCATGAAAGATATGCAAGTACAAG
ATAATGTTGGCGAAACAAAGTACAAAGACATCATTAGCATGCGATCTGAT
GAAGTGTTCGATTTAGAGTTGGCTATTTACGAGAATGGATCTTCTGGTAG
CAAGCAATACGATATGTCGTGTGTCGACACCAGTGTCAAACTGAACTTCG
GTCAAATGCGCGTTGTTTTCTTGTATAGATTCATACAAGACTTAATGTCA
TTCACCGAAAACTTCGAAGAAGCACAGAAAGCAGTTGTGGAAGCTGGTAA
AGCTGCCAAGGATAAAGCTCTGGAAACAGCGACCGATTTGAATAGACATT
CTTCTCGTGTCAAACTAAATGTGGTTCTGAAAGCACCGACTATTATCATT
CCAGTTGGATCAAACAATGAATTGGCTTTACTGGTGGATCTGGGTGAATT
GCGTATTTACAACACATTCAAACTCCTCAACGATGATCAATACCATAAGA
AATCTATCATCACTGATAACATGACCATTAAGTTATCCAATCTGAAATTG
TTAAAAGCACTTATTCAAGATGGTAAAGATTTCTTGCATCAACGAGCCAT
TATTGAACCTATGATGCTACAAATAACTATTGTTCGTAATTTAACGAAAG
GTAACCATTCCATACCGGATGTTTCAGTTCAAGCAAAGATGCCAGCTATT
CTGTTATCAATCAGTGAAGAAGATGTGACCGTAGCTCTAAAGATTGTCCA
AGGGAATCTCGCCGAAGGTGAGTCACATGCGCCGAAGAAGCAAGCCAAGC
CTGCCAAACAAACGTTAAACGTGCCACAAGATCGTTTAGCAGACATTTAC
GAGGAGcctgaagatgaagatgagaaTCGACAAGGATATCTTCAAACCAA
ACTATCCTTCGATCTGGCTAAAATTGACATCAAGCTTTACTTGAAACCAT
CTGATATGACATTTGAAGATGAATTTTTAGCGAGGACGGATGATTTGTTG
TTAGCTTTGTTCACTATTGGTAACCTGTGTGTTGATGGAGACATCATGTC
CACGCAAGCTATGAAGATGAGCGTTCGATTGGACACTTTGGTGTTGGATG
ATATGAGACCTATCGAGGAGCATGAAGGTGTTAAACGTATGATCAACTAC
AGTCCCGAGCCACTCCTTGAAGAAGTCAAAACCTCTTCTCATAAACGACC
AATCGACAACTCACGAATGATCGAAATCCAAttcgatcaaacttcatcgc
aagataaaaatatcgacATCAAACTTTGTAACATGCTTTGTATATTCAAC
GTTGAGTTTATCATGGTCCTGTTGAAAACGTTGCAAGCTGCCATACCTAA
AGATGATAGTCTGCAACATGGCCATTCAATGAGTAGTCTAGACTCGGCGG
CAGGGTCTGGCGGCAGCGATGACGAGGACTCTTTAGAAGCCAGCGAGATT
GTCCTCTGCACTGGTGATCAAGAAAGACCTGAGACTAAAGTCTCTATCTT
CGTCCATAACCCGCAAATTGTTTTACTAGCAGATGCAAAGGATGTCAAAA
CAAATGCACTCTTTCTTACAACCGagatcaattttcaatatttcgaaTTG
CGAGATACTCAAAAAATGATTGGCGCTGTTTCTAACACCGCTATTTTGTC
AACTGCTTTCAAGAATGACCATCGGAGTGATATATCAACAGTGTTGTCAT
TAGATTCCATCAATCTCCACTCGTCATCACCCATCAATGGTAAACCTCAT
ATGAGTGTCAGCACAACTTTGATCAAACTGAATATCTCACCCAAAACCAT
CCGAACTTTATCAGCGTGTGCTGGTTACATCTCCAATGATCCAACAGATG
AAGAAATCAAAGAAGCTCGAAAAGCCATGCGTGATTTATGGCAAATTCAA
ACGTTCACCAATAAGCGACCGTGGTATTTAAACCACCCACCACAACAAGT
CTTAAGTGCTGGCAGCTTCGTCCTTGCGCGAACGAGAACAGGAGAATATA
AGCATGGTTTCTTAGCTAAAAAGGATGTCTCGTATCAAGTCTATTTTTCA
GAGGAGCGAGGAACAGCCAGTCACCGAGCCATGGATATCTCATCTGTTGT
TTTGGATATCGTACCGCTGATCGGTGATCTATGTGTTGGATGTAATGTTT
TAGCTGTGGAATCGAAAGAACATGGATATCGTACTGGTCGAATTACTCAG
GTTTGGGATTCGAATGTGGATAAAGATTCTTCGGATGGCGCCAAACAATC
TGTTTCTGTCAAGACAACTGCTATTGCTCCAATCAAATACCTTGTCAATT
TCTATGACAACCAAACGGAGAACTTCTTCCCGCCTGATGAACTTCGTATC
ATTGGTAAACCCATCAAGGGGGTTGTCCCTGGACTAGGGGCGTGTGTTTA
CGCCCGCTTTAATGATGGTTTTTACTATCGGGGCAAAGTTGATGACATCG
AGGATTATCGAATCCGAGTGCAATTGGATGAGATCAGTGGAGAAATCGAA
CACGACATCGATGATCCGTCAGCCGTTATTTTGAACCTGACGCCTCAATA
CCGTCAAGTCAAAAAGCATTTCAAAGTCATTGCATCCAAAGGAAGCACAA
CTAAAGGATATCATCCGGGGAAAGTGACCGCCATCCAAGGTGAAGGAAAT
AACCGATTGTATTCGATACGCTTCGAAGACGGTACAATTAACCAAGTACC
CATCacgaaattgattttgatgccAAAAGCACCTTTTGATGCTTTACCTG
AAGTTGGCACATACGTTTATTCCCGAGTGTCACGCGACGCTCCTTTATAC
GAGAAGGGTATCGTAGCAGAGAAGAACACAATGATCTGCGTTAAACATTT
AAATGGACGGAAATTGGCTCACGAAATACAAAACATTCATTTTGTTGTCC
GAAATATCGTTCCTCTCGTGTCATCAttgaagGTTGGTTTGGACGTCATA
GTGCAACCTGACAATGACGATCAGAAAATGTATTTGGCTGTCATTAGGGA
AGTCACCAAAAAAGAAGGTGACAAAACGAACCGTTATCTAGTGGAGTTTA
CGGATGGATCCAAGAAGAGAGTGACGCCCAGCCGGATCCGTATACTTTCT
CAATACGGAAGTGCAGAAACGAGTGAAGAAAATGCTGACATTATCACAAC
AAGACAGGAGGAACTAGTTCTCGATGTGCAAGGTATCTCATTACGTGTGG
AAGGTTACTTGGGAGGCGTGTTGACACCCATGCTCAAAATGGATTCCAAA
ATCACAGCTAACTTGAAGGATTGGTCAAGCCAAATGAATGCACACGCTAC
TGTATCATTAGAAGCCAGTTATTATAACGAAAACGTTGCCGAATGGGAGC
CAGTTATTGAACCTTTGATGGAGAAACGGAGGGAAAGACCGTGGCAACTC
TCTGTCAATTACACGATGGAAGGTGACGACAATTCTGCTTCATCCACTTC
CAACGAACTCGTTTTACAAAAACCGGAATCCAACCTGAAAATCAAATCTC
AAGATAATCTTGAATTGACAATTTCAAAATCATGTCTTGCTTTACTCGGT
GAATTGGGACAGGTGTTTGGAGATGCAGTAGAATCTGTGGACGTTTTACC
ACAAGTCCTGGTCGAAAAAGAACCTTTCATGATCGAAAACTTGCTCTCCA
AGAAGGTGACAGTAACATTGAATGAACTTCTGCAGGGACCAAATGGAGAT
TCGACAATCGAGCTAGCATCTTCTTCGAATCCTGTTGGCATTACTTTTGC
TCCCAagaaatttgagaaacgaaAGACCAACGATCTATACACAATCAATT
TAtcgGTGGACGGTTTTCATGACATTAAAGACATTGTGGTTCAAAGAAAG
CGAAGCGTTATCTATGATCTTGTACCAATAAAACTATTATCAGCACAGTC
TTCATATTCGATAGTGGTACAAGTGAAGACAACAGACGGACAACGTATCA
TCGTACTCCGATCACCATTGCAGTTGAAAAATCACTTTCCAATGCCGTTG
GATGTCAGCTACATTTCCAAAGAAAACCAACCAGTTAAACTGACAACAGT
GGGATCGGGAGATATCTATTCCTTCCCTTTGTTGTTAACCTACCACAGTG
TTTTTCATCTCAAACCTGCTGGTTTCGACTACGGTGATTGCACAGAAGCT
CTCAATTGGAGTGATTTGAAGACGAGCAACGAAAAACAGTTCTCCTGCCC
TTCACCTGACAAAAGTGCTGACCCTTTCTACATGCAGGTGGTGATGAAAG
AGGAGACGTACTCTTCCGTACACGGCATGTTGGACTGTGTACCACGTTAC
ACGTTGGAGTGCTTTCCCGTCATCACGCTGCATAATTACCTACCTTGCAC
TATTAATTATAAGATCAAGGGTATGGCGAAATCGGAAAGTCTACCAGGCG
GACACAATTGGCCTTTGTTTACCGTCAACTTCAGTGATAAACCTTCCATC
TATATCGAGATTGAGTCGTATAACAACCAAAGATGGGAAGGAGGTTTGAC
ATTACCAACAAAACCGGTAGATTCTTTGAACAAACCATCATTATCTTTCG
TCATGATGTCTGGTGAACGCAAAATGGAATTGGGTGTTTATTACCAGTTA
GACGGTTCATTGAACATCACCTTATATTCGCCTTACTGGCTTCTCAATAA
AACTGGAAAACCACTTGTCTATCAGCCAGCGGGGAGCAGCATCCAGCAAG
TTCACCAAGAGAACGATGTAAATGCTCTTATGATGCTCGTCAAAGGGAAA
CATAAAAAGgcgaaagtgaaagtgaaaaataGCGAGTCATGGTCAAATGA
ATTTTCATTGGATACTGTTGGCAGTGGTGGTTCCTTGAAATGCAATGGTC
CAAGAGATCGAGTTTATGAGATTGGTTTGAACATCAGTTTGTCATACTTT
GGATTGACGAAGATTGTGACGTTCACGCCACTCCGAATGTTATCTAACCA
CACCAAGTACACCATCAGTATGGCAGAAAGTAATTCTAAATCGTCAGAAT
GGCACACGGTAAACCCTGACGAGaacattccatTCTGGCCGACGAAACTT
CCTTTGGTCAACCTTTACATTAACATCAATGGGCAAGATTCAGTGAAATT
CAACCCTGAAGTTGGAAAAACTTTACTGTTGAAGTTCCAGAATGAGGTTG
GAGGAGTTTGCGTGGATTACCAAGAAAAGGACTCGTCCTCAGTCCTTTCG
TTTAATCCGTACTTCGCAGGTGCAGCTCCTGTGCGGCttgaaaatctttg
caaaaaGATCGGCATGATCGCTTATAAACAAGCAGGTTCGGTAATGGGTC
ACGTGTTAACACATGACCAATCAGTGTTGTACACGTGGGATGATCCAACC
ATGGAACAAGAATTGATTTGTTCCATTGTCAATGATGAAGCCAGTGAAAC
AAGGATCAAACTCGATGCCAACGATTTCGGACGAATGAGAGTTGGAGATG
GTGCAATTTATTGGGTTTCCTTTCTGGATGGTCTTCAACGTGTTCTATTG
TTCACTGATAACTTCAAATCTGCTTACTGCGCATGTCAGgaGCAAAATTT
ACGCCCAACCATGGAAGTTGACTTTGAGATTGAGAGTTTTGGTTTGTCTC
TGGTCAATGTTGATAAGAGAATGGAGATTGGCTACTTAGCTATCCGACAA
AGCAAGACTGTATGGGAGCAACGCAAGAAAAAGAACCGCTGGAAAGCTTT
ACCGCTTGCCATGTGTGAAGCTCTCGAAGAAGGTTATCTCAATTATCAAA
ACAGAAAAGGTGCAGTCAAAGAGAAAGTTCTGGATAAGGAGGTGGATTAC
GAGAAGATGTTTATTACGAAACCTGAGAAGATTAAGATCAGAAGAACGTA
CCACAGCGGTCTTGGTTTCAAATACACAATCTCACCCAATGAAATGCGTG
TGCATGCTTCTATCAGCTCAATACAGTTGGATAGCCATGTTCCAGGTTCG
ACCTTTCCAACAGTCTTGCATATGGTTGAACCACCAAAATCTGTTGCTTC
AGAAAACGCTCCAAAGCCATTCTttgaattgagtttaatgaCAAGGATCG
GTGATAAAAATGTGGTCAATGAAGTcagCTATTGTCACGTGTTGATTCAA
GAGATGGATGTGAGGGTTGATATTGGATTTTTATTGGCTCTGATGGAACT
CTTCAGTCATGCAAGAGCTCGAACAACCGAGAAAGAACAATACGCGCTTG
ATATTGGCCAAGCAGCAACAAAGTTTGAAGAAAGCGCTGAATTTCAGGCA
GCCAAACAAGATCGATATTACGTTTTGAACGACTTTCATTTATCACCGCT
AAAGATTCACGTCAGTTTCTCTTTGACGGGTGGTTCCAAAGATGAAAATG
CTATTGCTTCATTACATGGTAACGTGTTGAACTTGTTGTTACAAAGTGTC
GGACTGGCCTTCACTGAAATACAAGACGTACAATTCAAATTAGCATGTTA
CGAAGTGCATAAGTCCATGCAGAGTAATTCGCAGCTCGGTGATGGAATAA
CTAAACATTATCAAACACAGGCTATCAAGCAACTTTATGTGTTGGTACTC
GGGCTAGACGTTCTTGGTAATCCGTATGGTTTGATATCTGGTGTTGGAAC
CGGAGCAAAGAATTTCTTCTACGAACCTTACCAGGGATTAATTCAAGGAC
CAGAAGAATTTGCGGAAGGATTGGCGTATGGGGTGAAGAGTCTTGTTGGT
GGAACCGTGGGTGGAGTATCAGGAGCTGTGAGTAAGATTACCGGTACCTT
CGGTAAAGGTTTGGCTGCATTGACCTTGGATGAAGAATATCAACAAAAGA
GACGTGAAAACATGAGCCAACGCCCAACTAACCTCGGTGAAGGTCTCGCC
AAAGGTGGTAAAGGCCTTGTAAAGGGTATCGTGTCTGGTGTTACAGGGAT
CGTTACCAAACCCTATGAAGGTGCCAAGAATGATGGTGCAGGTGGCTTTT
TTAAGGGCGTTGGAAAAGGCCTGATTGGCGTGGTTGCACGCCCTGTTGGT
GGAGTGGTAGATATGGCCAGTAACACGTTTGATGGTTTGAAAAGCACGAC
ATCTGGCGTGAAAGCGATCGAGTTGAGCCGTGTTACTCGCGTCTTCCACG
CAGATAAGGTTTTACGACCTTTCAATCTGTACGAAGCAGATGGAAACAAA
ATTCTTATGCAATGTAACAAAGGAGAATACGCCAAGAAGAATTTTTATAT
CACTCATGTAGTGGACAAGAAGAACTATCTCATCCTCACTCAATCaaacA
TTTTGTATGTTGGAAAGAACGAGTTGAAAATGGGTGAATGGGAATCggtt
tgggttatcgagttcaATGAGCTAAAACGTGAACCAGAAGTGAAAGAGAC
AAAGATTATTTTCCATATCCATAATACGGACACGCGACGTTCAATTTTCA
AGAAATCGACGAACACACGTGAAGTGATATTGGAGTCTAGTGCTGTTGCA
GACTGGTTTATCTTAAAGCTTAGAGATGCTAAAATGTTATAGatggtatt
tgaaTCTTTGGTTGCTGACCTCTTGAACAAGTATCTGGGTCAATATGTGA
AAAATCTTGATGCTTCTCAATTGAAGATTGGCATTTGGGGAGGAAATGTT
GTCCTGACAGAACTTGAACTGAAAGATACAGCTCTGGATGATCTTGACTT
ACCCATAAAAGTTGTTCGTGGATATTTGGgtAAATTGGTCTTGTCCATCC
CATGGAAAAATCTTTACACTGAATCAACTGTTGTCGATATTCAAGATCTC
CACCTTGTCGCTAAGCCTAATTTTGACATCAAATACAATGAAGAACgcga
agaaaaatcaaaacatgacAAGAAACAACAACAGATTCACAATATCGAAG
AAGCGAGGCAAAGAGAAGAAGACAAAAAGAAAGGCGCCAAGAAAGAAGAG
AGTGACGGTTTTGCTGAGAAACTTGCAACAAACGTCATAAAAAATCTACA
GGTTACGATCAAGAACATACATGTTCGATATGAAGACTCAATCAGTGATG
TGAATGGACCCTTTTCAGTCGGTCTTACAATGGAAAGTTTAACAGCACAA
ACCACAGATGAAGATTTTGTTCCAAAGATTATCAAAGAATCTGTCTCATT
AATTCATAAGatggTGAAATTAGACAATTTGGCTTTATATTGGAATCCAG
GAGACGAACTGATTGATCCTTCACTTGATACCAAGCAATGGTTGgaagtT
TCAACGAAGCAAATTTCAACACACCAATCGAAGCCAGAGAAAACGAAATA
TATTTTGAGTCCCATGGTTGCAACGAAGAAATTGAAGCTGAACACCAAAC
CAGGTTCCAACCTTGACATCCCGAAGatgttTTTGAACTTGGTTTTGGAA
GAACTTGGTATCATCGTGGCAAGAAGTCAATATCATGGCGTGGTGCAACT
GATTGAATCATTTGAACGAATGAATAGGAACCAACCTTTTCGTAAATACA
GACCACATACCTCCGTTCTTGGGAACGAAAGTATTTGGTGGAAGTACTGC
ATGTCCAGCATACTGGAGGTGGATGTCAAAAGACGATCTCAAATGTGGAG
CTGGAAGCATATTCAAAAACATCGAGTTCTTTGCAAAGCTTACAAAGTGA
AGTAcaaggaaaaattgaaacagaaaaATCCATCCAAACAAATTCTCACT
GAACTAGAGaGCATGGAGGATGAGTTGAATATTGCAAGCATCACCATTTT
TCGACAGCTTGCAGCTACAGAGGTTTTAACGGAACAAAAGAAGAAAGGCA
CTAAAGGAAGTTTCTTCAGTTTCTTCTCCAGATCAAAAGAACCAGAAAAG
TCTGCTGCTAATAAAATTGGAGATTTAATGGGTGATGACCAGGAGAAGGA
AATGCAGAAATTGTATGACGCAATCGGTTATACTGAAAATGAAGTCATCA
CTCCCTTTCCTAAAGAGTACGTGGCGATGTCAGTGGAATCGATTCTCCAG
AAATTATTCATCAGCCTCATCGATGACACAGATAAGGCGAAAGAATTCAA
AGTGTTGGATTTTTCACTCAACAACATCATTGTAGAAGTTTTCCAAAGAC
CTTCTGCTCAAGCTCTCAAATTATGTGCAAAGATAGGAGAGATGAAGTTA
TTTGGTACAGCTTCTGCTCAATGTACACCTCtcatcatcaaaaacatgtt
aCAAGGTCGAGGTATGGAATTTCTGCCGTTGGTGGACTTCATCTTTGAGA
CGAATCCTTTGAAGAAACCGGACATTGACCAATGTATCACTGCTATTTGT
CAACCCTTAGAAATCATCTATGATGCTAACACGATCAACCATATCATTAG
TTTCTTCAAACCTCCTGAACATGTTATCTTGCAAGATTTACAAGACAAAG
CGTATTCTACTTTCGAAGATTTTAAAGTTTCAAGTACGGCTGGTCTTCTA
CATGCTATGGAACAAAGAACGGTTATGGACATCGACATTGATGTTGGAGC
ATCTCATTTGATCATCCCTGAAAAAGGTTCTTACAATGGTTGTACAGATA
TGCTGGTGATCGACTTTGGTAAAATCACGATGAGCAGCGATCCTAGTCAA
ATCAGACACCTTGACCCTAAGGACATTGAGGATGTGAATGAAGTACAAAG
CAAAGCTTATGATCGATTCTTGTTGTCGCTTCAAGCTCTTCAAATATTAC
TCGTTAGAGAAGGTGAAGATTTAAAGAGTGCTAAAAGCAACGTCAGTAAA
GCTTCATCACACATTTTGCATCCCATCAATTTCGATGGCAAACTTGCCAA
AGCTATACTTCCACAAGATCCACGTTTAAAACAGATATGTGTCTCTGGTG
AATTATCTTCGCTGTTTGTTTCTGTATCGGATGATAAAGTCAGTCGTCTC
ATCAAGCTAGCAGACTCGATACCACTCCCTCAATCACCTTCTCACGATAA
CATCGACGGAGAAGAAAAACCTGAAGGACTCTTCACCAAGGCGTTGTCAA
TGATAAGCTTGACAGGTGACAATGACACAGGGGTGGACATCGGAGGATTT
TCCATCCCTGTACCGACATCTCCAACATCAGTGACGTCAGATGAAGATGA
ATACGGGACACCACCTGATGGCTCCATATTACAGTTACAACAAGAAGCTG
GTCCGGACTTTTCATCAGGAGTGGCGAACCAAGTCAAAGTGGACTTGAAC
TTTAAAATCCATAAAGTGATGATCGCCATTGGTTTGACTGACAAAGCATT
GAAACAGGAAAAAGAATGTCTGAAATTCATCGTGGACGACATCAATACAG
AGgtGATACTACGAAGATGGGATTTGTTCGTCAATGCAGAAGTTGGTCGT
CTGGTGTTGAATGAAATGACATGGGGTGTTGATGGAGAACCTTTCGCCAT
CATGAGTACacccaaaaacaccaaaatgttGAAATTCAGCTATCGGAGGT
GTGAATTCAACGAAAGTTTGAATCTCGGTCCAAGTTACTTTTATTCCAAA
GAAGCGCAAGTCAGAGCTTTACATTTCAAAGATGAATTTGGCGCCACGGA
TCAGATTTTAGATGTACAAGTGGCTACTTTATTTCTGATGCTTCATCAAG
AAGCACTTTTGAGCATCATGTCATTGATCTACCAAGTACTGGAACCACTC
AACAAACATGATAAGGAAGCCACACAGAAGATCAAACGGAGTTTGAGTAC
GGCAGGTAGTCGTTTGAGTCTCTCCatcgaagaaaaagaaaaggagaGAC
AGATACAACGAAAATTAGCCAACCCTAAAGCACTGGAAGCTGCCAACGAA
CTTAAGCAACAGGTTGGcttagaagaagaaaaaaagatgaGAGTGACCGC
CCACCTGGATGGTGTTGGTATCATGATTTGTTCAGCCAAAGTTGACCTTG
CACAAGCCTTCGTTAAAGGGTTATCTGCTAAAGTACTGATGAAAGATGAC
TTATTAGAAGTGAAAGCCAGCATGAAAGATATGCAAGTACAAGATAATGT
TGGCGAAACAAAGTACAAAGACATCATTAGCATGCGATCTGATGAAGTGT
TCGATTTAGAGTTGGCTATTTACGAGAATGGATCTTCTGGTAGCAAGCAA
TACGATATGTCGTGTGTCGACACCAGTGTCAAACTGAACTTCGGTCAAAT
GCGCGTTGTTTTCTTGTATAGATTCATACAAGACTTAATGTCATTCACCG
AAAACTTCGAAGAAGCACAGAAAGCAGTTGTGGAAGCTGGTAAAGCTGCC
AAGGATAAAGCTCTGGAAACAGCGACCGATTTGAATAGACATTCTTCTCG
TGTCAAACTAAATGTGGTTCTGAAAGCACCGACTATTATCATTCCAGTTG
GATCAAACAATGAATTGGCTTTACTGGTGGATCTGGGTGAATTGCGTATT
TACAACACATTCAAACTCCTCAACGATGATCAATACCATAAGAAATCTAT
CATCACTGATAACATGACCATTAAGTTATCCAATCTGAAATTGTTAAAAG
CACTTATTCAAGATGGTAAAGATTTCTTGCATCAACGAGCCATTATTGAA
CCTATGATGCTACAAATAACTATTGTTCGTAATTTAACGAAAGGTAACCA
TTCCATACCGGATGTTTCAGTTCAAGCAAAGATGCCAGCTATTCTGTTAT
CAATCAGTGAAGAAGATGTGACCGTAGCTCTAAAGATTGTCCAAGGGAAT
CTCGCCGAAGGTGAGTCACATGCGCCGAAGAAGCAAGCCAAGCCTGCCAA
ACAAACGTTAAACGTGCCACAAGATCGTTTAGCAGACATTTACGAGGAGc
ctgaagatgaagatgagaaTCGACAAGGATATCTTCAAACCAAACTATCC
TTCGATCTGGCTAAAATTGACATCAAGCTTTACTTGAAACCATCTGATAT
GACATTTGAAGATGAATTTTTAGCGAGGACGGATGATTTGTTGTTAGCTT
TGTTCACTATTGGTAACCTGTGTGTTGATGGAGACATCATGTCCACGCAA
GCTATGAAGATGAGCGTTCGATTGGACACTTTGGTGTTGGATGATATGAG
ACCTATCGAGGAGCATGAAGGTGTTAAACGTATGATCAACTACAGTCCCG
AGCCACTCCTTGAAGAAGTCAAAACCTCTTCTCATAAACGACCAATCGAC
AACTCACGAATGATCGAAATCCAAttcgatcaaacttcatcgcaagataa
aaatatcgacATCAAACTTTGTAACATGCTTTGTATATTCAACGTTGAGT
TTATCATGGTCCTGTTGAAAACGTTGCAAGCTGCCATACCTAAAGATGAT
AGTCTGCAACATGGCCATTCAATGAGTAGTCTAGACTCGGCGGCAGGGTC
TGGCGGCAGCGATGACGAGGACTCTTTAGAAGCCAGCGAGATTGTCCTCT
GCACTGGTGATCAAGAAAGACCTGAGACTAAAGTCTCTATCTTCGTCCAT
AACCCGCAAATTGTTTTACTAGCAGATGCAAAGGATGTCAAAACAAATGC
ACTCTTTCTTACAACCGagatcaattttcaatatttcgaaTTGCGAGATA
CTCAAAAAATGATTGGCGCTGTTTCTAACACCGCTATTTTGTCAACTGCT
TTCAAGAATGACCATCGGAGTGATATATCAACAGTGTTGTCATTAGATTC
CATCAATCTCCACTCGTCATCACCCATCAATGGTAAACCTCATATGAGTG
TCAGCACAACTTTGATCAAACTGAATATCTCACCCAAAACCATCCGAACT
TTATCAGCGTGTGCTGGTTACATCTCCAATGATCCAACAGATGAAGAAAT
CAAAGAAGCTCGAAAAGCCATGCGTGATTTATGGCAAATTCAAACGTTCA
CCAATAAGCGACCGTGGTATTTAAACCACCCACCACAACAAGTCTTAAGT
GCTGGCAGCTTCGTCCTTGCGCGAACGAGAACAGGAGAATATAAGCATGG
TTTCTTAGCTAAAAAGGATGTCTCGTATCAAGTCTATTTTTCAGAGGAGC
GAGGAACAGCCAGTCACCGAGCCATGGATATCTCATCTGTTGTTTTGGAT
ATCGTACCGCTGATCGGTGATCTATGTGTTGGATGTAATGTTTTAGCTGT
GGAATCGAAAGAACATGGATATCGTACTGGTCGAATTACTCAGGTTTGGG
ATTCGAATGTGGATAAAGATTCTTCGGATGGCGCCAAACAATCTGTTTCT
GTCAAGACAACTGCTATTGCTCCAATCAAATACCTTGTCAATTTCTATGA
CAACCAAACGGAGAACTTCTTCCCGCCTGATGAACTTCGTATCATTGGTA
AACCCATCAAGGGGGTTGTCCCTGGACTAGGGGCGTGTGTTTACGCCCGC
TTTAATGATGGTTTTTACTATCGGGGCAAAGTTGATGACATCGAGGATTA
TCGAATCCGAGTGCAATTGGATGAGATCAGTGGAGAAATCGAACACGACA
TCGATGATCCGTCAGCCGTTATTTTGAACCTGACGCCTCAATACCGTCAA
GTCAAAAAGCATTTCAAAGTCATTGCATCCAAAGGAAGCACAACTAAAGG
ATATCATCCGGGGAAAGTGACCGCCATCCAAGGTGAAGGAAATAACCGAT
TGTATTCGATACGCTTCGAAGACGGTACAATTAACCAAGTACCCATCacg
aaattgattttgatgccAAAAGCACCTTTTGATGCTTTACCTGAAGTTGG
CACATACGTTTATTCCCGAGTGTCACGCGACGCTCCTTTATACGAGAAGG
GTATCGTAGCAGAGAAGAACACAATGATCTGCGTTAAACATTTAAATGGA
CGGAAATTGGCTCACGAAATACAAAACATTCATTTTGTTGTCCGAAATAT
CGTTCCTCTCGTGTCATCAttgaagGTTGGTTTGGACGTCATAGTGCAAC
CTGACAATGACGATCAGAAAATGTATTTGGCTGTCATTAGGGAAGTCACC
AAAAAAGAAGGTGACAAAACGAACCGTTATCTAGTGGAGTTTACGGATGG
ATCCAAGAAGAGAGTGACGCCCAGCCGGATCCGTATACTTTCTCAATACG
GAAGTGCAGAAACGAGTGAAGAAAATGCTGACATTATCACAACAAGACAG
GAGGAACTAGTTCTCGATGTGCAAGGTATCTCATTACGTGTGGAAGGTTA
CTTGGGAGGCGTGTTGACACCCATGCTCAAAATGGATTCCAAAATCACAG
CTAACTTGAAGGATTGGTCAAGCCAAATGAATGCACACGCTACTGTATCA
TTAGAAGCCAGTTATTATAACGAAAACGTTGCCGAATGGGAGCCAGTTAT
TGAACCTTTGATGGAGAAACGGAGGGAAAGACCGTGGCAACTCTCTGTCA
ATTACACGATGGAAGGTGACGACAATTCTGCTTCATCCACTTCCAACGAA
CTCGTTTTACAAAAACCGGAATCCAACCTGAAAATCAAATCTCAAGATAA
TCTTGAATTGACAATTTCAAAATCATGTCTTGCTTTACTCGGTGAATTGG
GACAGGTGTTTGGAGATGCAGTAGAATCTGTGGACGTTTTACCACAAGTC
CTGGTCGAAAAAGAACCTTTCATGATCGAAAACTTGCTCTCCAAGAAGGT
GACAGTAACATTGAATGAACTTCTGCAGGGACCAAATGGAGATTCGACAA
TCGAGCTAGCATCTTCTTCGAATCCTGTTGGCATTACTTTTGCTCCCAag
aaatttgagaaacgaaAGACCAACGATCTATACACAATCAATTTAtcgGT
GGACGGTTTTCATGACATTAAAGACATTGTGGTTCAAAGAAAGCGAAGCG
TTATCTATGATCTTGTACCAATAAAACTATTATCAGCACAGTCTTCATAT
TCGATAGTGGTACAAGTGAAGACAACAGACGGACAACGTATCATCGTACT
CCGATCACCATTGCAGTTGAAAAATCACTTTCCAATGCCGTTGGATGTCA
GCTACATTTCCAAAGAAAACCAACCAGTTAAACTGACAACAGTGGGATCG
GGAGATATCTATTCCTTCCCTTTGTTGTTAACCTACCACAGTGTTTTTCA
TCTCAAACCTGCTGGTTTCGACTACGGTGATTGCACAGAAGCTCTCAATT
GGAGTGATTTGAAGACGAGCAACGAAAAACAGTTCTCCTGCCCTTCACCT
GACAAAAGTGCTGACCCTTTCTACATGCAGGTGGTGATGAAAGAGGAGAC
GTACTCTTCCGTACACGGCATGTTGGACTGTGTACCACGTTACACGTTGG
AGTGCTTTCCCGTCATCACGCTGCATAATTACCTACCTTGCACTATTAAT
TATAAGATCAAGGGTATGGCGAAATCGGAAAGTCTACCAGGCGGACACAA
TTGGCCTTTGTTTACCGTCAACTTCAGTGATAAACCTTCCATCTATATCG
AGATTGAGTCGTATAACAACCAAAGATGGGAAGGAGGTTTGACATTACCA
ACAAAACCGGTAGATTCTTTGAACAAACCATCATTATCTTTCGTCATGAT
GTCTGGTGAACGCAAAATGGAATTGGGTGTTTATTACCAGTTAGACGGTT
CATTGAACATCACCTTATATTCGCCTTACTGGCTTCTCAATAAAACTGGA
AAACCACTTGTCTATCAGCCAGCGGGGAGCAGCATCCAGCAAGTTCACCA
AGAGAACGATGTAAATGCTCTTATGATGCTCGTCAAAGGGAAACATAAAA
AGgcgaaagtgaaagtgaaaaataGCGAGTCATGGTCAAATGAATTTTCA
TTGGATACTGTTGGCAGTGGTGGTTCCTTGAAATGCAATGGTCCAAGAGA
TCGAGTTTATGAGATTGGTTTGAACATCAGTTTGTCATACTTTGGATTGA
CGAAGATTGTGACGTTCACGCCACTCCGAATGTTATCTAACCACACCAAG
TACACCATCAGTATGGCAGAAAGTAATTCTAAATCGTCAGAATGGCACAC
GGTAAACCCTGACGAGaacattccatTCTGGCCGACGAAACTTCCTTTGG
TCAACCTTTACATTAACATCAATGGGCAAGATTCAGTGAAATTCAACCCT
GAAGTTGGAAAAACTTTACTGTTGAAGTTCCAGAATGAGGTTGGAGGAGT
TTGCGTGGATTACCAAGAAAAGGACTCGTCCTCAGTCCTTTCGTTTAATC
CGTACTTCGCAGGTGCAGCTCCTGTGCGGCttgaaaatctttgcaaaaaG
ATCGGCATGATCGCTTATAAACAAGCAGGTTCGGTAATGGGTCACGTGTT
AACACATGACCAATCAGTGTTGTACACGTGGGATGATCCAACCATGGAAC
AAGAATTGATTTGTTCCATTGTCAATGATGAAGCCAGTGAAACAAGGATC
AAACTCGATGCCAACGATTTCGGACGAATGAGAGTTGGAGATGGTGCAAT
TTATTGGGTTTCCTTTCTGGATGGTCTTCAACGTGTTCTATTGTTCACTG
ATAACTTCAAATCTGCTTACTGCGCATGTCAGgaGCAAAATTTACGCCCA
ACCATGGAAGTTGACTTTGAGATTGAGAGTTTTGGTTTGTCTCTGGTCAA
TGTTGATAAGAGAATGGAGATTGGCTACTTAGCTATCCGACAAAGCAAGA
CTGTATGGGAGCAACGCAAGAAAAAGAACCGCTGGAAAGCTTTACCGCTT
GCCATGTGTGAAGCTCTCGAAGAAGGTTATCTCAATTATCAAAACAGAAA
AGGTGCAGTCAAAGAGAAAGTTCTGGATAAGGAGGTGGATTACGAGAAGA
TGTTTATTACGAAACCTGAGAAGATTAAGATCAGAAGAACGTACCACAGC
GGTCTTGGTTTCAAATACACAATCTCACCCAATGAAATGCGTGTGCATGC
TTCTATCAGCTCAATACAGTTGGATAGCCATGTTCCAGGTTCGACCTTTC
CAACAGTCTTGCATATGGTTGAACCACCAAAATCTGTTGCTTCAGAAAAC
GCTCCAAAGCCATTCTttgaattgagtttaatgaCAAGGATCGGTGATAA
AAATGTGGTCAATGAAGTcagCTATTGTCACGTGTTGATTCAAGAGATGG
ATGTGAGGGTTGATATTGGATTTTTATTGGCTCTGATGGAACTCTTCAGT
CATGCAAGAGCTCGAACAACCGAGAAAGAACAATACGCGCTTGATATTGG
CCAAGCAGCAACAAAGTTTGAAGAAAGCGCTGAATTTCAGGCAGCCAAAC
AAGATCGATATTACGTTTTGAACGACTTTCATTTATCACCGCTAAAGATT
CACGTCAGTTTCTCTTTGACGGGTGGTTCCAAAGATGAAAATGCTATTGC
TTCATTACATGGTAACGTGTTGAACTTGTTGTTACAAAGTGTCGGACTGG
CCTTCACTGAAATACAAGACGTACAATTCAAATTAGCATGTTACGAAGTG
CATAAGTCCATGCAGAGTAATTCGCAGCTCGGTGATGGAATAACTAAACA
TTATCAAACACAGGCTATCAAGCAACTTTATGTGTTGGTACTCGGGCTAG
ACGTTCTTGGTAATCCGTATGGTTTGATATCTGGTGTTGGAACCGGAGCA
AAGAATTTCTTCTACGAACCTTACCAGGGATTAATTCAAGGACCAGAAGA
ATTTGCGGAAGGATTGGCGTATGGGGTGAAGAGTCTTGTTGGTGGAACCG
TGGGTGGAGTATCAGGAGCTGTGAGTAAGATTACCGGTACCTTCGGTAAA
GGTTTGGCTGCATTGACCTTGGATGAAGAATATCAACAAAAGAGACGTGA
AAACATGAGCCAACGCCCAACTAACCTCGGTGAAGGTCTCGCCAAAGGTG
GTAAAGGCCTTGTAAAGGGTATCGTGTCTGGTGTTACAGGGATCGTTACC
AAACCCTATGAAGGTGCCAAGAATGATGGTGCAGGTGGCTTTTTTAAGGG
CGTTGGAAAAGGCCTGATTGGCGTGGTTGCACGCCCTGTTGGTGGAGTGG
TAGATATGGCCAGTAACACGTTTGATGGTTTGAAAAGCACGACATCTGGC
GTGAAAGCGATCGAGTTGAGCCGTGTTACTCGCGTCTTCCACGCAGATAA
GGTTTTACGACCTTTCAATCTGTACGAAGCAGATGGAAACAAAATTCTTA
TGCAATGTAACAAAGGAGAATACGCCAAGAAGAATTTTTATATCACTCAT
GTAGTGGACAAGAAGAACTATCTCATCCTCACTCAATCaaacATTTTGTA
TGTTGGAAAGAACGAGTTGAAAATGGGTGAATGGGAATCggtttgggtta
tcgagttcaATGAGCTAAAACGTGAACCAGAAGTGAAAGAGACAAAGATT
ATTTTCCATATCCATAATACGGACACGCGACGTTCAATTTTCAAGAAATC
GACGAACACACGTGAAGTGATATTGGAGTCTAGTGCTGTTGCAGACTGGT
TTATCTTAAAGCTTAGAGATGCTAAAATGTTATAGatggtatttgaaTCT
TTGGTTGCTGACCTCTTGAACAAGTATCTGGGTCAATATGTGAAAAATCT
TGATGCTTCTCAATTGAAGATTGGCATTTGGGGAGGAAATGTTGTCCTGA
CAGAACTTGAACTGAAAGATACAGCTCTGGATGATCTTGACTTACCCATA
AAAGTTGTTCGTGGATATTTGGgtAAATTGGTCTTGTCCATCCCATGGAA
AAATCTTTACACTGAATCAACTGTTGTCGATATTCAAGATCTCCACCTTG
TCGCTAAGCCTAATTTTGACATCAAATACAATGAAGAACgcgaagaaaaa
tcaaaacatgacAAGAAACAACAACAGATTCACAATATCGAAGAAGCGAG
GCAAAGAGAAGAAGACAAAAAGAAAGGCGCCAAGAAAGAAGAGAGTGACG
GTTTTGCTGAGAAACTTGCAACAAACGTCATAAAAAATCTACAGGTTACG
ATCAAGAACATACATGTTCGATATGAAGACTCAATCAGTGATGTGAATGG
ACCCTTTTCAGTCGGTCTTACAATGGAAAGTTTAACAGCACAAACCACAG
ATGAAGATTTTGTTCCAAAGATTATCAAAGAATCTGTCTCATTAATTCAT
AAGatggTGAAATTAGACAATTTGGCTTTATATTGGAATCCAGGAGACGA
ACTGATTGATCCTTCACTTGATACCAAGCAATGGTTGgaagtTTCAACGA
AGCAAATTTCAACACACCAATCGAAGCCAGAGAAAACGAAATATATTTTG
AGTCCCATGGTTGCAACGAAGAAATTGAAGCTGAACACCAAACCAGGTTC
CAACCTTGACATCCCGAAGatgttTTTGAACTTGGTTTTGGAAGAACTTG
GTATCATCGTGGCAAGAAGTCAATATCATGGCGTGGTGCAACTGATTGAA
TCATTTGAACGAATGAATAGGAACCAACCTTTTCGTAAATACAGACCACA
TACCTCCGTTCTTGGGAACGAAAGTATTTGGTGGAAGTACTGCATGTCCA
GCATACTGGAGGTGGATGTCAAAAGACGATCTCAAATGTGGAGCTGGAAG
CATATTCAAAAACATCGAGTTCTTTGCAAAGCTTACAAAGTGAAGTAcaa
ggaaaaattgaaacagaaaaATCCATCCAAACAAATTCTCACTGAACTAG
AGaGCATGGAGGATGAGTTGAATATTGCAAGCATCACCATTTTTCGACAG
CTTGCAGCTACAGAGGTTTTAACGGAACAAAAGAAGAAAGGCACTAAAGG
AAGTTTCTTCAGTTTCTTCTCCAGATCAAAAGAACCAGAAAAGTCTGCTG
CTAATAAAATTGGAGATTTAATGGGTGATGACCAGGAGAAGGAAATGCAG
AAATTGTATGACGCAATCGGTTATACTGAAAATGAAGTCATCACTCCCTT
TCCTAAAGAGTACGTGGCGATGTCAGTGGAATCGATTCTCCAGAAATTAT
TCATCAGCCTCATCGATGACACAGATAAGGCGAAAGAATTCAAAGTGTTG
GATTTTTCACTCAACAACATCATTGTAGAAGTTTTCCAAAGACCTTCTGC
TCAAGCTCTCAAATTATGTGCAAAGATAGGAGAGATGAAGTTATTTGGTA
CAGCTTCTGCTCAATGTACACCTCtcatcatcaaaaacatgttaCAAGGT
CGAGGTATGGAATTTCTGCCGTTGGTGGACTTCATCTTTGAGACGAATCC
TTTGAAGAAACCGGACATTGACCAATGTATCACTGCTATTTGTCAACCCT
TAGAAATCATCTATGATGCTAACACGATCAACCATATCATTAGTTTCTTC
AAACCTCCTGAACATGTTATCTTGCAAGATTTACAAGACAAAGCGTATTC
TACTTTCGAAGATTTTAAAGTTTCAAGTACGGCTGGTCTTCTACATGCTA
TGGAACAAAGAACGGTTATGGACATCGACATTGATGTTGGAGCATCTCAT
TTGATCATCCCTGAAAAAGGTTCTTACAATGGTTGTACAGATATGCTGGT
GATCGACTTTGGTAAAATCACGATGAGCAGCGATCCTAGTCAAATCAGAC
ACCTTGACCCTAAGGACATTGAGGATGTGAATGAAGTACAAAGCAAAGCT
TATGATCGATTCTTGTTGTCGCTTCAAGCTCTTCAAATATTACTCGTTAG
AGAAGGTGAAGATTTAAAGAGTGCTAAAAGCAACGTCAGTAAAGCTTCAT
CACACATTTTGCATCCCATCAATTTCGATGGCAAACTTGCCAAAGCTATA
CTTCCACAAGATCCACGTTTAAAACAGATATGTGTCTCTGGTGAATTATC
TTCGCTGTTTGTTTCTGTATCGGATGATAAAGTCAGTCGTCTCATCAAGC
TAGCAGACTCGATACCACTCCCTCAATCACCTTCTCACGATAACATCGAC
GGAGAAGAAAAACCTGAAGGACTCTTCACCAAGGCGTTGTCAATGATAAG
CTTGACAGGTGACAATGACACAGGGGTGGACATCGGAGGATTTTCCATCC
CTGTACCGACATCTCCAACATCAGTGACGTCAGATGAAGATGAATACGGG
ACACCACCTGATGGCTCCATATTACAGTTACAACAAGAAGCTGGTCCGGA
CTTTTCATCAGGAGTGGCGAACCAAGTCAAAGTGGACTTGAACTTTAAAA
TCCATAAAGTGATGATCGCCATTGGTTTGACTGACAAAGCATTGAAACAG
GAAAAAGAATGTCTGAAATTCATCGTGGACGACATCAATACAGAGgtGAT
ACTACGAAGATGGGATTTGTTCGTCAATGCAGAAGTTGGTCGTCTGGTGT
TGAATGAAATGACATGGGGTGTTGATGGAGAACCTTTCGCCATCATGAGT
ACacccaaaaacaccaaaatgttGAAATTCAGCTATCGGAGGTGTGAATT
CAACGAAAGTTTGAATCTCGGTCCAAGTTACTTTTATTCCAAAGAAGCGC
AAGTCAGAGCTTTACATTTCAAAGATGAATTTGGCGCCACGGATCAGATT
TTAGATGTACAAGTGGCTACTTTATTTCTGATGCTTCATCAAGAAGCACT
TTTGAGCATCATGTCATTGATCTACCAAGTACTGGAACCACTCAACAAAC
ATGATAAGGAAGCCACACAGAAGATCAAACGGAGTTTGAGTACGGCAGGT
AGTCGTTTGAGTCTCTCCatcgaagaaaaagaaaaggagaGACAGATACA
ACGAAAATTAGCCAACCCTAAAGCACTGGAAGCTGCCAACGAACTTAAGC
AACAGGTTGGcttagaagaagaaaaaaagatgaGAGTGACCGCCCACCTG
GATGGTGTTGGTATCATGATTTGTTCAGCCAAAGTTGACCTTGCACAAGC
CTTCGTTAAAGGGTTATCTGCTAAAGTACTGATGAAAGATGACTTATTAG
AAGTGAAAGCCAGCATGAAAGATATGCAAGTACAAGATAATGTTGGCGAA
ACAAAGTACAAAGACATCATTAGCATGCGATCTGATGAAGTGTTCGATTT
AGAGTTGGCTATTTACGAGAATGGATCTTCTGGTAGCAAGCAATACGATA
TGTCGTGTGTCGACACCAGTGTCAAACTGAACTTCGGTCAAATGCGCGTT
GTTTTCTTGTATAGATTCATACAAGACTTAATGTCATTCACCGAAAACTT
CGAAGAAGCACAGAAAGCAGTTGTGGAAGCTGGTAAAGCTGCCAAGGATA
AAGCTCTGGAAACAGCGACCGATTTGAATAGACATTCTTCTCGTGTCAAA
CTAAATGTGGTTCTGAAAGCACCGACTATTATCATTCCAGTTGGATCAAA
CAATGAATTGGCTTTACTGGTGGATCTGGGTGAATTGCGTATTTACAACA
CATTCAAACTCCTCAACGATGATCAATACCATAAGAAATCTATCATCACT
GATAACATGACCATTAAGTTATCCAATCTGAAATTGTTAAAAGCACTTAT
TCAAGATGGTAAAGATTTCTTGCATCAACGAGCCATTATTGAACCTATGA
TGCTACAAATAACTATTGTTCGTAATTTAACGAAAGGTAACCATTCCATA
CCGGATGTTTCAGTTCAAGCAAAGATGCCAGCTATTCTGTTATCAATCAG
TGAAGAAGATGTGACCGTAGCTCTAAAGATTGTCCAAGGGAATCTCGCCG
AAGGTGAGTCACATGCGCCGAAGAAGCAAGCCAAGCCTGCCAAACAAACG
TTAAACGTGCCACAAGATCGTTTAGCAGACATTTACGAGGAGcctgaaga
tgaagatgagaaTCGACAAGGATATCTTCAAACCAAACTATCCTTCGATC
TGGCTAAAATTGACATCAAGCTTTACTTGAAACCATCTGATATGACATTT
GAAGATGAATTTTTAGCGAGGACGGATGATTTGTTGTTAGCTTTGTTCAC
TATTGGTAACCTGTGTGTTGATGGAGACATCATGTCCACGCAAGCTATGA
AGATGAGCGTTCGATTGGACACTTTGGTGTTGGATGATATGAGACCTATC
GAGGAGCATGAAGGTGTTAAACGTATGATCAACTACAGTCCCGAGCCACT
CCTTGAAGAAGTCAAAACCTCTTCTCATAAACGACCAATCGACAACTCAC
GAATGATCGAAATCCAAttcgatcaaacttcatcgcaagataaaaatatc
gacATCAAACTTTGTAACATGCTTTGTATATTCAACGTTGAGTTTATCAT
GGTCCTGTTGAAAACGTTGCAAGCTGCCATACCTAAAGATGATAGTCTGC
AACATGGCCATTCAATGAGTAGTCTAGACTCGGCGGCAGGGTCTGGCGGC
AGCGATGACGAGGACTCTTTAGAAGCCAGCGAGATTGTCCTCTGCACTGG
TGATCAAGAAAGACCTGAGACTAAAGTCTCTATCTTCGTCCATAACCCGC
AAATTGTTTTACTAGCAGATGCAAAGGATGTCAAAACAAATGCACTCTTT
CTTACAACCGagatcaattttcaatatttcgaaTTGCGAGATACTCAAAA
AATGATTGGCGCTGTTTCTAACACCGCTATTTTGTCAACTGCTTTCAAGA
ATGACCATCGGAGTGATATATCAACAGTGTTGTCATTAGATTCCATCAAT
CTCCACTCGTCATCACCCATCAATGGTAAACCTCATATGAGTGTCAGCAC
AACTTTGATCAAACTGAATATCTCACCCAAAACCATCCGAACTTTATCAG
CGTGTGCTGGTTACATCTCCAATGATCCAACAGATGAAGAAATCAAAGAA
GCTCGAAAAGCCATGCGTGATTTATGGCAAATTCAAACGTTCACCAATAA
GCGACCGTGGTATTTAAACCACCCACCACAACAAGTCTTAAGTGCTGGCA
GCTTCGTCCTTGCGCGAACGAGAACAGGAGAATATAAGCATGGTTTCTTA
GCTAAAAAGGATGTCTCGTATCAAGTCTATTTTTCAGAGGAGCGAGGAAC
AGCCAGTCACCGAGCCATGGATATCTCATCTGTTGTTTTGGATATCGTAC
CGCTGATCGGTGATCTATGTGTTGGATGTAATGTTTTAGCTGTGGAATCG
AAAGAACATGGATATCGTACTGGTCGAATTACTCAGGTTTGGGATTCGAA
TGTGGATAAAGATTCTTCGGATGGCGCCAAACAATCTGTTTCTGTCAAGA
CAACTGCTATTGCTCCAATCAAATACCTTGTCAATTTCTATGACAACCAA
ACGGAGAACTTCTTCCCGCCTGATGAACTTCGTATCATTGGTAAACCCAT
CAAGGGGGTTGTCCCTGGACTAGGGGCGTGTGTTTACGCCCGCTTTAATG
ATGGTTTTTACTATCGGGGCAAAGTTGATGACATCGAGGATTATCGAATC
CGAGTGCAATTGGATGAGATCAGTGGAGAAATCGAACACGACATCGATGA
TCCGTCAGCCGTTATTTTGAACCTGACGCCTCAATACCGTCAAGTCAAAA
AGCATTTCAAAGTCATTGCATCCAAAGGAAGCACAACTAAAGGATATCAT
CCGGGGAAAGTGACCGCCATCCAAGGTGAAGGAAATAACCGATTGTATTC
GATACGCTTCGAAGACGGTACAATTAACCAAGTACCCATCacgaaattga
ttttgatgccAAAAGCACCTTTTGATGCTTTACCTGAAGTTGGCACATAC
GTTTATTCCCGAGTGTCACGCGACGCTCCTTTATACGAGAAGGGTATCGT
AGCAGAGAAGAACACAATGATCTGCGTTAAACATTTAAATGGACGGAAAT
TGGCTCACGAAATACAAAACATTCATTTTGTTGTCCGAAATATCGTTCCT
CTCGTGTCATCAttgaagGTTGGTTTGGACGTCATAGTGCAACCTGACAA
TGACGATCAGAAAATGTATTTGGCTGTCATTAGGGAAGTCACCAAAAAAG
AAGGTGACAAAACGAACCGTTATCTAGTGGAGTTTACGGATGGATCCAAG
AAGAGAGTGACGCCCAGCCGGATCCGTATACTTTCTCAATACGGAAGTGC
AGAAACGAGTGAAGAAAATGCTGACATTATCACAACAAGACAGGAGGAAC
TAGTTCTCGATGTGCAAGGTATCTCATTACGTGTGGAAGGTTACTTGGGA
GGCGTGTTGACACCCATGCTCAAAATGGATTCCAAAATCACAGCTAACTT
GAAGGATTGGTCAAGCCAAATGAATGCACACGCTACTGTATCATTAGAAG
CCAGTTATTATAACGAAAACGTTGCCGAATGGGAGCCAGTTATTGAACCT
TTGATGGAGAAACGGAGGGAAAGACCGTGGCAACTCTCTGTCAATTACAC
GATGGAAGGTGACGACAATTCTGCTTCATCCACTTCCAACGAACTCGTTT
TACAAAAACCGGAATCCAACCTGAAAATCAAATCTCAAGATAATCTTGAA
TTGACAATTTCAAAATCATGTCTTGCTTTACTCGGTGAATTGGGACAGGT
GTTTGGAGATGCAGTAGAATCTGTGGACGTTTTACCACAAGTCCTGGTCG
AAAAAGAACCTTTCATGATCGAAAACTTGCTCTCCAAGAAGGTGACAGTA
ACATTGAATGAACTTCTGCAGGGACCAAATGGAGATTCGACAATCGAGCT
AGCATCTTCTTCGAATCCTGTTGGCATTACTTTTGCTCCCAagaaatttg
agaaacgaaAGACCAACGATCTATACACAATCAATTTAtcgGTGGACGGT
TTTCATGACATTAAAGACATTGTGGTTCAAAGAAAGCGAAGCGTTATCTA
TGATCTTGTACCAATAAAACTATTATCAGCACAGTCTTCATATTCGATAG
TGGTACAAGTGAAGACAACAGACGGACAACGTATCATCGTACTCCGATCA
CCATTGCAGTTGAAAAATCACTTTCCAATGCCGTTGGATGTCAGCTACAT
TTCCAAAGAAAACCAACCAGTTAAACTGACAACAGTGGGATCGGGAGATA
TCTATTCCTTCCCTTTGTTGTTAACCTACCACAGTGTTTTTCATCTCAAA
CCTGCTGGTTTCGACTACGGTGATTGCACAGAAGCTCTCAATTGGAGTGA
TTTGAAGACGAGCAACGAAAAACAGTTCTCCTGCCCTTCACCTGACAAAA
GTGCTGACCCTTTCTACATGCAGGTGGTGATGAAAGAGGAGACGTACTCT
TCCGTACACGGCATGTTGGACTGTGTACCACGTTACACGTTGGAGTGCTT
TCCCGTCATCACGCTGCATAATTACCTACCTTGCACTATTAATTATAAGA
TCAAGGGTATGGCGAAATCGGAAAGTCTACCAGGCGGACACAATTGGCCT
TTGTTTACCGTCAACTTCAGTGATAAACCTTCCATCTATATCGAGATTGA
GTCGTATAACAACCAAAGATGGGAAGGAGGTTTGACATTACCAACAAAAC
CGGTAGATTCTTTGAACAAACCATCATTATCTTTCGTCATGATGTCTGGT
GAACGCAAAATGGAATTGGGTGTTTATTACCAGTTAGACGGTTCATTGAA
CATCACCTTATATTCGCCTTACTGGCTTCTCAATAAAACTGGAAAACCAC
TTGTCTATCAGCCAGCGGGGAGCAGCATCCAGCAAGTTCACCAAGAGAAC
GATGTAAATGCTCTTATGATGCTCGTCAAAGGGAAACATAAAAAGgcgaa
agtgaaagtgaaaaataGCGAGTCATGGTCAAATGAATTTTCATTGGATA
CTGTTGGCAGTGGTGGTTCCTTGAAATGCAATGGTCCAAGAGATCGAGTT
TATGAGATTGGTTTGAACATCAGTTTGTCATACTTTGGATTGACGAAGAT
TGTGACGTTCACGCCACTCCGAATGTTATCTAACCACACCAAGTACACCA
TCAGTATGGCAGAAAGTAATTCTAAATCGTCAGAATGGCACACGGTAAAC
CCTGACGAGaacattccatTCTGGCCGACGAAACTTCCTTTGGTCAACCT
TTACATTAACATCAATGGGCAAGATTCAGTGAAATTCAACCCTGAAGTTG
GAAAAACTTTACTGTTGAAGTTCCAGAATGAGGTTGGAGGAGTTTGCGTG
GATTACCAAGAAAAGGACTCGTCCTCAGTCCTTTCGTTTAATCCGTACTT
CGCAGGTGCAGCTCCTGTGCGGCttgaaaatctttgcaaaaaGATCGGCA
TGATCGCTTATAAACAAGCAGGTTCGGTAATGGGTCACGTGTTAACACAT
GACCAATCAGTGTTGTACACGTGGGATGATCCAACCATGGAACAAGAATT
GATTTGTTCCATTGTCAATGATGAAGCCAGTGAAACAAGGATCAAACTCG
ATGCCAACGATTTCGGACGAATGAGAGTTGGAGATGGTGCAATTTATTGG
GTTTCCTTTCTGGATGGTCTTCAACGTGTTCTATTGTTCACTGATAACTT
CAAATCTGCTTACTGCGCATGTCAGgaGCAAAATTTACGCCCAACCATGG
AAGTTGACTTTGAGATTGAGAGTTTTGGTTTGTCTCTGGTCAATGTTGAT
AAGAGAATGGAGATTGGCTACTTAGCTATCCGACAAAGCAAGACTGTATG
GGAGCAACGCAAGAAAAAGAACCGCTGGAAAGCTTTACCGCTTGCCATGT
GTGAAGCTCTCGAAGAAGGTTATCTCAATTATCAAAACAGAAAAGGTGCA
GTCAAAGAGAAAGTTCTGGATAAGGAGGTGGATTACGAGAAGATGTTTAT
TACGAAACCTGAGAAGATTAAGATCAGAAGAACGTACCACAGCGGTCTTG
GTTTCAAATACACAATCTCACCCAATGAAATGCGTGTGCATGCTTCTATC
AGCTCAATACAGTTGGATAGCCATGTTCCAGGTTCGACCTTTCCAACAGT
CTTGCATATGGTTGAACCACCAAAATCTGTTGCTTCAGAAAACGCTCCAA
AGCCATTCTttgaattgagtttaatgaCAAGGATCGGTGATAAAAATGTG
GTCAATGAAGTcagCTATTGTCACGTGTTGATTCAAGAGATGGATGTGAG
GGTTGATATTGGATTTTTATTGGCTCTGATGGAACTCTTCAGTCATGCAA
GAGCTCGAACAACCGAGAAAGAACAATACGCGCTTGATATTGGCCAAGCA
GCAACAAAGTTTGAAGAAAGCGCTGAATTTCAGGCAGCCAAACAAGATCG
ATATTACGTTTTGAACGACTTTCATTTATCACCGCTAAAGATTCACGTCA
GTTTCTCTTTGACGGGTGGTTCCAAAGATGAAAATGCTATTGCTTCATTA
CATGGTAACGTGTTGAACTTGTTGTTACAAAGTGTCGGACTGGCCTTCAC
TGAAATACAAGACGTACAATTCAAATTAGCATGTTACGAAGTGCATAAGT
CCATGCAGAGTAATTCGCAGCTCGGTGATGGAATAACTAAACATTATCAA
ACACAGGCTATCAAGCAACTTTATGTGTTGGTACTCGGGCTAGACGTTCT
TGGTAATCCGTATGGTTTGATATCTGGTGTTGGAACCGGAGCAAAGAATT
TCTTCTACGAACCTTACCAGGGATTAATTCAAGGACCAGAAGAATTTGCG
GAAGGATTGGCGTATGGGGTGAAGAGTCTTGTTGGTGGAACCGTGGGTGG
AGTATCAGGAGCTGTGAGTAAGATTACCGGTACCTTCGGTAAAGGTTTGG
CTGCATTGACCTTGGATGAAGAATATCAACAAAAGAGACGTGAAAACATG
AGCCAACGCCCAACTAACCTCGGTGAAGGTCTCGCCAAAGGTGGTAAAGG
CCTTGTAAAGGGTATCGTGTCTGGTGTTACAGGGATCGTTACCAAACCCT
ATGAAGGTGCCAAGAATGATGGTGCAGGTGGCTTTTTTAAGGGCGTTGGA
AAAGGCCTGATTGGCGTGGTTGCACGCCCTGTTGGTGGAGTGGTAGATAT
GGCCAGTAACACGTTTGATGGTTTGAAAAGCACGACATCTGGCGTGAAAG
CGATCGAGTTGAGCCGTGTTACTCGCGTCTTCCACGCAGATAAGGTTTTA
CGACCTTTCAATCTGTACGAAGCAGATGGAAACAAAATTCTTATGCAATG
TAACAAAGGAGAATACGCCAAGAAGAATTTTTATATCACTCATGTAGTGG
ACAAGAAGAACTATCTCATCCTCACTCAATCaaacATTTTGTATGTTGGA
AAGAACGAGTTGAAAATGGGTGAATGGGAATCggtttgggttatcgagtt
caATGAGCTAAAACGTGAACCAGAAGTGAAAGAGACAAAGATTATTTTCC
ATATCCATAATACGGACACGCGACGTTCAATTTTCAAGAAATCGACGAAC
ACACGTGAAGTGATATTGGAGTCTAGTGCTGTTGCAGACTGGTTTATCTT
AAAGCTTAGAGATGCTAAAATGTTATAGatggtatttgaaTCTTTGGTTG
CTGACCTCTTGAACAAGTATCTGGGTCAATATGTGAAAAATCTTGATGCT
TCTCAATTGAAGATTGGCATTTGGGGAGGAAATGTTGTCCTGACAGAACT
TGAACTGAAAGATACAGCTCTGGATGATCTTGACTTACCCATAAAAGTTG
TTCGTGGATATTTGGgtAAATTGGTCTTGTCCATCCCATGGAAAAATCTT
TACACTGAATCAACTGTTGTCGATATTCAAGATCTCCACCTTGTCGCTAA
GCCTAATTTTGACATCAAATACAATGAAGAACgcgaagaaaaatcaaaac
atgacAAGAAACAACAACAGATTCACAATATCGAAGAAGCGAGGCAAAGA
GAAGAAGACAAAAAGAAAGGCGCCAAGAAAGAAGAGAGTGACGGTTTTGC
TGAGAAACTTGCAACAAACGTCATAAAAAATCTACAGGTTACGATCAAGA
ACATACATGTTCGATATGAAGACTCAATCAGTGATGTGAATGGACCCTTT
TCAGTCGGTCTTACAATGGAAAGTTTAACAGCACAAACCACAGATGAAGA
TTTTGTTCCAAAGATTATCAAAGAATCTGTCTCATTAATTCATAAGatgg
TGAAATTAGACAATTTGGCTTTATATTGGAATCCAGGAGACGAACTGATT
GATCCTTCACTTGATACCAAGCAATGGTTGgaagtTTCAACGAAGCAAAT
TTCAACACACCAATCGAAGCCAGAGAAAACGAAATATATTTTGAGTCCCA
TGGTTGCAACGAAGAAATTGAAGCTGAACACCAAACCAGGTTCCAACCTT
GACATCCCGAAGatgttTTTGAACTTGGTTTTGGAAGAACTTGGTATCAT
CGTGGCAAGAAGTCAATATCATGGCGTGGTGCAACTGATTGAATCATTTG
AACGAATGAATAGGAACCAACCTTTTCGTAAATACAGACCACATACCTCC
GTTCTTGGGAACGAAAGTATTTGGTGGAAGTACTGCATGTCCAGCATACT
GGAGGTGGATGTCAAAAGACGATCTCAAATGTGGAGCTGGAAGCATATTC
AAAAACATCGAGTTCTTTGCAAAGCTTACAAAGTGAAGTAcaaggaaaaa
ttgaaacagaaaaATCCATCCAAACAAATTCTCACTGAACTAGAGaGCAT
GGAGGATGAGTTGAATATTGCAAGCATCACCATTTTTCGACAGCTTGCAG
CTACAGAGGTTTTAACGGAACAAAAGAAGAAAGGCACTAAAGGAAGTTTC
TTCAGTTTCTTCTCCAGATCAAAAGAACCAGAAAAGTCTGCTGCTAATAA
AATTGGAGATTTAATGGGTGATGACCAGGAGAAGGAAATGCAGAAATTGT
ATGACGCAATCGGTTATACTGAAAATGAAGTCATCACTCCCTTTCCTAAA
GAGTACGTGGCGATGTCAGTGGAATCGATTCTCCAGAAATTATTCATCAG
CCTCATCGATGACACAGATAAGGCGAAAGAATTCAAAGTGTTGGATTTTT
CACTCAACAACATCATTGTAGAAGTTTTCCAAAGACCTTCTGCTCAAGCT
CTCAAATTATGTGCAAAGATAGGAGAGATGAAGTTATTTGGTACAGCTTC
TGCTCAATGTACACCTCtcatcatcaaaaacatgttaCAAGGTCGAGGTA
TGGAATTTCTGCCGTTGGTGGACTTCATCTTTGAGACGAATCCTTTGAAG
AAACCGGACATTGACCAATGTATCACTGCTATTTGTCAACCCTTAGAAAT
CATCTATGATGCTAACACGATCAACCATATCATTAGTTTCTTCAAACCTC
CTGAACATGTTATCTTGCAAGATTTACAAGACAAAGCGTATTCTACTTTC
GAAGATTTTAAAGTTTCAAGTACGGCTGGTCTTCTACATGCTATGGAACA
AAGAACGGTTATGGACATCGACATTGATGTTGGAGCATCTCATTTGATCA
TCCCTGAAAAAGGTTCTTACAATGGTTGTACAGATATGCTGGTGATCGAC
TTTGGTAAAATCACGATGAGCAGCGATCCTAGTCAAATCAGACACCTTGA
CCCTAAGGACATTGAGGATGTGAATGAAGTACAAAGCAAAGCTTATGATC
GATTCTTGTTGTCGCTTCAAGCTCTTCAAATATTACTCGTTAGAGAAGGT
GAAGATTTAAAGAGTGCTAAAAGCAACGTCAGTAAAGCTTCATCACACAT
TTTGCATCCCATCAATTTCGATGGCAAACTTGCCAAAGCTATACTTCCAC
AAGATCCACGTTTAAAACAGATATGTGTCTCTGGTGAATTATCTTCGCTG
TTTGTTTCTGTATCGGATGATAAAGTCAGTCGTCTCATCAAGCTAGCAGA
CTCGATACCACTCCCTCAATCACCTTCTCACGATAACATCGACGGAGAAG
AAAAACCTGAAGGACTCTTCACCAAGGCGTTGTCAATGATAAGCTTGACA
GGTGACAATGACACAGGGGTGGACATCGGAGGATTTTCCATCCCTGTACC
GACATCTCCAACATCAGTGACGTCAGATGAAGATGAATACGGGACACCAC
CTGATGGCTCCATATTACAGTTACAACAAGAAGCTGGTCCGGACTTTTCA
TCAGGAGTGGCGAACCAAGTCAAAGTGGACTTGAACTTTAAAATCCATAA
AGTGATGATCGCCATTGGTTTGACTGACAAAGCATTGAAACAGGAAAAAG
AATGTCTGAAATTCATCGTGGACGACATCAATACAGAGgtGATACTACGA
AGATGGGATTTGTTCGTCAATGCAGAAGTTGGTCGTCTGGTGTTGAATGA
AATGACATGGGGTGTTGATGGAGAACCTTTCGCCATCATGAGTACaccca
aaaacaccaaaatgttGAAATTCAGCTATCGGAGGTGTGAATTCAACGAA
AGTTTGAATCTCGGTCCAAGTTACTTTTATTCCAAAGAAGCGCAAGTCAG
AGCTTTACATTTCAAAGATGAATTTGGCGCCACGGATCAGATTTTAGATG
TACAAGTGGCTACTTTATTTCTGATGCTTCATCAAGAAGCACTTTTGAGC
ATCATGTCATTGATCTACCAAGTACTGGAACCACTCAACAAACATGATAA
GGAAGCCACACAGAAGATCAAACGGAGTTTGAGTACGGCAGGTAGTCGTT
TGAGTCTCTCCatcgaagaaaaagaaaaggagaGACAGATACAACGAAAA
TTAGCCAACCCTAAAGCACTGGAAGCTGCCAACGAACTTAAGCAACAGGT
TGGcttagaagaagaaaaaaagatgaGAGTGACCGCCCACCTGGATGGTG
TTGGTATCATGATTTGTTCAGCCAAAGTTGACCTTGCACAAGCCTTCGTT
AAAGGGTTATCTGCTAAAGTACTGATGAAAGATGACTTATTAGAAGTGAA
AGCCAGCATGAAAGATATGCAAGTACAAGATAATGTTGGCGAAACAAAGT
ACAAAGACATCATTAGCATGCGATCTGATGAAGTGTTCGATTTAGAGTTG
GCTATTTACGAGAATGGATCTTCTGGTAGCAAGCAATACGATATGTCGTG
TGTCGACACCAGTGTCAAACTGAACTTCGGTCAAATGCGCGTTGTTTTCT
TGTATAGATTCATACAAGACTTAATGTCATTCACCGAAAACTTCGAAGAA
GCACAGAAAGCAGTTGTGGAAGCTGGTAAAGCTGCCAAGGATAAAGCTCT
GGAAACAGCGACCGATTTGAATAGACATTCTTCTCGTGTCAAACTAAATG
TGGTTCTGAAAGCACCGACTATTATCATTCCAGTTGGATCAAACAATGAA
TTGGCTTTACTGGTGGATCTGGGTGAATTGCGTATTTACAACACATTCAA
ACTCCTCAACGATGATCAATACCATAAGAAATCTATCATCACTGATAACA
TGACCATTAAGTTATCCAATCTGAAATTGTTAAAAGCACTTATTCAAGAT
GGTAAAGATTTCTTGCATCAACGAGCCATTATTGAACCTATGATGCTACA
AATAACTATTGTTCGTAATTTAACGAAAGGTAACCATTCCATACCGGATG
TTTCAGTTCAAGCAAAGATGCCAGCTATTCTGTTATCAATCAGTGAAGAA
GATGTGACCGTAGCTCTAAAGATTGTCCAAGGGAATCTCGCCGAAGGTGA
GTCACATGCGCCGAAGAAGCAAGCCAAGCCTGCCAAACAAACGTTAAACG
TGCCACAAGATCGTTTAGCAGACATTTACGAGGAGcctgaagatgaagat
gagaaTCGACAAGGATATCTTCAAACCAAACTATCCTTCGATCTGGCTAA
AATTGACATCAAGCTTTACTTGAAACCATCTGATATGACATTTGAAGATG
AATTTTTAGCGAGGACGGATGATTTGTTGTTAGCTTTGTTCACTATTGGT
AACCTGTGTGTTGATGGAGACATCATGTCCACGCAAGCTATGAAGATGAG
CGTTCGATTGGACACTTTGGTGTTGGATGATATGAGACCTATCGAGGAGC
ATGAAGGTGTTAAACGTATGATCAACTACAGTCCCGAGCCACTCCTTGAA
GAAGTCAAAACCTCTTCTCATAAACGACCAATCGACAACTCACGAATGAT
CGAAATCCAAttcgatcaaacttcatcgcaagataaaaatatcgacATCA
AACTTTGTAACATGCTTTGTATATTCAACGTTGAGTTTATCATGGTCCTG
TTGAAAACGTTGCAAGCTGCCATACCTAAAGATGATAGTCTGCAACATGG
CCATTCAATGAGTAGTCTAGACTCGGCGGCAGGGTCTGGCGGCAGCGATG
ACGAGGACTCTTTAGAAGCCAGCGAGATTGTCCTCTGCACTGGTGATCAA
GAAAGACCTGAGACTAAAGTCTCTATCTTCGTCCATAACCCGCAAATTGT
TTTACTAGCAGATGCAAAGGATGTCAAAACAAATGCACTCTTTCTTACAA
CCGagatcaattttcaatatttcgaaTTGCGAGATACTCAAAAAATGATT
GGCGCTGTTTCTAACACCGCTATTTTGTCAACTGCTTTCAAGAATGACCA
TCGGAGTGATATATCAACAGTGTTGTCATTAGATTCCATCAATCTCCACT
CGTCATCACCCATCAATGGTAAACCTCATATGAGTGTCAGCACAACTTTG
ATCAAACTGAATATCTCACCCAAAACCATCCGAACTTTATCAGCGTGTGC
TGGTTACATCTCCAATGATCCAACAGATGAAGAAATCAAAGAAGCTCGAA
AAGCCATGCGTGATTTATGGCAAATTCAAACGTTCACCAATAAGCGACCG
TGGTATTTAAACCACCCACCACAACAAGTCTTAAGTGCTGGCAGCTTCGT
CCTTGCGCGAACGAGAACAGGAGAATATAAGCATGGTTTCTTAGCTAAAA
AGGATGTCTCGTATCAAGTCTATTTTTCAGAGGAGCGAGGAACAGCCAGT
CACCGAGCCATGGATATCTCATCTGTTGTTTTGGATATCGTACCGCTGAT
CGGTGATCTATGTGTTGGATGTAATGTTTTAGCTGTGGAATCGAAAGAAC
ATGGATATCGTACTGGTCGAATTACTCAGGTTTGGGATTCGAATGTGGAT
AAAGATTCTTCGGATGGCGCCAAACAATCTGTTTCTGTCAAGACAACTGC
TATTGCTCCAATCAAATACCTTGTCAATTTCTATGACAACCAAACGGAGA
ACTTCTTCCCGCCTGATGAACTTCGTATCATTGGTAAACCCATCAAGGGG
GTTGTCCCTGGACTAGGGGCGTGTGTTTACGCCCGCTTTAATGATGGTTT
TTACTATCGGGGCAAAGTTGATGACATCGAGGATTATCGAATCCGAGTGC
AATTGGATGAGATCAGTGGAGAAATCGAACACGACATCGATGATCCGTCA
GCCGTTATTTTGAACCTGACGCCTCAATACCGTCAAGTCAAAAAGCATTT
CAAAGTCATTGCATCCAAAGGAAGCACAACTAAAGGATATCATCCGGGGA
AAGTGACCGCCATCCAAGGTGAAGGAAATAACCGATTGTATTCGATACGC
TTCGAAGACGGTACAATTAACCAAGTACCCATCacgaaattgattttgat
gccAAAAGCACCTTTTGATGCTTTACCTGAAGTTGGCACATACGTTTATT
CCCGAGTGTCACGCGACGCTCCTTTATACGAGAAGGGTATCGTAGCAGAG
AAGAACACAATGATCTGCGTTAAACATTTAAATGGACGGAAATTGGCTCA
CGAAATACAAAACATTCATTTTGTTGTCCGAAATATCGTTCCTCTCGTGT
CATCAttgaagGTTGGTTTGGACGTCATAGTGCAACCTGACAATGACGAT
CAGAAAATGTATTTGGCTGTCATTAGGGAAGTCACCAAAAAAGAAGGTGA
CAAAACGAACCGTTATCTAGTGGAGTTTACGGATGGATCCAAGAAGAGAG
TGACGCCCAGCCGGATCCGTATACTTTCTCAATACGGAAGTGCAGAAACG
AGTGAAGAAAATGCTGACATTATCACAACAAGACAGGAGGAACTAGTTCT
CGATGTGCAAGGTATCTCATTACGTGTGGAAGGTTACTTGGGAGGCGTGT
TGACACCCATGCTCAAAATGGATTCCAAAATCACAGCTAACTTGAAGGAT
TGGTCAAGCCAAATGAATGCACACGCTACTGTATCATTAGAAGCCAGTTA
TTATAACGAAAACGTTGCCGAATGGGAGCCAGTTATTGAACCTTTGATGG
AGAAACGGAGGGAAAGACCGTGGCAACTCTCTGTCAATTACACGATGGAA
GGTGACGACAATTCTGCTTCATCCACTTCCAACGAACTCGTTTTACAAAA
ACCGGAATCCAACCTGAAAATCAAATCTCAAGATAATCTTGAATTGACAA
TTTCAAAATCATGTCTTGCTTTACTCGGTGAATTGGGACAGGTGTTTGGA
GATGCAGTAGAATCTGTGGACGTTTTACCACAAGTCCTGGTCGAAAAAGA
ACCTTTCATGATCGAAAACTTGCTCTCCAAGAAGGTGACAGTAACATTGA
ATGAACTTCTGCAGGGACCAAATGGAGATTCGACAATCGAGCTAGCATCT
TCTTCGAATCCTGTTGGCATTACTTTTGCTCCCAagaaatttgagaaacg
aaAGACCAACGATCTATACACAATCAATTTAtcgGTGGACGGTTTTCATG
ACATTAAAGACATTGTGGTTCAAAGAAAGCGAAGCGTTATCTATGATCTT
GTACCAATAAAACTATTATCAGCACAGTCTTCATATTCGATAGTGGTACA
AGTGAAGACAACAGACGGACAACGTATCATCGTACTCCGATCACCATTGC
AGTTGAAAAATCACTTTCCAATGCCGTTGGATGTCAGCTACATTTCCAAA
GAAAACCAACCAGTTAAACTGACAACAGTGGGATCGGGAGATATCTATTC
CTTCCCTTTGTTGTTAACCTACCACAGTGTTTTTCATCTCAAACCTGCTG
GTTTCGACTACGGTGATTGCACAGAAGCTCTCAATTGGAGTGATTTGAAG
ACGAGCAACGAAAAACAGTTCTCCTGCCCTTCACCTGACAAAAGTGCTGA
CCCTTTCTACATGCAGGTGGTGATGAAAGAGGAGACGTACTCTTCCGTAC
ACGGCATGTTGGACTGTGTACCACGTTACACGTTGGAGTGCTTTCCCGTC
ATCACGCTGCATAATTACCTACCTTGCACTATTAATTATAAGATCAAGGG
TATGGCGAAATCGGAAAGTCTACCAGGCGGACACAATTGGCCTTTGTTTA
CCGTCAACTTCAGTGATAAACCTTCCATCTATATCGAGATTGAGTCGTAT
AACAACCAAAGATGGGAAGGAGGTTTGACATTACCAACAAAACCGGTAGA
TTCTTTGAACAAACCATCATTATCTTTCGTCATGATGTCTGGTGAACGCA
AAATGGAATTGGGTGTTTATTACCAGTTAGACGGTTCATTGAACATCACC
TTATATTCGCCTTACTGGCTTCTCAATAAAACTGGAAAACCACTTGTCTA
TCAGCCAGCGGGGAGCAGCATCCAGCAAGTTCACCAAGAGAACGATGTAA
ATGCTCTTATGATGCTCGTCAAAGGGAAACATAAAAAGgcgaaagtgaaa
gtgaaaaataGCGAGTCATGGTCAAATGAATTTTCATTGGATACTGTTGG
CAGTGGTGGTTCCTTGAAATGCAATGGTCCAAGAGATCGAGTTTATGAGA
TTGGTTTGAACATCAGTTTGTCATACTTTGGATTGACGAAGATTGTGACG
TTCACGCCACTCCGAATGTTATCTAACCACACCAAGTACACCATCAGTAT
GGCAGAAAGTAATTCTAAATCGTCAGAATGGCACACGGTAAACCCTGACG
AGaacattccatTCTGGCCGACGAAACTTCCTTTGGTCAACCTTTACATT
AACATCAATGGGCAAGATTCAGTGAAATTCAACCCTGAAGTTGGAAAAAC
TTTACTGTTGAAGTTCCAGAATGAGGTTGGAGGAGTTTGCGTGGATTACC
AAGAAAAGGACTCGTCCTCAGTCCTTTCGTTTAATCCGTACTTCGCAGGT
GCAGCTCCTGTGCGGCttgaaaatctttgcaaaaaGATCGGCATGATCGC
TTATAAACAAGCAGGTTCGGTAATGGGTCACGTGTTAACACATGACCAAT
CAGTGTTGTACACGTGGGATGATCCAACCATGGAACAAGAATTGATTTGT
TCCATTGTCAATGATGAAGCCAGTGAAACAAGGATCAAACTCGATGCCAA
CGATTTCGGACGAATGAGAGTTGGAGATGGTGCAATTTATTGGGTTTCCT
TTCTGGATGGTCTTCAACGTGTTCTATTGTTCACTGATAACTTCAAATCT
GCTTACTGCGCATGTCAGgaGCAAAATTTACGCCCAACCATGGAAGTTGA
CTTTGAGATTGAGAGTTTTGGTTTGTCTCTGGTCAATGTTGATAAGAGAA
TGGAGATTGGCTACTTAGCTATCCGACAAAGCAAGACTGTATGGGAGCAA
CGCAAGAAAAAGAACCGCTGGAAAGCTTTACCGCTTGCCATGTGTGAAGC
TCTCGAAGAAGGTTATCTCAATTATCAAAACAGAAAAGGTGCAGTCAAAG
AGAAAGTTCTGGATAAGGAGGTGGATTACGAGAAGATGTTTATTACGAAA
CCTGAGAAGATTAAGATCAGAAGAACGTACCACAGCGGTCTTGGTTTCAA
ATACACAATCTCACCCAATGAAATGCGTGTGCATGCTTCTATCAGCTCAA
TACAGTTGGATAGCCATGTTCCAGGTTCGACCTTTCCAACAGTCTTGCAT
ATGGTTGAACCACCAAAATCTGTTGCTTCAGAAAACGCTCCAAAGCCATT
CTttgaattgagtttaatgaCAAGGATCGGTGATAAAAATGTGGTCAATG
AAGTcagCTATTGTCACGTGTTGATTCAAGAGATGGATGTGAGGGTTGAT
ATTGGATTTTTATTGGCTCTGATGGAACTCTTCAGTCATGCAAGAGCTCG
AACAACCGAGAAAGAACAATACGCGCTTGATATTGGCCAAGCAGCAACAA
AGTTTGAAGAAAGCGCTGAATTTCAGGCAGCCAAACAAGATCGATATTAC
GTTTTGAACGACTTTCATTTATCACCGCTAAAGATTCACGTCAGTTTCTC
TTTGACGGGTGGTTCCAAAGATGAAAATGCTATTGCTTCATTACATGGTA
ACGTGTTGAACTTGTTGTTACAAAGTGTCGGACTGGCCTTCACTGAAATA
CAAGACGTACAATTCAAATTAGCATGTTACGAAGTGCATAAGTCCATGCA
GAGTAATTCGCAGCTCGGTGATGGAATAACTAAACATTATCAAACACAGG
CTATCAAGCAACTTTATGTGTTGGTACTCGGGCTAGACGTTCTTGGTAAT
CCGTATGGTTTGATATCTGGTGTTGGAACCGGAGCAAAGAATTTCTTCTA
CGAACCTTACCAGGGATTAATTCAAGGACCAGAAGAATTTGCGGAAGGAT
TGGCGTATGGGGTGAAGAGTCTTGTTGGTGGAACCGTGGGTGGAGTATCA
GGAGCTGTGAGTAAGATTACCGGTACCTTCGGTAAAGGTTTGGCTGCATT
GACCTTGGATGAAGAATATCAACAAAAGAGACGTGAAAACATGAGCCAAC
GCCCAACTAACCTCGGTGAAGGTCTCGCCAAAGGTGGTAAAGGCCTTGTA
AAGGGTATCGTGTCTGGTGTTACAGGGATCGTTACCAAACCCTATGAAGG
TGCCAAGAATGATGGTGCAGGTGGCTTTTTTAAGGGCGTTGGAAAAGGCC
TGATTGGCGTGGTTGCACGCCCTGTTGGTGGAGTGGTAGATATGGCCAGT
AACACGTTTGATGGTTTGAAAAGCACGACATCTGGCGTGAAAGCGATCGA
GTTGAGCCGTGTTACTCGCGTCTTCCACGCAGATAAGGTTTTACGACCTT
TCAATCTGTACGAAGCAGATGGAAACAAAATTCTTATGCAATGTAACAAA
GGAGAATACGCCAAGAAGAATTTTTATATCACTCATGTAGTGGACAAGAA
GAACTATCTCATCCTCACTCAATCaaacATTTTGTATGTTGGAAAGAACG
AGTTGAAAATGGGTGAATGGGAATCggtttgggttatcgagttcaATGAG
CTAAAACGTGAACCAGAAGTGAAAGAGACAAAGATTATTTTCCATATCCA
TAATACGGACACGCGACGTTCAATTTTCAAGAAATCGACGAACACACGTG
AAGTGATATTGGAGTCTAGTGCTGTTGCAGACTGGTTTATCTTAAAGCTT
AGAGATGCTAAAATGTTATAGatggtatttgaaTCTTTGGTTGCTGACCT
CTTGAACAAGTATCTGGGTCAATATGTGAAAAATCTTGATGCTTCTCAAT
TGAAGATTGGCATTTGGGGAGGAAATGTTGTCCTGACAGAACTTGAACTG
AAAGATACAGCTCTGGATGATCTTGACTTACCCATAAAAGTTGTTCGTGG
ATATTTGGgtAAATTGGTCTTGTCCATCCCATGGAAAAATCTTTACACTG
AATCAACTGTTGTCGATATTCAAGATCTCCACCTTGTCGCTAAGCCTAAT
TTTGACATCAAATACAATGAAGAACgcgaagaaaaatcaaaacatgacAA
GAAACAACAACAGATTCACAATATCGAAGAAGCGAGGCAAAGAGAAGAAG
ACAAAAAGAAAGGCGCCAAGAAAGAAGAGAGTGACGGTTTTGCTGAGAAA
CTTGCAACAAACGTCATAAAAAATCTACAGGTTACGATCAAGAACATACA
TGTTCGATATGAAGACTCAATCAGTGATGTGAATGGACCCTTTTCAGTCG
GTCTTACAATGGAAAGTTTAACAGCACAAACCACAGATGAAGATTTTGTT
CCAAAGATTATCAAAGAATCTGTCTCATTAATTCATAAGatggTGAAATT
AGACAATTTGGCTTTATATTGGAATCCAGGAGACGAACTGATTGATCCTT
CACTTGATACCAAGCAATGGTTGgaagtTTCAACGAAGCAAATTTCAACA
CACCAATCGAAGCCAGAGAAAACGAAATATATTTTGAGTCCCATGGTTGC
AACGAAGAAATTGAAGCTGAACACCAAACCAGGTTCCAACCTTGACATCC
CGAAGatgttTTTGAACTTGGTTTTGGAAGAACTTGGTATCATCGTGGCA
AGAAGTCAATATCATGGCGTGGTGCAACTGATTGAATCATTTGAACGAAT
GAATAGGAACCAACCTTTTCGTAAATACAGACCACATACCTCCGTTCTTG
GGAACGAAAGTATTTGGTGGAAGTACTGCATGTCCAGCATACTGGAGGTG
GATGTCAAAAGACGATCTCAAATGTGGAGCTGGAAGCATATTCAAAAACA
TCGAGTTCTTTGCAAAGCTTACAAAGTGAAGTAcaaggaaaaattgaaac
agaaaaATCCATCCAAACAAATTCTCACTGAACTAGAGaGCATGGAGGAT
GAGTTGAATATTGCAAGCATCACCATTTTTCGACAGCTTGCAGCTACAGA
GGTTTTAACGGAACAAAAGAAGAAAGGCACTAAAGGAAGTTTCTTCAGTT
TCTTCTCCAGATCAAAAGAACCAGAAAAGTCTGCTGCTAATAAAATTGGA
GATTTAATGGGTGATGACCAGGAGAAGGAAATGCAGAAATTGTATGACGC
AATCGGTTATACTGAAAATGAAGTCATCACTCCCTTTCCTAAAGAGTACG
TGGCGATGTCAGTGGAATCGATTCTCCAGAAATTATTCATCAGCCTCATC
GATGACACAGATAAGGCGAAAGAATTCAAAGTGTTGGATTTTTCACTCAA
CAACATCATTGTAGAAGTTTTCCAAAGACCTTCTGCTCAAGCTCTCAAAT
TATGTGCAAAGATAGGAGAGATGAAGTTATTTGGTACAGCTTCTGCTCAA
TGTACACCTCtcatcatcaaaaacatgttaCAAGGTCGAGGTATGGAATT
TCTGCCGTTGGTGGACTTCATCTTTGAGACGAATCCTTTGAAGAAACCGG
ACATTGACCAATGTATCACTGCTATTTGTCAACCCTTAGAAATCATCTAT
GATGCTAACACGATCAACCATATCATTAGTTTCTTCAAACCTCCTGAACA
TGTTATCTTGCAAGATTTACAAGACAAAGCGTATTCTACTTTCGAAGATT
TTAAAGTTTCAAGTACGGCTGGTCTTCTACATGCTATGGAACAAAGAACG
GTTATGGACATCGACATTGATGTTGGAGCATCTCATTTGATCATCCCTGA
AAAAGGTTCTTACAATGGTTGTACAGATATGCTGGTGATCGACTTTGGTA
AAATCACGATGAGCAGCGATCCTAGTCAAATCAGACACCTTGACCCTAAG
GACATTGAGGATGTGAATGAAGTACAAAGCAAAGCTTATGATCGATTCTT
GTTGTCGCTTCAAGCTCTTCAAATATTACTCGTTAGAGAAGGTGAAGATT
TAAAGAGTGCTAAAAGCAACGTCAGTAAAGCTTCATCACACATTTTGCAT
CCCATCAATTTCGATGGCAAACTTGCCAAAGCTATACTTCCACAAGATCC
ACGTTTAAAACAGATATGTGTCTCTGGTGAATTATCTTCGCTGTTTGTTT
CTGTATCGGATGATAAAGTCAGTCGTCTCATCAAGCTAGCAGACTCGATA
CCACTCCCTCAATCACCTTCTCACGATAACATCGACGGAGAAGAAAAACC
TGAAGGACTCTTCACCAAGGCGTTGTCAATGATAAGCTTGACAGGTGACA
ATGACACAGGGGTGGACATCGGAGGATTTTCCATCCCTGTACCGACATCT
CCAACATCAGTGACGTCAGATGAAGATGAATACGGGACACCACCTGATGG
CTCCATATTACAGTTACAACAAGAAGCTGGTCCGGACTTTTCATCAGGAG
TGGCGAACCAAGTCAAAGTGGACTTGAACTTTAAAATCCATAAAGTGATG
ATCGCCATTGGTTTGACTGACAAAGCATTGAAACAGGAAAAAGAATGTCT
GAAATTCATCGTGGACGACATCAATACAGAGgtGATACTACGAAGATGGG
ATTTGTTCGTCAATGCAGAAGTTGGTCGTCTGGTGTTGAATGAAATGACA
TGGGGTGTTGATGGAGAACCTTTCGCCATCATGAGTACacccaaaaacac
caaaatgttGAAATTCAGCTATCGGAGGTGTGAATTCAACGAAAGTTTGA
ATCTCGGTCCAAGTTACTTTTATTCCAAAGAAGCGCAAGTCAGAGCTTTA
CATTTCAAAGATGAATTTGGCGCCACGGATCAGATTTTAGATGTACAAGT
GGCTACTTTATTTCTGATGCTTCATCAAGAAGCACTTTTGAGCATCATGT
CATTGATCTACCAAGTACTGGAACCACTCAACAAACATGATAAGGAAGCC
ACACAGAAGATCAAACGGAGTTTGAGTACGGCAGGTAGTCGTTTGAGTCT
CTCCatcgaagaaaaagaaaaggagaGACAGATACAACGAAAATTAGCCA
ACCCTAAAGCACTGGAAGCTGCCAACGAACTTAAGCAACAGGTTGGctta
gaagaagaaaaaaagatgaGAGTGACCGCCCACCTGGATGGTGTTGGTAT
CATGATTTGTTCAGCCAAAGTTGACCTTGCACAAGCCTTCGTTAAAGGGT
TATCTGCTAAAGTACTGATGAAAGATGACTTATTAGAAGTGAAAGCCAGC
ATGAAAGATATGCAAGTACAAGATAATGTTGGCGAAACAAAGTACAAAGA
CATCATTAGCATGCGATCTGATGAAGTGTTCGATTTAGAGTTGGCTATTT
ACGAGAATGGATCTTCTGGTAGCAAGCAATACGATATGTCGTGTGTCGAC
ACCAGTGTCAAACTGAACTTCGGTCAAATGCGCGTTGTTTTCTTGTATAG
ATTCATACAAGACTTAATGTCATTCACCGAAAACTTCGAAGAAGCACAGA
AAGCAGTTGTGGAAGCTGGTAAAGCTGCCAAGGATAAAGCTCTGGAAACA
GCGACCGATTTGAATAGACATTCTTCTCGTGTCAAACTAAATGTGGTTCT
GAAAGCACCGACTATTATCATTCCAGTTGGATCAAACAATGAATTGGCTT
TACTGGTGGATCTGGGTGAATTGCGTATTTACAACACATTCAAACTCCTC
AACGATGATCAATACCATAAGAAATCTATCATCACTGATAACATGACCAT
TAAGTTATCCAATCTGAAATTGTTAAAAGCACTTATTCAAGATGGTAAAG
ATTTCTTGCATCAACGAGCCATTATTGAACCTATGATGCTACAAATAACT
ATTGTTCGTAATTTAACGAAAGGTAACCATTCCATACCGGATGTTTCAGT
TCAAGCAAAGATGCCAGCTATTCTGTTATCAATCAGTGAAGAAGATGTGA
CCGTAGCTCTAAAGATTGTCCAAGGGAATCTCGCCGAAGGTGAGTCACAT
GCGCCGAAGAAGCAAGCCAAGCCTGCCAAACAAACGTTAAACGTGCCACA
AGATCGTTTAGCAGACATTTACGAGGAGcctgaagatgaagatgagaaTC
GACAAGGATATCTTCAAACCAAACTATCCTTCGATCTGGCTAAAATTGAC
ATCAAGCTTTACTTGAAACCATCTGATATGACATTTGAAGATGAATTTTT
AGCGAGGACGGATGATTTGTTGTTAGCTTTGTTCACTATTGGTAACCTGT
GTGTTGATGGAGACATCATGTCCACGCAAGCTATGAAGATGAGCGTTCGA
TTGGACACTTTGGTGTTGGATGATATGAGACCTATCGAGGAGCATGAAGG
TGTTAAACGTATGATCAACTACAGTCCCGAGCCACTCCTTGAAGAAGTCA
AAACCTCTTCTCATAAACGACCAATCGACAACTCACGAATGATCGAAATC
CAAttcgatcaaacttcatcgcaagataaaaatatcgacATCAAACTTTG
TAACATGCTTTGTATATTCAACGTTGAGTTTATCATGGTCCTGTTGAAAA
CGTTGCAAGCTGCCATACCTAAAGATGATAGTCTGCAACATGGCCATTCA
ATGAGTAGTCTAGACTCGGCGGCAGGGTCTGGCGGCAGCGATGACGAGGA
CTCTTTAGAAGCCAGCGAGATTGTCCTCTGCACTGGTGATCAAGAAAGAC
CTGAGACTAAAGTCTCTATCTTCGTCCATAACCCGCAAATTGTTTTACTA
GCAGATGCAAAGGATGTCAAAACAAATGCACTCTTTCTTACAACCGagat
caattttcaatatttcgaaTTGCGAGATACTCAAAAAATGATTGGCGCTG
TTTCTAACACCGCTATTTTGTCAACTGCTTTCAAGAATGACCATCGGAGT
GATATATCAACAGTGTTGTCATTAGATTCCATCAATCTCCACTCGTCATC
ACCCATCAATGGTAAACCTCATATGAGTGTCAGCACAACTTTGATCAAAC
TGAATATCTCACCCAAAACCATCCGAACTTTATCAGCGTGTGCTGGTTAC
ATCTCCAATGATCCAACAGATGAAGAAATCAAAGAAGCTCGAAAAGCCAT
GCGTGATTTATGGCAAATTCAAACGTTCACCAATAAGCGACCGTGGTATT
TAAACCACCCACCACAACAAGTCTTAAGTGCTGGCAGCTTCGTCCTTGCG
CGAACGAGAACAGGAGAATATAAGCATGGTTTCTTAGCTAAAAAGGATGT
CTCGTATCAAGTCTATTTTTCAGAGGAGCGAGGAACAGCCAGTCACCGAG
CCATGGATATCTCATCTGTTGTTTTGGATATCGTACCGCTGATCGGTGAT
CTATGTGTTGGATGTAATGTTTTAGCTGTGGAATCGAAAGAACATGGATA
TCGTACTGGTCGAATTACTCAGGTTTGGGATTCGAATGTGGATAAAGATT
CTTCGGATGGCGCCAAACAATCTGTTTCTGTCAAGACAACTGCTATTGCT
CCAATCAAATACCTTGTCAATTTCTATGACAACCAAACGGAGAACTTCTT
CCCGCCTGATGAACTTCGTATCATTGGTAAACCCATCAAGGGGGTTGTCC
CTGGACTAGGGGCGTGTGTTTACGCCCGCTTTAATGATGGTTTTTACTAT
CGGGGCAAAGTTGATGACATCGAGGATTATCGAATCCGAGTGCAATTGGA
TGAGATCAGTGGAGAAATCGAACACGACATCGATGATCCGTCAGCCGTTA
TTTTGAACCTGACGCCTCAATACCGTCAAGTCAAAAAGCATTTCAAAGTC
ATTGCATCCAAAGGAAGCACAACTAAAGGATATCATCCGGGGAAAGTGAC
CGCCATCCAAGGTGAAGGAAATAACCGATTGTATTCGATACGCTTCGAAG
ACGGTACAATTAACCAAGTACCCATCacgaaattgattttgatgccAAAA
GCACCTTTTGATGCTTTACCTGAAGTTGGCACATACGTTTATTCCCGAGT
GTCACGCGACGCTCCTTTATACGAGAAGGGTATCGTAGCAGAGAAGAACA
CAATGATCTGCGTTAAACATTTAAATGGACGGAAATTGGCTCACGAAATA
CAAAACATTCATTTTGTTGTCCGAAATATCGTTCCTCTCGTGTCATCAtt
gaagGTTGGTTTGGACGTCATAGTGCAACCTGACAATGACGATCAGAAAA
TGTATTTGGCTGTCATTAGGGAAGTCACCAAAAAAGAAGGTGACAAAACG
AACCGTTATCTAGTGGAGTTTACGGATGGATCCAAGAAGAGAGTGACGCC
CAGCCGGATCCGTATACTTTCTCAATACGGAAGTGCAGAAACGAGTGAAG
AAAATGCTGACATTATCACAACAAGACAGGAGGAACTAGTTCTCGATGTG
CAAGGTATCTCATTACGTGTGGAAGGTTACTTGGGAGGCGTGTTGACACC
CATGCTCAAAATGGATTCCAAAATCACAGCTAACTTGAAGGATTGGTCAA
GCCAAATGAATGCACACGCTACTGTATCATTAGAAGCCAGTTATTATAAC
GAAAACGTTGCCGAATGGGAGCCAGTTATTGAACCTTTGATGGAGAAACG
GAGGGAAAGACCGTGGCAACTCTCTGTCAATTACACGATGGAAGGTGACG
ACAATTCTGCTTCATCCACTTCCAACGAACTCGTTTTACAAAAACCGGAA
TCCAACCTGAAAATCAAATCTCAAGATAATCTTGAATTGACAATTTCAAA
ATCATGTCTTGCTTTACTCGGTGAATTGGGACAGGTGTTTGGAGATGCAG
TAGAATCTGTGGACGTTTTACCACAAGTCCTGGTCGAAAAAGAACCTTTC
ATGATCGAAAACTTGCTCTCCAAGAAGGTGACAGTAACATTGAATGAACT
TCTGCAGGGACCAAATGGAGATTCGACAATCGAGCTAGCATCTTCTTCGA
ATCCTGTTGGCATTACTTTTGCTCCCAagaaatttgagaaacgaaAGACC
AACGATCTATACACAATCAATTTAtcgGTGGACGGTTTTCATGACATTAA
AGACATTGTGGTTCAAAGAAAGCGAAGCGTTATCTATGATCTTGTACCAA
TAAAACTATTATCAGCACAGTCTTCATATTCGATAGTGGTACAAGTGAAG
ACAACAGACGGACAACGTATCATCGTACTCCGATCACCATTGCAGTTGAA
AAATCACTTTCCAATGCCGTTGGATGTCAGCTACATTTCCAAAGAAAACC
AACCAGTTAAACTGACAACAGTGGGATCGGGAGATATCTATTCCTTCCCT
TTGTTGTTAACCTACCACAGTGTTTTTCATCTCAAACCTGCTGGTTTCGA
CTACGGTGATTGCACAGAAGCTCTCAATTGGAGTGATTTGAAGACGAGCA
ACGAAAAACAGTTCTCCTGCCCTTCACCTGACAAAAGTGCTGACCCTTTC
TACATGCAGGTGGTGATGAAAGAGGAGACGTACTCTTCCGTACACGGCAT
GTTGGACTGTGTACCACGTTACACGTTGGAGTGCTTTCCCGTCATCACGC
TGCATAATTACCTACCTTGCACTATTAATTATAAGATCAAGGGTATGGCG
AAATCGGAAAGTCTACCAGGCGGACACAATTGGCCTTTGTTTACCGTCAA
CTTCAGTGATAAACCTTCCATCTATATCGAGATTGAGTCGTATAACAACC
AAAGATGGGAAGGAGGTTTGACATTACCAACAAAACCGGTAGATTCTTTG
AACAAACCATCATTATCTTTCGTCATGATGTCTGGTGAACGCAAAATGGA
ATTGGGTGTTTATTACCAGTTAGACGGTTCATTGAACATCACCTTATATT
CGCCTTACTGGCTTCTCAATAAAACTGGAAAACCACTTGTCTATCAGCCA
GCGGGGAGCAGCATCCAGCAAGTTCACCAAGAGAACGATGTAAATGCTCT
TATGATGCTCGTCAAAGGGAAACATAAAAAGgcgaaagtgaaagtgaaaa
ataGCGAGTCATGGTCAAATGAATTTTCATTGGATACTGTTGGCAGTGGT
GGTTCCTTGAAATGCAATGGTCCAAGAGATCGAGTTTATGAGATTGGTTT
GAACATCAGTTTGTCATACTTTGGATTGACGAAGATTGTGACGTTCACGC
CACTCCGAATGTTATCTAACCACACCAAGTACACCATCAGTATGGCAGAA
AGTAATTCTAAATCGTCAGAATGGCACACGGTAAACCCTGACGAGaacat
tccatTCTGGCCGACGAAACTTCCTTTGGTCAACCTTTACATTAACATCA
ATGGGCAAGATTCAGTGAAATTCAACCCTGAAGTTGGAAAAACTTTACTG
TTGAAGTTCCAGAATGAGGTTGGAGGAGTTTGCGTGGATTACCAAGAAAA
GGACTCGTCCTCAGTCCTTTCGTTTAATCCGTACTTCGCAGGTGCAGCTC
CTGTGCGGCttgaaaatctttgcaaaaaGATCGGCATGATCGCTTATAAA
CAAGCAGGTTCGGTAATGGGTCACGTGTTAACACATGACCAATCAGTGTT
GTACACGTGGGATGATCCAACCATGGAACAAGAATTGATTTGTTCCATTG
TCAATGATGAAGCCAGTGAAACAAGGATCAAACTCGATGCCAACGATTTC
GGACGAATGAGAGTTGGAGATGGTGCAATTTATTGGGTTTCCTTTCTGGA
TGGTCTTCAACGTGTTCTATTGTTCACTGATAACTTCAAATCTGCTTACT
GCGCATGTCAGgaGCAAAATTTACGCCCAACCATGGAAGTTGACTTTGAG
ATTGAGAGTTTTGGTTTGTCTCTGGTCAATGTTGATAAGAGAATGGAGAT
TGGCTACTTAGCTATCCGACAAAGCAAGACTGTATGGGAGCAACGCAAGA
AAAAGAACCGCTGGAAAGCTTTACCGCTTGCCATGTGTGAAGCTCTCGAA
GAAGGTTATCTCAATTATCAAAACAGAAAAGGTGCAGTCAAAGAGAAAGT
TCTGGATAAGGAGGTGGATTACGAGAAGATGTTTATTACGAAACCTGAGA
AGATTAAGATCAGAAGAACGTACCACAGCGGTCTTGGTTTCAAATACACA
ATCTCACCCAATGAAATGCGTGTGCATGCTTCTATCAGCTCAATACAGTT
GGATAGCCATGTTCCAGGTTCGACCTTTCCAACAGTCTTGCATATGGTTG
AACCACCAAAATCTGTTGCTTCAGAAAACGCTCCAAAGCCATTCTttgaa
ttgagtttaatgaCAAGGATCGGTGATAAAAATGTGGTCAATGAAGTcag
CTATTGTCACGTGTTGATTCAAGAGATGGATGTGAGGGTTGATATTGGAT
TTTTATTGGCTCTGATGGAACTCTTCAGTCATGCAAGAGCTCGAACAACC
GAGAAAGAACAATACGCGCTTGATATTGGCCAAGCAGCAACAAAGTTTGA
AGAAAGCGCTGAATTTCAGGCAGCCAAACAAGATCGATATTACGTTTTGA
ACGACTTTCATTTATCACCGCTAAAGATTCACGTCAGTTTCTCTTTGACG
GGTGGTTCCAAAGATGAAAATGCTATTGCTTCATTACATGGTAACGTGTT
GAACTTGTTGTTACAAAGTGTCGGACTGGCCTTCACTGAAATACAAGACG
TACAATTCAAATTAGCATGTTACGAAGTGCATAAGTCCATGCAGAGTAAT
TCGCAGCTCGGTGATGGAATAACTAAACATTATCAAACACAGGCTATCAA
GCAACTTTATGTGTTGGTACTCGGGCTAGACGTTCTTGGTAATCCGTATG
GTTTGATATCTGGTGTTGGAACCGGAGCAAAGAATTTCTTCTACGAACCT
TACCAGGGATTAATTCAAGGACCAGAAGAATTTGCGGAAGGATTGGCGTA
TGGGGTGAAGAGTCTTGTTGGTGGAACCGTGGGTGGAGTATCAGGAGCTG
TGAGTAAGATTACCGGTACCTTCGGTAAAGGTTTGGCTGCATTGACCTTG
GATGAAGAATATCAACAAAAGAGACGTGAAAACATGAGCCAACGCCCAAC
TAACCTCGGTGAAGGTCTCGCCAAAGGTGGTAAAGGCCTTGTAAAGGGTA
TCGTGTCTGGTGTTACAGGGATCGTTACCAAACCCTATGAAGGTGCCAAG
AATGATGGTGCAGGTGGCTTTTTTAAGGGCGTTGGAAAAGGCCTGATTGG
CGTGGTTGCACGCCCTGTTGGTGGAGTGGTAGATATGGCCAGTAACACGT
TTGATGGTTTGAAAAGCACGACATCTGGCGTGAAAGCGATCGAGTTGAGC
CGTGTTACTCGCGTCTTCCACGCAGATAAGGTTTTACGACCTTTCAATCT
GTACGAAGCAGATGGAAACAAAATTCTTATGCAATGTAACAAAGGAGAAT
ACGCCAAGAAGAATTTTTATATCACTCATGTAGTGGACAAGAAGAACTAT
CTCATCCTCACTCAATCaaacATTTTGTATGTTGGAAAGAACGAGTTGAA
AATGGGTGAATGGGAATCggtttgggttatcgagttcaATGAGCTAAAAC
GTGAACCAGAAGTGAAAGAGACAAAGATTATTTTCCATATCCATAATACG
GACACGCGACGTTCAATTTTCAAGAAATCGACGAACACACGTGAAGTGAT
ATTGGAGTCTAGTGCTGTTGCAGACTGGTTTATCTTAAAGCTTAGAGATG
CTAAAATGTTATAGatggtatttgaaTCTTTGGTTGCTGACCTCTTGAAC
AAGTATCTGGGTCAATATGTGAAAAATCTTGATGCTTCTCAATTGAAGAT
TGGCATTTGGGGAGGAAATGTTGTCCTGACAGAACTTGAACTGAAAGATA
CAGCTCTGGATGATCTTGACTTACCCATAAAAGTTGTTCGTGGATATTTG
GgtAAATTGGTCTTGTCCATCCCATGGAAAAATCTTTACACTGAATCAAC
TGTTGTCGATATTCAAGATCTCCACCTTGTCGCTAAGCCTAATTTTGACA
TCAAATACAATGAAGAACgcgaagaaaaatcaaaacatgacAAGAAACAA
CAACAGATTCACAATATCGAAGAAGCGAGGCAAAGAGAAGAAGACAAAAA
GAAAGGCGCCAAGAAAGAAGAGAGTGACGGTTTTGCTGAGAAACTTGCAA
CAAACGTCATAAAAAATCTACAGGTTACGATCAAGAACATACATGTTCGA
TATGAAGACTCAATCAGTGATGTGAATGGACCCTTTTCAGTCGGTCTTAC
AATGGAAAGTTTAACAGCACAAACCACAGATGAAGATTTTGTTCCAAAGA
TTATCAAAGAATCTGTCTCATTAATTCATAAGatggTGAAATTAGACAAT
TTGGCTTTATATTGGAATCCAGGAGACGAACTGATTGATCCTTCACTTGA
TACCAAGCAATGGTTGgaagtTTCAACGAAGCAAATTTCAACACACCAAT
CGAAGCCAGAGAAAACGAAATATATTTTGAGTCCCATGGTTGCAACGAAG
AAATTGAAGCTGAACACCAAACCAGGTTCCAACCTTGACATCCCGAAGat
gttTTTGAACTTGGTTTTGGAAGAACTTGGTATCATCGTGGCAAGAAGTC
AATATCATGGCGTGGTGCAACTGATTGAATCATTTGAACGAATGAATAGG
AACCAACCTTTTCGTAAATACAGACCACATACCTCCGTTCTTGGGAACGA
AAGTATTTGGTGGAAGTACTGCATGTCCAGCATACTGGAGGTGGATGTCA
AAAGACGATCTCAAATGTGGAGCTGGAAGCATATTCAAAAACATCGAGTT
CTTTGCAAAGCTTACAAAGTGAAGTAcaaggaaaaattgaaacagaaaaA
TCCATCCAAACAAATTCTCACTGAACTAGAGaGCATGGAGGATGAGTTGA
ATATTGCAAGCATCACCATTTTTCGACAGCTTGCAGCTACAGAGGTTTTA
ACGGAACAAAAGAAGAAAGGCACTAAAGGAAGTTTCTTCAGTTTCTTCTC
CAGATCAAAAGAACCAGAAAAGTCTGCTGCTAATAAAATTGGAGATTTAA
TGGGTGATGACCAGGAGAAGGAAATGCAGAAATTGTATGACGCAATCGGT
TATACTGAAAATGAAGTCATCACTCCCTTTCCTAAAGAGTACGTGGCGAT
GTCAGTGGAATCGATTCTCCAGAAATTATTCATCAGCCTCATCGATGACA
CAGATAAGGCGAAAGAATTCAAAGTGTTGGATTTTTCACTCAACAACATC
ATTGTAGAAGTTTTCCAAAGACCTTCTGCTCAAGCTCTCAAATTATGTGC
AAAGATAGGAGAGATGAAGTTATTTGGTACAGCTTCTGCTCAATGTACAC
CTCtcatcatcaaaaacatgttaCAAGGTCGAGGTATGGAATTTCTGCCG
TTGGTGGACTTCATCTTTGAGACGAATCCTTTGAAGAAACCGGACATTGA
CCAATGTATCACTGCTATTTGTCAACCCTTAGAAATCATCTATGATGCTA
ACACGATCAACCATATCATTAGTTTCTTCAAACCTCCTGAACATGTTATC
TTGCAAGATTTACAAGACAAAGCGTATTCTACTTTCGAAGATTTTAAAGT
TTCAAGTACGGCTGGTCTTCTACATGCTATGGAACAAAGAACGGTTATGG
ACATCGACATTGATGTTGGAGCATCTCATTTGATCATCCCTGAAAAAGGT
TCTTACAATGGTTGTACAGATATGCTGGTGATCGACTTTGGTAAAATCAC
GATGAGCAGCGATCCTAGTCAAATCAGACACCTTGACCCTAAGGACATTG
AGGATGTGAATGAAGTACAAAGCAAAGCTTATGATCGATTCTTGTTGTCG
CTTCAAGCTCTTCAAATATTACTCGTTAGAGAAGGTGAAGATTTAAAGAG
TGCTAAAAGCAACGTCAGTAAAGCTTCATCACACATTTTGCATCCCATCA
ATTTCGATGGCAAACTTGCCAAAGCTATACTTCCACAAGATCCACGTTTA
AAACAGATATGTGTCTCTGGTGAATTATCTTCGCTGTTTGTTTCTGTATC
GGATGATAAAGTCAGTCGTCTCATCAAGCTAGCAGACTCGATACCACTCC
CTCAATCACCTTCTCACGATAACATCGACGGAGAAGAAAAACCTGAAGGA
CTCTTCACCAAGGCGTTGTCAATGATAAGCTTGACAGGTGACAATGACAC
AGGGGTGGACATCGGAGGATTTTCCATCCCTGTACCGACATCTCCAACAT
CAGTGACGTCAGATGAAGATGAATACGGGACACCACCTGATGGCTCCATA
TTACAGTTACAACAAGAAGCTGGTCCGGACTTTTCATCAGGAGTGGCGAA
CCAAGTCAAAGTGGACTTGAACTTTAAAATCCATAAAGTGATGATCGCCA
TTGGTTTGACTGACAAAGCATTGAAACAGGAAAAAGAATGTCTGAAATTC
ATCGTGGACGACATCAATACAGAGgtGATACTACGAAGATGGGATTTGTT
CGTCAATGCAGAAGTTGGTCGTCTGGTGTTGAATGAAATGACATGGGGTG
TTGATGGAGAACCTTTCGCCATCATGAGTACacccaaaaacaccaaaatg
ttGAAATTCAGCTATCGGAGGTGTGAATTCAACGAAAGTTTGAATCTCGG
TCCAAGTTACTTTTATTCCAAAGAAGCGCAAGTCAGAGCTTTACATTTCA
AAGATGAATTTGGCGCCACGGATCAGATTTTAGATGTACAAGTGGCTACT
TTATTTCTGATGCTTCATCAAGAAGCACTTTTGAGCATCATGTCATTGAT
CTACCAAGTACTGGAACCACTCAACAAACATGATAAGGAAGCCACACAGA
AGATCAAACGGAGTTTGAGTACGGCAGGTAGTCGTTTGAGTCTCTCCatc
gaagaaaaagaaaaggagaGACAGATACAACGAAAATTAGCCAACCCTAA
AGCACTGGAAGCTGCCAACGAACTTAAGCAACAGGTTGGcttagaagaag
aaaaaaagatgaGAGTGACCGCCCACCTGGATGGTGTTGGTATCATGATT
TGTTCAGCCAAAGTTGACCTTGCACAAGCCTTCGTTAAAGGGTTATCTGC
TAAAGTACTGATGAAAGATGACTTATTAGAAGTGAAAGCCAGCATGAAAG
ATATGCAAGTACAAGATAATGTTGGCGAAACAAAGTACAAAGACATCATT
AGCATGCGATCTGATGAAGTGTTCGATTTAGAGTTGGCTATTTACGAGAA
TGGATCTTCTGGTAGCAAGCAATACGATATGTCGTGTGTCGACACCAGTG
TCAAACTGAACTTCGGTCAAATGCGCGTTGTTTTCTTGTATAGATTCATA
CAAGACTTAATGTCATTCACCGAAAACTTCGAAGAAGCACAGAAAGCAGT
TGTGGAAGCTGGTAAAGCTGCCAAGGATAAAGCTCTGGAAACAGCGACCG
ATTTGAATAGACATTCTTCTCGTGTCAAACTAAATGTGGTTCTGAAAGCA
CCGACTATTATCATTCCAGTTGGATCAAACAATGAATTGGCTTTACTGGT
GGATCTGGGTGAATTGCGTATTTACAACACATTCAAACTCCTCAACGATG
ATCAATACCATAAGAAATCTATCATCACTGATAACATGACCATTAAGTTA
TCCAATCTGAAATTGTTAAAAGCACTTATTCAAGATGGTAAAGATTTCTT
GCATCAACGAGCCATTATTGAACCTATGATGCTACAAATAACTATTGTTC
GTAATTTAACGAAAGGTAACCATTCCATACCGGATGTTTCAGTTCAAGCA
AAGATGCCAGCTATTCTGTTATCAATCAGTGAAGAAGATGTGACCGTAGC
TCTAAAGATTGTCCAAGGGAATCTCGCCGAAGGTGAGTCACATGCGCCGA
AGAAGCAAGCCAAGCCTGCCAAACAAACGTTAAACGTGCCACAAGATCGT
TTAGCAGACATTTACGAGGAGcctgaagatgaagatgagaaTCGACAAGG
ATATCTTCAAACCAAACTATCCTTCGATCTGGCTAAAATTGACATCAAGC
TTTACTTGAAACCATCTGATATGACATTTGAAGATGAATTTTTAGCGAGG
ACGGATGATTTGTTGTTAGCTTTGTTCACTATTGGTAACCTGTGTGTTGA
TGGAGACATCATGTCCACGCAAGCTATGAAGATGAGCGTTCGATTGGACA
CTTTGGTGTTGGATGATATGAGACCTATCGAGGAGCATGAAGGTGTTAAA
CGTATGATCAACTACAGTCCCGAGCCACTCCTTGAAGAAGTCAAAACCTC
TTCTCATAAACGACCAATCGACAACTCACGAATGATCGAAATCCAAttcg
atcaaacttcatcgcaagataaaaatatcgacATCAAACTTTGTAACATG
CTTTGTATATTCAACGTTGAGTTTATCATGGTCCTGTTGAAAACGTTGCA
AGCTGCCATACCTAAAGATGATAGTCTGCAACATGGCCATTCAATGAGTA
GTCTAGACTCGGCGGCAGGGTCTGGCGGCAGCGATGACGAGGACTCTTTA
GAAGCCAGCGAGATTGTCCTCTGCACTGGTGATCAAGAAAGACCTGAGAC
TAAAGTCTCTATCTTCGTCCATAACCCGCAAATTGTTTTACTAGCAGATG
CAAAGGATGTCAAAACAAATGCACTCTTTCTTACAACCGagatcaatttt
caatatttcgaaTTGCGAGATACTCAAAAAATGATTGGCGCTGTTTCTAA
CACCGCTATTTTGTCAACTGCTTTCAAGAATGACCATCGGAGTGATATAT
CAACAGTGTTGTCATTAGATTCCATCAATCTCCACTCGTCATCACCCATC
AATGGTAAACCTCATATGAGTGTCAGCACAACTTTGATCAAACTGAATAT
CTCACCCAAAACCATCCGAACTTTATCAGCGTGTGCTGGTTACATCTCCA
ATGATCCAACAGATGAAGAAATCAAAGAAGCTCGAAAAGCCATGCGTGAT
TTATGGCAAATTCAAACGTTCACCAATAAGCGACCGTGGTATTTAAACCA
CCCACCACAACAAGTCTTAAGTGCTGGCAGCTTCGTCCTTGCGCGAACGA
GAACAGGAGAATATAAGCATGGTTTCTTAGCTAAAAAGGATGTCTCGTAT
CAAGTCTATTTTTCAGAGGAGCGAGGAACAGCCAGTCACCGAGCCATGGA
TATCTCATCTGTTGTTTTGGATATCGTACCGCTGATCGGTGATCTATGTG
TTGGATGTAATGTTTTAGCTGTGGAATCGAAAGAACATGGATATCGTACT
GGTCGAATTACTCAGGTTTGGGATTCGAATGTGGATAAAGATTCTTCGGA
TGGCGCCAAACAATCTGTTTCTGTCAAGACAACTGCTATTGCTCCAATCA
AATACCTTGTCAATTTCTATGACAACCAAACGGAGAACTTCTTCCCGCCT
GATGAACTTCGTATCATTGGTAAACCCATCAAGGGGGTTGTCCCTGGACT
AGGGGCGTGTGTTTACGCCCGCTTTAATGATGGTTTTTACTATCGGGGCA
AAGTTGATGACATCGAGGATTATCGAATCCGAGTGCAATTGGATGAGATC
AGTGGAGAAATCGAACACGACATCGATGATCCGTCAGCCGTTATTTTGAA
CCTGACGCCTCAATACCGTCAAGTCAAAAAGCATTTCAAAGTCATTGCAT
CCAAAGGAAGCACAACTAAAGGATATCATCCGGGGAAAGTGACCGCCATC
CAAGGTGAAGGAAATAACCGATTGTATTCGATACGCTTCGAAGACGGTAC
AATTAACCAAGTACCCATCacgaaattgattttgatgccAAAAGCACCTT
TTGATGCTTTACCTGAAGTTGGCACATACGTTTATTCCCGAGTGTCACGC
GACGCTCCTTTATACGAGAAGGGTATCGTAGCAGAGAAGAACACAATGAT
CTGCGTTAAACATTTAAATGGACGGAAATTGGCTCACGAAATACAAAACA
TTCATTTTGTTGTCCGAAATATCGTTCCTCTCGTGTCATCAttgaagGTT
GGTTTGGACGTCATAGTGCAACCTGACAATGACGATCAGAAAATGTATTT
GGCTGTCATTAGGGAAGTCACCAAAAAAGAAGGTGACAAAACGAACCGTT
ATCTAGTGGAGTTTACGGATGGATCCAAGAAGAGAGTGACGCCCAGCCGG
ATCCGTATACTTTCTCAATACGGAAGTGCAGAAACGAGTGAAGAAAATGC
TGACATTATCACAACAAGACAGGAGGAACTAGTTCTCGATGTGCAAGGTA
TCTCATTACGTGTGGAAGGTTACTTGGGAGGCGTGTTGACACCCATGCTC
AAAATGGATTCCAAAATCACAGCTAACTTGAAGGATTGGTCAAGCCAAAT
GAATGCACACGCTACTGTATCATTAGAAGCCAGTTATTATAACGAAAACG
TTGCCGAATGGGAGCCAGTTATTGAACCTTTGATGGAGAAACGGAGGGAA
AGACCGTGGCAACTCTCTGTCAATTACACGATGGAAGGTGACGACAATTC
TGCTTCATCCACTTCCAACGAACTCGTTTTACAAAAACCGGAATCCAACC
TGAAAATCAAATCTCAAGATAATCTTGAATTGACAATTTCAAAATCATGT
CTTGCTTTACTCGGTGAATTGGGACAGGTGTTTGGAGATGCAGTAGAATC
TGTGGACGTTTTACCACAAGTCCTGGTCGAAAAAGAACCTTTCATGATCG
AAAACTTGCTCTCCAAGAAGGTGACAGTAACATTGAATGAACTTCTGCAG
GGACCAAATGGAGATTCGACAATCGAGCTAGCATCTTCTTCGAATCCTGT
TGGCATTACTTTTGCTCCCAagaaatttgagaaacgaaAGACCAACGATC
TATACACAATCAATTTAtcgGTGGACGGTTTTCATGACATTAAAGACATT
GTGGTTCAAAGAAAGCGAAGCGTTATCTATGATCTTGTACCAATAAAACT
ATTATCAGCACAGTCTTCATATTCGATAGTGGTACAAGTGAAGACAACAG
ACGGACAACGTATCATCGTACTCCGATCACCATTGCAGTTGAAAAATCAC
TTTCCAATGCCGTTGGATGTCAGCTACATTTCCAAAGAAAACCAACCAGT
TAAACTGACAACAGTGGGATCGGGAGATATCTATTCCTTCCCTTTGTTGT
TAACCTACCACAGTGTTTTTCATCTCAAACCTGCTGGTTTCGACTACGGT
GATTGCACAGAAGCTCTCAATTGGAGTGATTTGAAGACGAGCAACGAAAA
ACAGTTCTCCTGCCCTTCACCTGACAAAAGTGCTGACCCTTTCTACATGC
AGGTGGTGATGAAAGAGGAGACGTACTCTTCCGTACACGGCATGTTGGAC
TGTGTACCACGTTACACGTTGGAGTGCTTTCCCGTCATCACGCTGCATAA
TTACCTACCTTGCACTATTAATTATAAGATCAAGGGTATGGCGAAATCGG
AAAGTCTACCAGGCGGACACAATTGGCCTTTGTTTACCGTCAACTTCAGT
GATAAACCTTCCATCTATATCGAGATTGAGTCGTATAACAACCAAAGATG
GGAAGGAGGTTTGACATTACCAACAAAACCGGTAGATTCTTTGAACAAAC
CATCATTATCTTTCGTCATGATGTCTGGTGAACGCAAAATGGAATTGGGT
GTTTATTACCAGTTAGACGGTTCATTGAACATCACCTTATATTCGCCTTA
CTGGCTTCTCAATAAAACTGGAAAACCACTTGTCTATCAGCCAGCGGGGA
GCAGCATCCAGCAAGTTCACCAAGAGAACGATGTAAATGCTCTTATGATG
CTCGTCAAAGGGAAACATAAAAAGgcgaaagtgaaagtgaaaaataGCGA
GTCATGGTCAAATGAATTTTCATTGGATACTGTTGGCAGTGGTGGTTCCT
TGAAATGCAATGGTCCAAGAGATCGAGTTTATGAGATTGGTTTGAACATC
AGTTTGTCATACTTTGGATTGACGAAGATTGTGACGTTCACGCCACTCCG
AATGTTATCTAACCACACCAAGTACACCATCAGTATGGCAGAAAGTAATT
CTAAATCGTCAGAATGGCACACGGTAAACCCTGACGAGaacattccatTC
TGGCCGACGAAACTTCCTTTGGTCAACCTTTACATTAACATCAATGGGCA
AGATTCAGTGAAATTCAACCCTGAAGTTGGAAAAACTTTACTGTTGAAGT
TCCAGAATGAGGTTGGAGGAGTTTGCGTGGATTACCAAGAAAAGGACTCG
TCCTCAGTCCTTTCGTTTAATCCGTACTTCGCAGGTGCAGCTCCTGTGCG
GCttgaaaatctttgcaaaaaGATCGGCATGATCGCTTATAAACAAGCAG
GTTCGGTAATGGGTCACGTGTTAACACATGACCAATCAGTGTTGTACACG
TGGGATGATCCAACCATGGAACAAGAATTGATTTGTTCCATTGTCAATGA
TGAAGCCAGTGAAACAAGGATCAAACTCGATGCCAACGATTTCGGACGAA
TGAGAGTTGGAGATGGTGCAATTTATTGGGTTTCCTTTCTGGATGGTCTT
CAACGTGTTCTATTGTTCACTGATAACTTCAAATCTGCTTACTGCGCATG
TCAGgaGCAAAATTTACGCCCAACCATGGAAGTTGACTTTGAGATTGAGA
GTTTTGGTTTGTCTCTGGTCAATGTTGATAAGAGAATGGAGATTGGCTAC
TTAGCTATCCGACAAAGCAAGACTGTATGGGAGCAACGCAAGAAAAAGAA
CCGCTGGAAAGCTTTACCGCTTGCCATGTGTGAAGCTCTCGAAGAAGGTT
ATCTCAATTATCAAAACAGAAAAGGTGCAGTCAAAGAGAAAGTTCTGGAT
AAGGAGGTGGATTACGAGAAGATGTTTATTACGAAACCTGAGAAGATTAA
GATCAGAAGAACGTACCACAGCGGTCTTGGTTTCAAATACACAATCTCAC
CCAATGAAATGCGTGTGCATGCTTCTATCAGCTCAATACAGTTGGATAGC
CATGTTCCAGGTTCGACCTTTCCAACAGTCTTGCATATGGTTGAACCACC
AAAATCTGTTGCTTCAGAAAACGCTCCAAAGCCATTCTttgaattgagtt
taatgaCAAGGATCGGTGATAAAAATGTGGTCAATGAAGTcagCTATTGT
CACGTGTTGATTCAAGAGATGGATGTGAGGGTTGATATTGGATTTTTATT
GGCTCTGATGGAACTCTTCAGTCATGCAAGAGCTCGAACAACCGAGAAAG
AACAATACGCGCTTGATATTGGCCAAGCAGCAACAAAGTTTGAAGAAAGC
GCTGAATTTCAGGCAGCCAAACAAGATCGATATTACGTTTTGAACGACTT
TCATTTATCACCGCTAAAGATTCACGTCAGTTTCTCTTTGACGGGTGGTT
CCAAAGATGAAAATGCTATTGCTTCATTACATGGTAACGTGTTGAACTTG
TTGTTACAAAGTGTCGGACTGGCCTTCACTGAAATACAAGACGTACAATT
CAAATTAGCATGTTACGAAGTGCATAAGTCCATGCAGAGTAATTCGCAGC
TCGGTGATGGAATAACTAAACATTATCAAACACAGGCTATCAAGCAACTT
TATGTGTTGGTACTCGGGCTAGACGTTCTTGGTAATCCGTATGGTTTGAT
ATCTGGTGTTGGAACCGGAGCAAAGAATTTCTTCTACGAACCTTACCAGG
GATTAATTCAAGGACCAGAAGAATTTGCGGAAGGATTGGCGTATGGGGTG
AAGAGTCTTGTTGGTGGAACCGTGGGTGGAGTATCAGGAGCTGTGAGTAA
GATTACCGGTACCTTCGGTAAAGGTTTGGCTGCATTGACCTTGGATGAAG
AATATCAACAAAAGAGACGTGAAAACATGAGCCAACGCCCAACTAACCTC
GGTGAAGGTCTCGCCAAAGGTGGTAAAGGCCTTGTAAAGGGTATCGTGTC
TGGTGTTACAGGGATCGTTACCAAACCCTATGAAGGTGCCAAGAATGATG
GTGCAGGTGGCTTTTTTAAGGGCGTTGGAAAAGGCCTGATTGGCGTGGTT
GCACGCCCTGTTGGTGGAGTGGTAGATATGGCCAGTAACACGTTTGATGG
TTTGAAAAGCACGACATCTGGCGTGAAAGCGATCGAGTTGAGCCGTGTTA
CTCGCGTCTTCCACGCAGATAAGGTTTTACGACCTTTCAATCTGTACGAA
GCAGATGGAAACAAAATTCTTATGCAATGTAACAAAGGAGAATACGCCAA
GAAGAATTTTTATATCACTCATGTAGTGGACAAGAAGAACTATCTCATCC
TCACTCAATCaaacATTTTGTATGTTGGAAAGAACGAGTTGAAAATGGGT
GAATGGGAATCggtttgggttatcgagttcaATGAGCTAAAACGTGAACC
AGAAGTGAAAGAGACAAAGATTATTTTCCATATCCATAATACGGACACGC
GACGTTCAATTTTCAAGAAATCGACGAACACACGTGAAGTGATATTGGAG
TCTAGTGCTGTTGCAGACTGGTTTATCTTAAAGCTTAGAGATGCTAAAAT
GTTATAGatggtatttgaaTCTTTGGTTGCTGACCTCTTGAACAAGTATC
TGGGTCAATATGTGAAAAATCTTGATGCTTCTCAATTGAAGATTGGCATT
TGGGGAGGAAATGTTGTCCTGACAGAACTTGAACTGAAAGATACAGCTCT
GGATGATCTTGACTTACCCATAAAAGTTGTTCGTGGATATTTGGgtAAAT
TGGTCTTGTCCATCCCATGGAAAAATCTTTACACTGAATCAACTGTTGTC
GATATTCAAGATCTCCACCTTGTCGCTAAGCCTAATTTTGACATCAAATA
CAATGAAGAACgcgaagaaaaatcaaaacatgacAAGAAACAACAACAGA
TTCACAATATCGAAGAAGCGAGGCAAAGAGAAGAAGACAAAAAGAAAGGC
GCCAAGAAAGAAGAGAGTGACGGTTTTGCTGAGAAACTTGCAACAAACGT
CATAAAAAATCTACAGGTTACGATCAAGAACATACATGTTCGATATGAAG
ACTCAATCAGTGATGTGAATGGACCCTTTTCAGTCGGTCTTACAATGGAA
AGTTTAACAGCACAAACCACAGATGAAGATTTTGTTCCAAAGATTATCAA
AGAATCTGTCTCATTAATTCATAAGatggTGAAATTAGACAATTTGGCTT
TATATTGGAATCCAGGAGACGAACTGATTGATCCTTCACTTGATACCAAG
CAATGGTTGgaagtTTCAACGAAGCAAATTTCAACACACCAATCGAAGCC
AGAGAAAACGAAATATATTTTGAGTCCCATGGTTGCAACGAAGAAATTGA
AGCTGAACACCAAACCAGGTTCCAACCTTGACATCCCGAAGatgttTTTG
AACTTGGTTTTGGAAGAACTTGGTATCATCGTGGCAAGAAGTCAATATCA
TGGCGTGGTGCAACTGATTGAATCATTTGAACGAATGAATAGGAACCAAC
CTTTTCGTAAATACAGACCACATACCTCCGTTCTTGGGAACGAAAGTATT
TGGTGGAAGTACTGCATGTCCAGCATACTGGAGGTGGATGTCAAAAGACG
ATCTCAAATGTGGAGCTGGAAGCATATTCAAAAACATCGAGTTCTTTGCA
AAGCTTACAAAGTGAAGTAcaaggaaaaattgaaacagaaaaATCCATCC
AAACAAATTCTCACTGAACTAGAGaGCATGGAGGATGAGTTGAATATTGC
AAGCATCACCATTTTTCGACAGCTTGCAGCTACAGAGGTTTTAACGGAAC
AAAAGAAGAAAGGCACTAAAGGAAGTTTCTTCAGTTTCTTCTCCAGATCA
AAAGAACCAGAAAAGTCTGCTGCTAATAAAATTGGAGATTTAATGGGTGA
TGACCAGGAGAAGGAAATGCAGAAATTGTATGACGCAATCGGTTATACTG
AAAATGAAGTCATCACTCCCTTTCCTAAAGAGTACGTGGCGATGTCAGTG
GAATCGATTCTCCAGAAATTATTCATCAGCCTCATCGATGACACAGATAA
GGCGAAAGAATTCAAAGTGTTGGATTTTTCACTCAACAACATCATTGTAG
AAGTTTTCCAAAGACCTTCTGCTCAAGCTCTCAAATTATGTGCAAAGATA
GGAGAGATGAAGTTATTTGGTACAGCTTCTGCTCAATGTACACCTCtcat
catcaaaaacatgttaCAAGGTCGAGGTATGGAATTTCTGCCGTTGGTGG
ACTTCATCTTTGAGACGAATCCTTTGAAGAAACCGGACATTGACCAATGT
ATCACTGCTATTTGTCAACCCTTAGAAATCATCTATGATGCTAACACGAT
CAACCATATCATTAGTTTCTTCAAACCTCCTGAACATGTTATCTTGCAAG
ATTTACAAGACAAAGCGTATTCTACTTTCGAAGATTTTAAAGTTTCAAGT
ACGGCTGGTCTTCTACATGCTATGGAACAAAGAACGGTTATGGACATCGA
CATTGATGTTGGAGCATCTCATTTGATCATCCCTGAAAAAGGTTCTTACA
ATGGTTGTACAGATATGCTGGTGATCGACTTTGGTAAAATCACGATGAGC
AGCGATCCTAGTCAAATCAGACACCTTGACCCTAAGGACATTGAGGATGT
GAATGAAGTACAAAGCAAAGCTTATGATCGATTCTTGTTGTCGCTTCAAG
CTCTTCAAATATTACTCGTTAGAGAAGGTGAAGATTTAAAGAGTGCTAAA
AGCAACGTCAGTAAAGCTTCATCACACATTTTGCATCCCATCAATTTCGA
TGGCAAACTTGCCAAAGCTATACTTCCACAAGATCCACGTTTAAAACAGA
TATGTGTCTCTGGTGAATTATCTTCGCTGTTTGTTTCTGTATCGGATGAT
AAAGTCAGTCGTCTCATCAAGCTAGCAGACTCGATACCACTCCCTCAATC
ACCTTCTCACGATAACATCGACGGAGAAGAAAAACCTGAAGGACTCTTCA
CCAAGGCGTTGTCAATGATAAGCTTGACAGGTGACAATGACACAGGGGTG
GACATCGGAGGATTTTCCATCCCTGTACCGACATCTCCAACATCAGTGAC
GTCAGATGAAGATGAATACGGGACACCACCTGATGGCTCCATATTACAGT
TACAACAAGAAGCTGGTCCGGACTTTTCATCAGGAGTGGCGAACCAAGTC
AAAGTGGACTTGAACTTTAAAATCCATAAAGTGATGATCGCCATTGGTTT
GACTGACAAAGCATTGAAACAGGAAAAAGAATGTCTGAAATTCATCGTGG
ACGACATCAATACAGAGgtGATACTACGAAGATGGGATTTGTTCGTCAAT
GCAGAAGTTGGTCGTCTGGTGTTGAATGAAATGACATGGGGTGTTGATGG
AGAACCTTTCGCCATCATGAGTACacccaaaaacaccaaaatgttGAAAT
TCAGCTATCGGAGGTGTGAATTCAACGAAAGTTTGAATCTCGGTCCAAGT
TACTTTTATTCCAAAGAAGCGCAAGTCAGAGCTTTACATTTCAAAGATGA
ATTTGGCGCCACGGATCAGATTTTAGATGTACAAGTGGCTACTTTATTTC
TGATGCTTCATCAAGAAGCACTTTTGAGCATCATGTCATTGATCTACCAA
GTACTGGAACCACTCAACAAACATGATAAGGAAGCCACACAGAAGATCAA
ACGGAGTTTGAGTACGGCAGGTAGTCGTTTGAGTCTCTCCatcgaagaaa
aagaaaaggagaGACAGATACAACGAAAATTAGCCAACCCTAAAGCACTG
GAAGCTGCCAACGAACTTAAGCAACAGGTTGGcttagaagaagaaaaaaa
gatgaGAGTGACCGCCCACCTGGATGGTGTTGGTATCATGATTTGTTCAG
CCAAAGTTGACCTTGCACAAGCCTTCGTTAAAGGGTTATCTGCTAAAGTA
CTGATGAAAGATGACTTATTAGAAGTGAAAGCCAGCATGAAAGATATGCA
AGTACAAGATAATGTTGGCGAAACAAAGTACAAAGACATCATTAGCATGC
GATCTGATGAAGTGTTCGATTTAGAGTTGGCTATTTACGAGAATGGATCT
TCTGGTAGCAAGCAATACGATATGTCGTGTGTCGACACCAGTGTCAAACT
GAACTTCGGTCAAATGCGCGTTGTTTTCTTGTATAGATTCATACAAGACT
TAATGTCATTCACCGAAAACTTCGAAGAAGCACAGAAAGCAGTTGTGGAA
GCTGGTAAAGCTGCCAAGGATAAAGCTCTGGAAACAGCGACCGATTTGAA
TAGACATTCTTCTCGTGTCAAACTAAATGTGGTTCTGAAAGCACCGACTA
TTATCATTCCAGTTGGATCAAACAATGAATTGGCTTTACTGGTGGATCTG
GGTGAATTGCGTATTTACAACACATTCAAACTCCTCAACGATGATCAATA
CCATAAGAAATCTATCATCACTGATAACATGACCATTAAGTTATCCAATC
TGAAATTGTTAAAAGCACTTATTCAAGATGGTAAAGATTTCTTGCATCAA
CGAGCCATTATTGAACCTATGATGCTACAAATAACTATTGTTCGTAATTT
AACGAAAGGTAACCATTCCATACCGGATGTTTCAGTTCAAGCAAAGATGC
CAGCTATTCTGTTATCAATCAGTGAAGAAGATGTGACCGTAGCTCTAAAG
ATTGTCCAAGGGAATCTCGCCGAAGGTGAGTCACATGCGCCGAAGAAGCA
AGCCAAGCCTGCCAAACAAACGTTAAACGTGCCACAAGATCGTTTAGCAG
ACATTTACGAGGAGcctgaagatgaagatgagaaTCGACAAGGATATCTT
CAAACCAAACTATCCTTCGATCTGGCTAAAATTGACATCAAGCTTTACTT
GAAACCATCTGATATGACATTTGAAGATGAATTTTTAGCGAGGACGGATG
ATTTGTTGTTAGCTTTGTTCACTATTGGTAACCTGTGTGTTGATGGAGAC
ATCATGTCCACGCAAGCTATGAAGATGAGCGTTCGATTGGACACTTTGGT
GTTGGATGATATGAGACCTATCGAGGAGCATGAAGGTGTTAAACGTATGA
TCAACTACAGTCCCGAGCCACTCCTTGAAGAAGTCAAAACCTCTTCTCAT
AAACGACCAATCGACAACTCACGAATGATCGAAATCCAAttcgatcaaac
ttcatcgcaagataaaaatatcgacATCAAACTTTGTAACATGCTTTGTA
TATTCAACGTTGAGTTTATCATGGTCCTGTTGAAAACGTTGCAAGCTGCC
ATACCTAAAGATGATAGTCTGCAACATGGCCATTCAATGAGTAGTCTAGA
CTCGGCGGCAGGGTCTGGCGGCAGCGATGACGAGGACTCTTTAGAAGCCA
GCGAGATTGTCCTCTGCACTGGTGATCAAGAAAGACCTGAGACTAAAGTC
TCTATCTTCGTCCATAACCCGCAAATTGTTTTACTAGCAGATGCAAAGGA
TGTCAAAACAAATGCACTCTTTCTTACAACCGagatcaattttcaatatt
tcgaaTTGCGAGATACTCAAAAAATGATTGGCGCTGTTTCTAACACCGCT
ATTTTGTCAACTGCTTTCAAGAATGACCATCGGAGTGATATATCAACAGT
GTTGTCATTAGATTCCATCAATCTCCACTCGTCATCACCCATCAATGGTA
AACCTCATATGAGTGTCAGCACAACTTTGATCAAACTGAATATCTCACCC
AAAACCATCCGAACTTTATCAGCGTGTGCTGGTTACATCTCCAATGATCC
AACAGATGAAGAAATCAAAGAAGCTCGAAAAGCCATGCGTGATTTATGGC
AAATTCAAACGTTCACCAATAAGCGACCGTGGTATTTAAACCACCCACCA
CAACAAGTCTTAAGTGCTGGCAGCTTCGTCCTTGCGCGAACGAGAACAGG
AGAATATAAGCATGGTTTCTTAGCTAAAAAGGATGTCTCGTATCAAGTCT
ATTTTTCAGAGGAGCGAGGAACAGCCAGTCACCGAGCCATGGATATCTCA
TCTGTTGTTTTGGATATCGTACCGCTGATCGGTGATCTATGTGTTGGATG
TAATGTTTTAGCTGTGGAATCGAAAGAACATGGATATCGTACTGGTCGAA
TTACTCAGGTTTGGGATTCGAATGTGGATAAAGATTCTTCGGATGGCGCC
AAACAATCTGTTTCTGTCAAGACAACTGCTATTGCTCCAATCAAATACCT
TGTCAATTTCTATGACAACCAAACGGAGAACTTCTTCCCGCCTGATGAAC
TTCGTATCATTGGTAAACCCATCAAGGGGGTTGTCCCTGGACTAGGGGCG
TGTGTTTACGCCCGCTTTAATGATGGTTTTTACTATCGGGGCAAAGTTGA
TGACATCGAGGATTATCGAATCCGAGTGCAATTGGATGAGATCAGTGGAG
AAATCGAACACGACATCGATGATCCGTCAGCCGTTATTTTGAACCTGACG
CCTCAATACCGTCAAGTCAAAAAGCATTTCAAAGTCATTGCATCCAAAGG
AAGCACAACTAAAGGATATCATCCGGGGAAAGTGACCGCCATCCAAGGTG
AAGGAAATAACCGATTGTATTCGATACGCTTCGAAGACGGTACAATTAAC
CAAGTACCCATCacgaaattgattttgatgccAAAAGCACCTTTTGATGC
TTTACCTGAAGTTGGCACATACGTTTATTCCCGAGTGTCACGCGACGCTC
CTTTATACGAGAAGGGTATCGTAGCAGAGAAGAACACAATGATCTGCGTT
AAACATTTAAATGGACGGAAATTGGCTCACGAAATACAAAACATTCATTT
TGTTGTCCGAAATATCGTTCCTCTCGTGTCATCAttgaagGTTGGTTTGG
ACGTCATAGTGCAACCTGACAATGACGATCAGAAAATGTATTTGGCTGTC
ATTAGGGAAGTCACCAAAAAAGAAGGTGACAAAACGAACCGTTATCTAGT
GGAGTTTACGGATGGATCCAAGAAGAGAGTGACGCCCAGCCGGATCCGTA
TACTTTCTCAATACGGAAGTGCAGAAACGAGTGAAGAAAATGCTGACATT
ATCACAACAAGACAGGAGGAACTAGTTCTCGATGTGCAAGGTATCTCATT
ACGTGTGGAAGGTTACTTGGGAGGCGTGTTGACACCCATGCTCAAAATGG
ATTCCAAAATCACAGCTAACTTGAAGGATTGGTCAAGCCAAATGAATGCA
CACGCTACTGTATCATTAGAAGCCAGTTATTATAACGAAAACGTTGCCGA
ATGGGAGCCAGTTATTGAACCTTTGATGGAGAAACGGAGGGAAAGACCGT
GGCAACTCTCTGTCAATTACACGATGGAAGGTGACGACAATTCTGCTTCA
TCCACTTCCAACGAACTCGTTTTACAAAAACCGGAATCCAACCTGAAAAT
CAAATCTCAAGATAATCTTGAATTGACAATTTCAAAATCATGTCTTGCTT
TACTCGGTGAATTGGGACAGGTGTTTGGAGATGCAGTAGAATCTGTGGAC
GTTTTACCACAAGTCCTGGTCGAAAAAGAACCTTTCATGATCGAAAACTT
GCTCTCCAAGAAGGTGACAGTAACATTGAATGAACTTCTGCAGGGACCAA
ATGGAGATTCGACAATCGAGCTAGCATCTTCTTCGAATCCTGTTGGCATT
ACTTTTGCTCCCAagaaatttgagaaacgaaAGACCAACGATCTATACAC
AATCAATTTAtcgGTGGACGGTTTTCATGACATTAAAGACATTGTGGTTC
AAAGAAAGCGAAGCGTTATCTATGATCTTGTACCAATAAAACTATTATCA
GCACAGTCTTCATATTCGATAGTGGTACAAGTGAAGACAACAGACGGACA
ACGTATCATCGTACTCCGATCACCATTGCAGTTGAAAAATCACTTTCCAA
TGCCGTTGGATGTCAGCTACATTTCCAAAGAAAACCAACCAGTTAAACTG
ACAACAGTGGGATCGGGAGATATCTATTCCTTCCCTTTGTTGTTAACCTA
CCACAGTGTTTTTCATCTCAAACCTGCTGGTTTCGACTACGGTGATTGCA
CAGAAGCTCTCAATTGGAGTGATTTGAAGACGAGCAACGAAAAACAGTTC
TCCTGCCCTTCACCTGACAAAAGTGCTGACCCTTTCTACATGCAGGTGGT
GATGAAAGAGGAGACGTACTCTTCCGTACACGGCATGTTGGACTGTGTAC
CACGTTACACGTTGGAGTGCTTTCCCGTCATCACGCTGCATAATTACCTA
CCTTGCACTATTAATTATAAGATCAAGGGTATGGCGAAATCGGAAAGTCT
ACCAGGCGGACACAATTGGCCTTTGTTTACCGTCAACTTCAGTGATAAAC
CTTCCATCTATATCGAGATTGAGTCGTATAACAACCAAAGATGGGAAGGA
GGTTTGACATTACCAACAAAACCGGTAGATTCTTTGAACAAACCATCATT
ATCTTTCGTCATGATGTCTGGTGAACGCAAAATGGAATTGGGTGTTTATT
ACCAGTTAGACGGTTCATTGAACATCACCTTATATTCGCCTTACTGGCTT
CTCAATAAAACTGGAAAACCACTTGTCTATCAGCCAGCGGGGAGCAGCAT
CCAGCAAGTTCACCAAGAGAACGATGTAAATGCTCTTATGATGCTCGTCA
AAGGGAAACATAAAAAGgcgaaagtgaaagtgaaaaataGCGAGTCATGG
TCAAATGAATTTTCATTGGATACTGTTGGCAGTGGTGGTTCCTTGAAATG
CAATGGTCCAAGAGATCGAGTTTATGAGATTGGTTTGAACATCAGTTTGT
CATACTTTGGATTGACGAAGATTGTGACGTTCACGCCACTCCGAATGTTA
TCTAACCACACCAAGTACACCATCAGTATGGCAGAAAGTAATTCTAAATC
GTCAGAATGGCACACGGTAAACCCTGACGAGaacattccatTCTGGCCGA
CGAAACTTCCTTTGGTCAACCTTTACATTAACATCAATGGGCAAGATTCA
GTGAAATTCAACCCTGAAGTTGGAAAAACTTTACTGTTGAAGTTCCAGAA
TGAGGTTGGAGGAGTTTGCGTGGATTACCAAGAAAAGGACTCGTCCTCAG
TCCTTTCGTTTAATCCGTACTTCGCAGGTGCAGCTCCTGTGCGGCttgaa
aatctttgcaaaaaGATCGGCATGATCGCTTATAAACAAGCAGGTTCGGT
AATGGGTCACGTGTTAACACATGACCAATCAGTGTTGTACACGTGGGATG
ATCCAACCATGGAACAAGAATTGATTTGTTCCATTGTCAATGATGAAGCC
AGTGAAACAAGGATCAAACTCGATGCCAACGATTTCGGACGAATGAGAGT
TGGAGATGGTGCAATTTATTGGGTTTCCTTTCTGGATGGTCTTCAACGTG
TTCTATTGTTCACTGATAACTTCAAATCTGCTTACTGCGCATGTCAGgaG
CAAAATTTACGCCCAACCATGGAAGTTGACTTTGAGATTGAGAGTTTTGG
TTTGTCTCTGGTCAATGTTGATAAGAGAATGGAGATTGGCTACTTAGCTA
TCCGACAAAGCAAGACTGTATGGGAGCAACGCAAGAAAAAGAACCGCTGG
AAAGCTTTACCGCTTGCCATGTGTGAAGCTCTCGAAGAAGGTTATCTCAA
TTATCAAAACAGAAAAGGTGCAGTCAAAGAGAAAGTTCTGGATAAGGAGG
TGGATTACGAGAAGATGTTTATTACGAAACCTGAGAAGATTAAGATCAGA
AGAACGTACCACAGCGGTCTTGGTTTCAAATACACAATCTCACCCAATGA
AATGCGTGTGCATGCTTCTATCAGCTCAATACAGTTGGATAGCCATGTTC
CAGGTTCGACCTTTCCAACAGTCTTGCATATGGTTGAACCACCAAAATCT
GTTGCTTCAGAAAACGCTCCAAAGCCATTCTttgaattgagtttaatgaC
AAGGATCGGTGATAAAAATGTGGTCAATGAAGTcagCTATTGTCACGTGT
TGATTCAAGAGATGGATGTGAGGGTTGATATTGGATTTTTATTGGCTCTG
ATGGAACTCTTCAGTCATGCAAGAGCTCGAACAACCGAGAAAGAACAATA
CGCGCTTGATATTGGCCAAGCAGCAACAAAGTTTGAAGAAAGCGCTGAAT
TTCAGGCAGCCAAACAAGATCGATATTACGTTTTGAACGACTTTCATTTA
TCACCGCTAAAGATTCACGTCAGTTTCTCTTTGACGGGTGGTTCCAAAGA
TGAAAATGCTATTGCTTCATTACATGGTAACGTGTTGAACTTGTTGTTAC
AAAGTGTCGGACTGGCCTTCACTGAAATACAAGACGTACAATTCAAATTA
GCATGTTACGAAGTGCATAAGTCCATGCAGAGTAATTCGCAGCTCGGTGA
TGGAATAACTAAACATTATCAAACACAGGCTATCAAGCAACTTTATGTGT
TGGTACTCGGGCTAGACGTTCTTGGTAATCCGTATGGTTTGATATCTGGT
GTTGGAACCGGAGCAAAGAATTTCTTCTACGAACCTTACCAGGGATTAAT
TCAAGGACCAGAAGAATTTGCGGAAGGATTGGCGTATGGGGTGAAGAGTC
TTGTTGGTGGAACCGTGGGTGGAGTATCAGGAGCTGTGAGTAAGATTACC
GGTACCTTCGGTAAAGGTTTGGCTGCATTGACCTTGGATGAAGAATATCA
ACAAAAGAGACGTGAAAACATGAGCCAACGCCCAACTAACCTCGGTGAAG
GTCTCGCCAAAGGTGGTAAAGGCCTTGTAAAGGGTATCGTGTCTGGTGTT
ACAGGGATCGTTACCAAACCCTATGAAGGTGCCAAGAATGATGGTGCAGG
TGGCTTTTTTAAGGGCGTTGGAAAAGGCCTGATTGGCGTGGTTGCACGCC
CTGTTGGTGGAGTGGTAGATATGGCCAGTAACACGTTTGATGGTTTGAAA
AGCACGACATCTGGCGTGAAAGCGATCGAGTTGAGCCGTGTTACTCGCGT
CTTCCACGCAGATAAGGTTTTACGACCTTTCAATCTGTACGAAGCAGATG
GAAACAAAATTCTTATGCAATGTAACAAAGGAGAATACGCCAAGAAGAAT
TTTTATATCACTCATGTAGTGGACAAGAAGAACTATCTCATCCTCACTCA
ATCaaacATTTTGTATGTTGGAAAGAACGAGTTGAAAATGGGTGAATGGG
AATCggtttgggttatcgagttcaATGAGCTAAAACGTGAACCAGAAGTG
AAAGAGACAAAGATTATTTTCCATATCCATAATACGGACACGCGACGTTC
AATTTTCAAGAAATCGACGAACACACGTGAAGTGATATTGGAGTCTAGTG
CTGTTGCAGACTGGTTTATCTTAAAGCTTAGAGATGCTAAAATGTTATAG
atggtatttgaaTCTTTGGTTGCTGACCTCTTGAACAAGTATCTGGGTCA
ATATGTGAAAAATCTTGATGCTTCTCAATTGAAGATTGGCATTTGGGGAG
GAAATGTTGTCCTGACAGAACTTGAACTGAAAGATACAGCTCTGGATGAT
CTTGACTTACCCATAAAAGTTGTTCGTGGATATTTGGgtAAATTGGTCTT
GTCCATCCCATGGAAAAATCTTTACACTGAATCAACTGTTGTCGATATTC
AAGATCTCCACCTTGTCGCTAAGCCTAATTTTGACATCAAATACAATGAA
GAACgcgaagaaaaatcaaaacatgacAAGAAACAACAACAGATTCACAA
TATCGAAGAAGCGAGGCAAAGAGAAGAAGACAAAAAGAAAGGCGCCAAGA
AAGAAGAGAGTGACGGTTTTGCTGAGAAACTTGCAACAAACGTCATAAAA
AATCTACAGGTTACGATCAAGAACATACATGTTCGATATGAAGACTCAAT
CAGTGATGTGAATGGACCCTTTTCAGTCGGTCTTACAATGGAAAGTTTAA
CAGCACAAACCACAGATGAAGATTTTGTTCCAAAGATTATCAAAGAATCT
GTCTCATTAATTCATAAGatggTGAAATTAGACAATTTGGCTTTATATTG
GAATCCAGGAGACGAACTGATTGATCCTTCACTTGATACCAAGCAATGGT
TGgaagtTTCAACGAAGCAAATTTCAACACACCAATCGAAGCCAGAGAAA
ACGAAATATATTTTGAGTCCCATGGTTGCAACGAAGAAATTGAAGCTGAA
CACCAAACCAGGTTCCAACCTTGACATCCCGAAGatgttTTTGAACTTGG
TTTTGGAAGAACTTGGTATCATCGTGGCAAGAAGTCAATATCATGGCGTG
GTGCAACTGATTGAATCATTTGAACGAATGAATAGGAACCAACCTTTTCG
TAAATACAGACCACATACCTCCGTTCTTGGGAACGAAAGTATTTGGTGGA
AGTACTGCATGTCCAGCATACTGGAGGTGGATGTCAAAAGACGATCTCAA
ATGTGGAGCTGGAAGCATATTCAAAAACATCGAGTTCTTTGCAAAGCTTA
CAAAGTGAAGTAcaaggaaaaattgaaacagaaaaATCCATCCAAACAAA
TTCTCACTGAACTAGAGaGCATGGAGGATGAGTTGAATATTGCAAGCATC
ACCATTTTTCGACAGCTTGCAGCTACAGAGGTTTTAACGGAACAAAAGAA
GAAAGGCACTAAAGGAAGTTTCTTCAGTTTCTTCTCCAGATCAAAAGAAC
CAGAAAAGTCTGCTGCTAATAAAATTGGAGATTTAATGGGTGATGACCAG
GAGAAGGAAATGCAGAAATTGTATGACGCAATCGGTTATACTGAAAATGA
AGTCATCACTCCCTTTCCTAAAGAGTACGTGGCGATGTCAGTGGAATCGA
TTCTCCAGAAATTATTCATCAGCCTCATCGATGACACAGATAAGGCGAAA
GAATTCAAAGTGTTGGATTTTTCACTCAACAACATCATTGTAGAAGTTTT
CCAAAGACCTTCTGCTCAAGCTCTCAAATTATGTGCAAAGATAGGAGAGA
TGAAGTTATTTGGTACAGCTTCTGCTCAATGTACACCTCtcatcatcaaa
aacatgttaCAAGGTCGAGGTATGGAATTTCTGCCGTTGGTGGACTTCAT
CTTTGAGACGAATCCTTTGAAGAAACCGGACATTGACCAATGTATCACTG
CTATTTGTCAACCCTTAGAAATCATCTATGATGCTAACACGATCAACCAT
ATCATTAGTTTCTTCAAACCTCCTGAACATGTTATCTTGCAAGATTTACA
AGACAAAGCGTATTCTACTTTCGAAGATTTTAAAGTTTCAAGTACGGCTG
GTCTTCTACATGCTATGGAACAAAGAACGGTTATGGACATCGACATTGAT
GTTGGAGCATCTCATTTGATCATCCCTGAAAAAGGTTCTTACAATGGTTG
TACAGATATGCTGGTGATCGACTTTGGTAAAATCACGATGAGCAGCGATC
CTAGTCAAATCAGACACCTTGACCCTAAGGACATTGAGGATGTGAATGAA
GTACAAAGCAAAGCTTATGATCGATTCTTGTTGTCGCTTCAAGCTCTTCA
AATATTACTCGTTAGAGAAGGTGAAGATTTAAAGAGTGCTAAAAGCAACG
TCAGTAAAGCTTCATCACACATTTTGCATCCCATCAATTTCGATGGCAAA
CTTGCCAAAGCTATACTTCCACAAGATCCACGTTTAAAACAGATATGTGT
CTCTGGTGAATTATCTTCGCTGTTTGTTTCTGTATCGGATGATAAAGTCA
GTCGTCTCATCAAGCTAGCAGACTCGATACCACTCCCTCAATCACCTTCT
CACGATAACATCGACGGAGAAGAAAAACCTGAAGGACTCTTCACCAAGGC
GTTGTCAATGATAAGCTTGACAGGTGACAATGACACAGGGGTGGACATCG
GAGGATTTTCCATCCCTGTACCGACATCTCCAACATCAGTGACGTCAGAT
GAAGATGAATACGGGACACCACCTGATGGCTCCATATTACAGTTACAACA
AGAAGCTGGTCCGGACTTTTCATCAGGAGTGGCGAACCAAGTCAAAGTGG
ACTTGAACTTTAAAATCCATAAAGTGATGATCGCCATTGGTTTGACTGAC
AAAGCATTGAAACAGGAAAAAGAATGTCTGAAATTCATCGTGGACGACAT
CAATACAGAGgtGATACTACGAAGATGGGATTTGTTCGTCAATGCAGAAG
TTGGTCGTCTGGTGTTGAATGAAATGACATGGGGTGTTGATGGAGAACCT
TTCGCCATCATGAGTACacccaaaaacaccaaaatgttGAAATTCAGCTA
TCGGAGGTGTGAATTCAACGAAAGTTTGAATCTCGGTCCAAGTTACTTTT
ATTCCAAAGAAGCGCAAGTCAGAGCTTTACATTTCAAAGATGAATTTGGC
GCCACGGATCAGATTTTAGATGTACAAGTGGCTACTTTATTTCTGATGCT
TCATCAAGAAGCACTTTTGAGCATCATGTCATTGATCTACCAAGTACTGG
AACCACTCAACAAACATGATAAGGAAGCCACACAGAAGATCAAACGGAGT
TTGAGTACGGCAGGTAGTCGTTTGAGTCTCTCCatcgaagaaaaagaaaa
ggagaGACAGATACAACGAAAATTAGCCAACCCTAAAGCACTGGAAGCTG
CCAACGAACTTAAGCAACAGGTTGGcttagaagaagaaaaaaagatgaGA
GTGACCGCCCACCTGGATGGTGTTGGTATCATGATTTGTTCAGCCAAAGT
TGACCTTGCACAAGCCTTCGTTAAAGGGTTATCTGCTAAAGTACTGATGA
AAGATGACTTATTAGAAGTGAAAGCCAGCATGAAAGATATGCAAGTACAA
GATAATGTTGGCGAAACAAAGTACAAAGACATCATTAGCATGCGATCTGA
TGAAGTGTTCGATTTAGAGTTGGCTATTTACGAGAATGGATCTTCTGGTA
GCAAGCAATACGATATGTCGTGTGTCGACACCAGTGTCAAACTGAACTTC
GGTCAAATGCGCGTTGTTTTCTTGTATAGATTCATACAAGACTTAATGTC
ATTCACCGAAAACTTCGAAGAAGCACAGAAAGCAGTTGTGGAAGCTGGTA
AAGCTGCCAAGGATAAAGCTCTGGAAACAGCGACCGATTTGAATAGACAT
TCTTCTCGTGTCAAACTAAATGTGGTTCTGAAAGCACCGACTATTATCAT
TCCAGTTGGATCAAACAATGAATTGGCTTTACTGGTGGATCTGGGTGAAT
TGCGTATTTACAACACATTCAAACTCCTCAACGATGATCAATACCATAAG
AAATCTATCATCACTGATAACATGACCATTAAGTTATCCAATCTGAAATT
GTTAAAAGCACTTATTCAAGATGGTAAAGATTTCTTGCATCAACGAGCCA
TTATTGAACCTATGATGCTACAAATAACTATTGTTCGTAATTTAACGAAA
GGTAACCATTCCATACCGGATGTTTCAGTTCAAGCAAAGATGCCAGCTAT
TCTGTTATCAATCAGTGAAGAAGATGTGACCGTAGCTCTAAAGATTGTCC
AAGGGAATCTCGCCGAAGGTGAGTCACATGCGCCGAAGAAGCAAGCCAAG
CCTGCCAAACAAACGTTAAACGTGCCACAAGATCGTTTAGCAGACATTTA
CGAGGAGcctgaagatgaagatgagaaTCGACAAGGATATCTTCAAACCA
AACTATCCTTCGATCTGGCTAAAATTGACATCAAGCTTTACTTGAAACCA
TCTGATATGACATTTGAAGATGAATTTTTAGCGAGGACGGATGATTTGTT
GTTAGCTTTGTTCACTATTGGTAACCTGTGTGTTGATGGAGACATCATGT
CCACGCAAGCTATGAAGATGAGCGTTCGATTGGACACTTTGGTGTTGGAT
GATATGAGACCTATCGAGGAGCATGAAGGTGTTAAACGTATGATCAACTA
CAGTCCCGAGCCACTCCTTGAAGAAGTCAAAACCTCTTCTCATAAACGAC
CAATCGACAACTCACGAATGATCGAAATCCAAttcgatcaaacttcatcg
caagataaaaatatcgacATCAAACTTTGTAACATGCTTTGTATATTCAA
CGTTGAGTTTATCATGGTCCTGTTGAAAACGTTGCAAGCTGCCATACCTA
AAGATGATAGTCTGCAACATGGCCATTCAATGAGTAGTCTAGACTCGGCG
GCAGGGTCTGGCGGCAGCGATGACGAGGACTCTTTAGAAGCCAGCGAGAT
TGTCCTCTGCACTGGTGATCAAGAAAGACCTGAGACTAAAGTCTCTATCT
TCGTCCATAACCCGCAAATTGTTTTACTAGCAGATGCAAAGGATGTCAAA
ACAAATGCACTCTTTCTTACAACCGagatcaattttcaatatttcgaaTT
GCGAGATACTCAAAAAATGATTGGCGCTGTTTCTAACACCGCTATTTTGT
CAACTGCTTTCAAGAATGACCATCGGAGTGATATATCAACAGTGTTGTCA
TTAGATTCCATCAATCTCCACTCGTCATCACCCATCAATGGTAAACCTCA
TATGAGTGTCAGCACAACTTTGATCAAACTGAATATCTCACCCAAAACCA
TCCGAACTTTATCAGCGTGTGCTGGTTACATCTCCAATGATCCAACAGAT
GAAGAAATCAAAGAAGCTCGAAAAGCCATGCGTGATTTATGGCAAATTCA
AACGTTCACCAATAAGCGACCGTGGTATTTAAACCACCCACCACAACAAG
TCTTAAGTGCTGGCAGCTTCGTCCTTGCGCGAACGAGAACAGGAGAATAT
AAGCATGGTTTCTTAGCTAAAAAGGATGTCTCGTATCAAGTCTATTTTTC
AGAGGAGCGAGGAACAGCCAGTCACCGAGCCATGGATATCTCATCTGTTG
TTTTGGATATCGTACCGCTGATCGGTGATCTATGTGTTGGATGTAATGTT
TTAGCTGTGGAATCGAAAGAACATGGATATCGTACTGGTCGAATTACTCA
GGTTTGGGATTCGAATGTGGATAAAGATTCTTCGGATGGCGCCAAACAAT
CTGTTTCTGTCAAGACAACTGCTATTGCTCCAATCAAATACCTTGTCAAT
TTCTATGACAACCAAACGGAGAACTTCTTCCCGCCTGATGAACTTCGTAT
CATTGGTAAACCCATCAAGGGGGTTGTCCCTGGACTAGGGGCGTGTGTTT
ACGCCCGCTTTAATGATGGTTTTTACTATCGGGGCAAAGTTGATGACATC
GAGGATTATCGAATCCGAGTGCAATTGGATGAGATCAGTGGAGAAATCGA
ACACGACATCGATGATCCGTCAGCCGTTATTTTGAACCTGACGCCTCAAT
ACCGTCAAGTCAAAAAGCATTTCAAAGTCATTGCATCCAAAGGAAGCACA
ACTAAAGGATATCATCCGGGGAAAGTGACCGCCATCCAAGGTGAAGGAAA
TAACCGATTGTATTCGATACGCTTCGAAGACGGTACAATTAACCAAGTAC
CCATCacgaaattgattttgatgccAAAAGCACCTTTTGATGCTTTACCT
GAAGTTGGCACATACGTTTATTCCCGAGTGTCACGCGACGCTCCTTTATA
CGAGAAGGGTATCGTAGCAGAGAAGAACACAATGATCTGCGTTAAACATT
TAAATGGACGGAAATTGGCTCACGAAATACAAAACATTCATTTTGTTGTC
CGAAATATCGTTCCTCTCGTGTCATCAttgaagGTTGGTTTGGACGTCAT
AGTGCAACCTGACAATGACGATCAGAAAATGTATTTGGCTGTCATTAGGG
AAGTCACCAAAAAAGAAGGTGACAAAACGAACCGTTATCTAGTGGAGTTT
ACGGATGGATCCAAGAAGAGAGTGACGCCCAGCCGGATCCGTATACTTTC
TCAATACGGAAGTGCAGAAACGAGTGAAGAAAATGCTGACATTATCACAA
CAAGACAGGAGGAACTAGTTCTCGATGTGCAAGGTATCTCATTACGTGTG
GAAGGTTACTTGGGAGGCGTGTTGACACCCATGCTCAAAATGGATTCCAA
AATCACAGCTAACTTGAAGGATTGGTCAAGCCAAATGAATGCACACGCTA
CTGTATCATTAGAAGCCAGTTATTATAACGAAAACGTTGCCGAATGGGAG
CCAGTTATTGAACCTTTGATGGAGAAACGGAGGGAAAGACCGTGGCAACT
CTCTGTCAATTACACGATGGAAGGTGACGACAATTCTGCTTCATCCACTT
CCAACGAACTCGTTTTACAAAAACCGGAATCCAACCTGAAAATCAAATCT
CAAGATAATCTTGAATTGACAATTTCAAAATCATGTCTTGCTTTACTCGG
TGAATTGGGACAGGTGTTTGGAGATGCAGTAGAATCTGTGGACGTTTTAC
CACAAGTCCTGGTCGAAAAAGAACCTTTCATGATCGAAAACTTGCTCTCC
AAGAAGGTGACAGTAACATTGAATGAACTTCTGCAGGGACCAAATGGAGA
TTCGACAATCGAGCTAGCATCTTCTTCGAATCCTGTTGGCATTACTTTTG
CTCCCAagaaatttgagaaacgaaAGACCAACGATCTATACACAATCAAT
TTAtcgGTGGACGGTTTTCATGACATTAAAGACATTGTGGTTCAAAGAAA
GCGAAGCGTTATCTATGATCTTGTACCAATAAAACTATTATCAGCACAGT
CTTCATATTCGATAGTGGTACAAGTGAAGACAACAGACGGACAACGTATC
ATCGTACTCCGATCACCATTGCAGTTGAAAAATCACTTTCCAATGCCGTT
GGATGTCAGCTACATTTCCAAAGAAAACCAACCAGTTAAACTGACAACAG
TGGGATCGGGAGATATCTATTCCTTCCCTTTGTTGTTAACCTACCACAGT
GTTTTTCATCTCAAACCTGCTGGTTTCGACTACGGTGATTGCACAGAAGC
TCTCAATTGGAGTGATTTGAAGACGAGCAACGAAAAACAGTTCTCCTGCC
CTTCACCTGACAAAAGTGCTGACCCTTTCTACATGCAGGTGGTGATGAAA
GAGGAGACGTACTCTTCCGTACACGGCATGTTGGACTGTGTACCACGTTA
CACGTTGGAGTGCTTTCCCGTCATCACGCTGCATAATTACCTACCTTGCA
CTATTAATTATAAGATCAAGGGTATGGCGAAATCGGAAAGTCTACCAGGC
GGACACAATTGGCCTTTGTTTACCGTCAACTTCAGTGATAAACCTTCCAT
CTATATCGAGATTGAGTCGTATAACAACCAAAGATGGGAAGGAGGTTTGA
CATTACCAACAAAACCGGTAGATTCTTTGAACAAACCATCATTATCTTTC
GTCATGATGTCTGGTGAACGCAAAATGGAATTGGGTGTTTATTACCAGTT
AGACGGTTCATTGAACATCACCTTATATTCGCCTTACTGGCTTCTCAATA
AAACTGGAAAACCACTTGTCTATCAGCCAGCGGGGAGCAGCATCCAGCAA
GTTCACCAAGAGAACGATGTAAATGCTCTTATGATGCTCGTCAAAGGGAA
ACATAAAAAGgcgaaagtgaaagtgaaaaataGCGAGTCATGGTCAAATG
AATTTTCATTGGATACTGTTGGCAGTGGTGGTTCCTTGAAATGCAATGGT
CCAAGAGATCGAGTTTATGAGATTGGTTTGAACATCAGTTTGTCATACTT
TGGATTGACGAAGATTGTGACGTTCACGCCACTCCGAATGTTATCTAACC
ACACCAAGTACACCATCAGTATGGCAGAAAGTAATTCTAAATCGTCAGAA
TGGCACACGGTAAACCCTGACGAGaacattccatTCTGGCCGACGAAACT
TCCTTTGGTCAACCTTTACATTAACATCAATGGGCAAGATTCAGTGAAAT
TCAACCCTGAAGTTGGAAAAACTTTACTGTTGAAGTTCCAGAATGAGGTT
GGAGGAGTTTGCGTGGATTACCAAGAAAAGGACTCGTCCTCAGTCCTTTC
GTTTAATCCGTACTTCGCAGGTGCAGCTCCTGTGCGGCttgaaaatcttt
gcaaaaaGATCGGCATGATCGCTTATAAACAAGCAGGTTCGGTAATGGGT
CACGTGTTAACACATGACCAATCAGTGTTGTACACGTGGGATGATCCAAC
CATGGAACAAGAATTGATTTGTTCCATTGTCAATGATGAAGCCAGTGAAA
CAAGGATCAAACTCGATGCCAACGATTTCGGACGAATGAGAGTTGGAGAT
GGTGCAATTTATTGGGTTTCCTTTCTGGATGGTCTTCAACGTGTTCTATT
GTTCACTGATAACTTCAAATCTGCTTACTGCGCATGTCAGgaGCAAAATT
TACGCCCAACCATGGAAGTTGACTTTGAGATTGAGAGTTTTGGTTTGTCT
CTGGTCAATGTTGATAAGAGAATGGAGATTGGCTACTTAGCTATCCGACA
AAGCAAGACTGTATGGGAGCAACGCAAGAAAAAGAACCGCTGGAAAGCTT
TACCGCTTGCCATGTGTGAAGCTCTCGAAGAAGGTTATCTCAATTATCAA
AACAGAAAAGGTGCAGTCAAAGAGAAAGTTCTGGATAAGGAGGTGGATTA
CGAGAAGATGTTTATTACGAAACCTGAGAAGATTAAGATCAGAAGAACGT
ACCACAGCGGTCTTGGTTTCAAATACACAATCTCACCCAATGAAATGCGT
GTGCATGCTTCTATCAGCTCAATACAGTTGGATAGCCATGTTCCAGGTTC
GACCTTTCCAACAGTCTTGCATATGGTTGAACCACCAAAATCTGTTGCTT
CAGAAAACGCTCCAAAGCCATTCTttgaattgagtttaatgaCAAGGATC
GGTGATAAAAATGTGGTCAATGAAGTcagCTATTGTCACGTGTTGATTCA
AGAGATGGATGTGAGGGTTGATATTGGATTTTTATTGGCTCTGATGGAAC
TCTTCAGTCATGCAAGAGCTCGAACAACCGAGAAAGAACAATACGCGCTT
GATATTGGCCAAGCAGCAACAAAGTTTGAAGAAAGCGCTGAATTTCAGGC
AGCCAAACAAGATCGATATTACGTTTTGAACGACTTTCATTTATCACCGC
TAAAGATTCACGTCAGTTTCTCTTTGACGGGTGGTTCCAAAGATGAAAAT
GCTATTGCTTCATTACATGGTAACGTGTTGAACTTGTTGTTACAAAGTGT
CGGACTGGCCTTCACTGAAATACAAGACGTACAATTCAAATTAGCATGTT
ACGAAGTGCATAAGTCCATGCAGAGTAATTCGCAGCTCGGTGATGGAATA
ACTAAACATTATCAAACACAGGCTATCAAGCAACTTTATGTGTTGGTACT
CGGGCTAGACGTTCTTGGTAATCCGTATGGTTTGATATCTGGTGTTGGAA
CCGGAGCAAAGAATTTCTTCTACGAACCTTACCAGGGATTAATTCAAGGA
CCAGAAGAATTTGCGGAAGGATTGGCGTATGGGGTGAAGAGTCTTGTTGG
TGGAACCGTGGGTGGAGTATCAGGAGCTGTGAGTAAGATTACCGGTACCT
TCGGTAAAGGTTTGGCTGCATTGACCTTGGATGAAGAATATCAACAAAAG
AGACGTGAAAACATGAGCCAACGCCCAACTAACCTCGGTGAAGGTCTCGC
CAAAGGTGGTAAAGGCCTTGTAAAGGGTATCGTGTCTGGTGTTACAGGGA
TCGTTACCAAACCCTATGAAGGTGCCAAGAATGATGGTGCAGGTGGCTTT
TTTAAGGGCGTTGGAAAAGGCCTGATTGGCGTGGTTGCACGCCCTGTTGG
TGGAGTGGTAGATATGGCCAGTAACACGTTTGATGGTTTGAAAAGCACGA
CATCTGGCGTGAAAGCGATCGAGTTGAGCCGTGTTACTCGCGTCTTCCAC
GCAGATAAGGTTTTACGACCTTTCAATCTGTACGAAGCAGATGGAAACAA
AATTCTTATGCAATGTAACAAAGGAGAATACGCCAAGAAGAATTTTTATA
TCACTCATGTAGTGGACAAGAAGAACTATCTCATCCTCACTCAATCaaac
ATTTTGTATGTTGGAAAGAACGAGTTGAAAATGGGTGAATGGGAATCggt
ttgggttatcgagttcaATGAGCTAAAACGTGAACCAGAAGTGAAAGAGA
CAAAGATTATTTTCCATATCCATAATACGGACACGCGACGTTCAATTTTC
AAGAAATCGACGAACACACGTGAAGTGATATTGGAGTCTAGTGCTGTTGC
AGACTGGTTTATCTTAAAGCTTAGAGATGCTAAAATGTTATAGatggtat
ttgaaTCTTTGGTTGCTGACCTCTTGAACAAGTATCTGGGTCAATATGTG
AAAAATCTTGATGCTTCTCAATTGAAGATTGGCATTTGGGGAGGAAATGT
TGTCCTGACAGAACTTGAACTGAAAGATACAGCTCTGGATGATCTTGACT
TACCCATAAAAGTTGTTCGTGGATATTTGGgtAAATTGGTCTTGTCCATC
CCATGGAAAAATCTTTACACTGAATCAACTGTTGTCGATATTCAAGATCT
CCACCTTGTCGCTAAGCCTAATTTTGACATCAAATACAATGAAGAACgcg
aagaaaaatcaaaacatgacAAGAAACAACAACAGATTCACAATATCGAA
GAAGCGAGGCAAAGAGAAGAAGACAAAAAGAAAGGCGCCAAGAAAGAAGA
GAGTGACGGTTTTGCTGAGAAACTTGCAACAAACGTCATAAAAAATCTAC
AGGTTACGATCAAGAACATACATGTTCGATATGAAGACTCAATCAGTGAT
GTGAATGGACCCTTTTCAGTCGGTCTTACAATGGAAAGTTTAACAGCACA
AACCACAGATGAAGATTTTGTTCCAAAGATTATCAAAGAATCTGTCTCAT
TAATTCATAAGatggTGAAATTAGACAATTTGGCTTTATATTGGAATCCA
GGAGACGAACTGATTGATCCTTCACTTGATACCAAGCAATGGTTGgaagt
TTCAACGAAGCAAATTTCAACACACCAATCGAAGCCAGAGAAAACGAAAT
ATATTTTGAGTCCCATGGTTGCAACGAAGAAATTGAAGCTGAACACCAAA
CCAGGTTCCAACCTTGACATCCCGAAGatgttTTTGAACTTGGTTTTGGA
AGAACTTGGTATCATCGTGGCAAGAAGTCAATATCATGGCGTGGTGCAAC
TGATTGAATCATTTGAACGAATGAATAGGAACCAACCTTTTCGTAAATAC
AGACCACATACCTCCGTTCTTGGGAACGAAAGTATTTGGTGGAAGTACTG
CATGTCCAGCATACTGGAGGTGGATGTCAAAAGACGATCTCAAATGTGGA
GCTGGAAGCATATTCAAAAACATCGAGTTCTTTGCAAAGCTTACAAAGTG
AAGTAcaaggaaaaattgaaacagaaaaATCCATCCAAACAAATTCTCAC
TGAACTAGAGaGCATGGAGGATGAGTTGAATATTGCAAGCATCACCATTT
TTCGACAGCTTGCAGCTACAGAGGTTTTAACGGAACAAAAGAAGAAAGGC
ACTAAAGGAAGTTTCTTCAGTTTCTTCTCCAGATCAAAAGAACCAGAAAA
GTCTGCTGCTAATAAAATTGGAGATTTAATGGGTGATGACCAGGAGAAGG
AAATGCAGAAATTGTATGACGCAATCGGTTATACTGAAAATGAAGTCATC
ACTCCCTTTCCTAAAGAGTACGTGGCGATGTCAGTGGAATCGATTCTCCA
GAAATTATTCATCAGCCTCATCGATGACACAGATAAGGCGAAAGAATTCA
AAGTGTTGGATTTTTCACTCAACAACATCATTGTAGAAGTTTTCCAAAGA
CCTTCTGCTCAAGCTCTCAAATTATGTGCAAAGATAGGAGAGATGAAGTT
ATTTGGTACAGCTTCTGCTCAATGTACACCTCtcatcatcaaaaacatgt
taCAAGGTCGAGGTATGGAATTTCTGCCGTTGGTGGACTTCATCTTTGAG
ACGAATCCTTTGAAGAAACCGGACATTGACCAATGTATCACTGCTATTTG
TCAACCCTTAGAAATCATCTATGATGCTAACACGATCAACCATATCATTA
GTTTCTTCAAACCTCCTGAACATGTTATCTTGCAAGATTTACAAGACAAA
GCGTATTCTACTTTCGAAGATTTTAAAGTTTCAAGTACGGCTGGTCTTCT
ACATGCTATGGAACAAAGAACGGTTATGGACATCGACATTGATGTTGGAG
CATCTCATTTGATCATCCCTGAAAAAGGTTCTTACAATGGTTGTACAGAT
ATGCTGGTGATCGACTTTGGTAAAATCACGATGAGCAGCGATCCTAGTCA
AATCAGACACCTTGACCCTAAGGACATTGAGGATGTGAATGAAGTACAAA
GCAAAGCTTATGATCGATTCTTGTTGTCGCTTCAAGCTCTTCAAATATTA
CTCGTTAGAGAAGGTGAAGATTTAAAGAGTGCTAAAAGCAACGTCAGTAA
AGCTTCATCACACATTTTGCATCCCATCAATTTCGATGGCAAACTTGCCA
AAGCTATACTTCCACAAGATCCACGTTTAAAACAGATATGTGTCTCTGGT
GAATTATCTTCGCTGTTTGTTTCTGTATCGGATGATAAAGTCAGTCGTCT
CATCAAGCTAGCAGACTCGATACCACTCCCTCAATCACCTTCTCACGATA
ACATCGACGGAGAAGAAAAACCTGAAGGACTCTTCACCAAGGCGTTGTCA
ATGATAAGCTTGACAGGTGACAATGACACAGGGGTGGACATCGGAGGATT
TTCCATCCCTGTACCGACATCTCCAACATCAGTGACGTCAGATGAAGATG
AATACGGGACACCACCTGATGGCTCCATATTACAGTTACAACAAGAAGCT
GGTCCGGACTTTTCATCAGGAGTGGCGAACCAAGTCAAAGTGGACTTGAA
CTTTAAAATCCATAAAGTGATGATCGCCATTGGTTTGACTGACAAAGCAT
TGAAACAGGAAAAAGAATGTCTGAAATTCATCGTGGACGACATCAATACA
GAGgtGATACTACGAAGATGGGATTTGTTCGTCAATGCAGAAGTTGGTCG
TCTGGTGTTGAATGAAATGACATGGGGTGTTGATGGAGAACCTTTCGCCA
TCATGAGTACacccaaaaacaccaaaatgttGAAATTCAGCTATCGGAGG
TGTGAATTCAACGAAAGTTTGAATCTCGGTCCAAGTTACTTTTATTCCAA
AGAAGCGCAAGTCAGAGCTTTACATTTCAAAGATGAATTTGGCGCCACGG
ATCAGATTTTAGATGTACAAGTGGCTACTTTATTTCTGATGCTTCATCAA
GAAGCACTTTTGAGCATCATGTCATTGATCTACCAAGTACTGGAACCACT
CAACAAACATGATAAGGAAGCCACACAGAAGATCAAACGGAGTTTGAGTA
CGGCAGGTAGTCGTTTGAGTCTCTCCatcgaagaaaaagaaaaggagaGA
CAGATACAACGAAAATTAGCCAACCCTAAAGCACTGGAAGCTGCCAACGA
ACTTAAGCAACAGGTTGGcttagaagaagaaaaaaagatgaGAGTGACCG
CCCACCTGGATGGTGTTGGTATCATGATTTGTTCAGCCAAAGTTGACCTT
GCACAAGCCTTCGTTAAAGGGTTATCTGCTAAAGTACTGATGAAAGATGA
CTTATTAGAAGTGAAAGCCAGCATGAAAGATATGCAAGTACAAGATAATG
TTGGCGAAACAAAGTACAAAGACATCATTAGCATGCGATCTGATGAAGTG
TTCGATTTAGAGTTGGCTATTTACGAGAATGGATCTTCTGGTAGCAAGCA
ATACGATATGTCGTGTGTCGACACCAGTGTCAAACTGAACTTCGGTCAAA
TGCGCGTTGTTTTCTTGTATAGATTCATACAAGACTTAATGTCATTCACC
GAAAACTTCGAAGAAGCACAGAAAGCAGTTGTGGAAGCTGGTAAAGCTGC
CAAGGATAAAGCTCTGGAAACAGCGACCGATTTGAATAGACATTCTTCTC
GTGTCAAACTAAATGTGGTTCTGAAAGCACCGACTATTATCATTCCAGTT
GGATCAAACAATGAATTGGCTTTACTGGTGGATCTGGGTGAATTGCGTAT
TTACAACACATTCAAACTCCTCAACGATGATCAATACCATAAGAAATCTA
TCATCACTGATAACATGACCATTAAGTTATCCAATCTGAAATTGTTAAAA
GCACTTATTCAAGATGGTAAAGATTTCTTGCATCAACGAGCCATTATTGA
ACCTATGATGCTACAAATAACTATTGTTCGTAATTTAACGAAAGGTAACC
ATTCCATACCGGATGTTTCAGTTCAAGCAAAGATGCCAGCTATTCTGTTA
TCAATCAGTGAAGAAGATGTGACCGTAGCTCTAAAGATTGTCCAAGGGAA
TCTCGCCGAAGGTGAGTCACATGCGCCGAAGAAGCAAGCCAAGCCTGCCA
AACAAACGTTAAACGTGCCACAAGATCGTTTAGCAGACATTTACGAGGAG
cctgaagatgaagatgagaaTCGACAAGGATATCTTCAAACCAAACTATC
CTTCGATCTGGCTAAAATTGACATCAAGCTTTACTTGAAACCATCTGATA
TGACATTTGAAGATGAATTTTTAGCGAGGACGGATGATTTGTTGTTAGCT
TTGTTCACTATTGGTAACCTGTGTGTTGATGGAGACATCATGTCCACGCA
AGCTATGAAGATGAGCGTTCGATTGGACACTTTGGTGTTGGATGATATGA
GACCTATCGAGGAGCATGAAGGTGTTAAACGTATGATCAACTACAGTCCC
GAGCCACTCCTTGAAGAAGTCAAAACCTCTTCTCATAAACGACCAATCGA
CAACTCACGAATGATCGAAATCCAAttcgatcaaacttcatcgcaagata
aaaatatcgacATCAAACTTTGTAACATGCTTTGTATATTCAACGTTGAG
TTTATCATGGTCCTGTTGAAAACGTTGCAAGCTGCCATACCTAAAGATGA
TAGTCTGCAACATGGCCATTCAATGAGTAGTCTAGACTCGGCGGCAGGGT
CTGGCGGCAGCGATGACGAGGACTCTTTAGAAGCCAGCGAGATTGTCCTC
TGCACTGGTGATCAAGAAAGACCTGAGACTAAAGTCTCTATCTTCGTCCA
TAACCCGCAAATTGTTTTACTAGCAGATGCAAAGGATGTCAAAACAAATG
CACTCTTTCTTACAACCGagatcaattttcaatatttcgaaTTGCGAGAT
ACTCAAAAAATGATTGGCGCTGTTTCTAACACCGCTATTTTGTCAACTGC
TTTCAAGAATGACCATCGGAGTGATATATCAACAGTGTTGTCATTAGATT
CCATCAATCTCCACTCGTCATCACCCATCAATGGTAAACCTCATATGAGT
GTCAGCACAACTTTGATCAAACTGAATATCTCACCCAAAACCATCCGAAC
TTTATCAGCGTGTGCTGGTTACATCTCCAATGATCCAACAGATGAAGAAA
TCAAAGAAGCTCGAAAAGCCATGCGTGATTTATGGCAAATTCAAACGTTC
ACCAATAAGCGACCGTGGTATTTAAACCACCCACCACAACAAGTCTTAAG
TGCTGGCAGCTTCGTCCTTGCGCGAACGAGAACAGGAGAATATAAGCATG
GTTTCTTAGCTAAAAAGGATGTCTCGTATCAAGTCTATTTTTCAGAGGAG
CGAGGAACAGCCAGTCACCGAGCCATGGATATCTCATCTGTTGTTTTGGA
TATCGTACCGCTGATCGGTGATCTATGTGTTGGATGTAATGTTTTAGCTG
TGGAATCGAAAGAACATGGATATCGTACTGGTCGAATTACTCAGGTTTGG
GATTCGAATGTGGATAAAGATTCTTCGGATGGCGCCAAACAATCTGTTTC
TGTCAAGACAACTGCTATTGCTCCAATCAAATACCTTGTCAATTTCTATG
ACAACCAAACGGAGAACTTCTTCCCGCCTGATGAACTTCGTATCATTGGT
AAACCCATCAAGGGGGTTGTCCCTGGACTAGGGGCGTGTGTTTACGCCCG
CTTTAATGATGGTTTTTACTATCGGGGCAAAGTTGATGACATCGAGGATT
ATCGAATCCGAGTGCAATTGGATGAGATCAGTGGAGAAATCGAACACGAC
ATCGATGATCCGTCAGCCGTTATTTTGAACCTGACGCCTCAATACCGTCA
AGTCAAAAAGCATTTCAAAGTCATTGCATCCAAAGGAAGCACAACTAAAG
GATATCATCCGGGGAAAGTGACCGCCATCCAAGGTGAAGGAAATAACCGA
TTGTATTCGATACGCTTCGAAGACGGTACAATTAACCAAGTACCCATCac
gaaattgattttgatgccAAAAGCACCTTTTGATGCTTTACCTGAAGTTG
GCACATACGTTTATTCCCGAGTGTCACGCGACGCTCCTTTATACGAGAAG
GGTATCGTAGCAGAGAAGAACACAATGATCTGCGTTAAACATTTAAATGG
ACGGAAATTGGCTCACGAAATACAAAACATTCATTTTGTTGTCCGAAATA
TCGTTCCTCTCGTGTCATCAttgaagGTTGGTTTGGACGTCATAGTGCAA
CCTGACAATGACGATCAGAAAATGTATTTGGCTGTCATTAGGGAAGTCAC
CAAAAAAGAAGGTGACAAAACGAACCGTTATCTAGTGGAGTTTACGGATG
GATCCAAGAAGAGAGTGACGCCCAGCCGGATCCGTATACTTTCTCAATAC
GGAAGTGCAGAAACGAGTGAAGAAAATGCTGACATTATCACAACAAGACA
GGAGGAACTAGTTCTCGATGTGCAAGGTATCTCATTACGTGTGGAAGGTT
ACTTGGGAGGCGTGTTGACACCCATGCTCAAAATGGATTCCAAAATCACA
GCTAACTTGAAGGATTGGTCAAGCCAAATGAATGCACACGCTACTGTATC
ATTAGAAGCCAGTTATTATAACGAAAACGTTGCCGAATGGGAGCCAGTTA
TTGAACCTTTGATGGAGAAACGGAGGGAAAGACCGTGGCAACTCTCTGTC
AATTACACGATGGAAGGTGACGACAATTCTGCTTCATCCACTTCCAACGA
ACTCGTTTTACAAAAACCGGAATCCAACCTGAAAATCAAATCTCAAGATA
ATCTTGAATTGACAATTTCAAAATCATGTCTTGCTTTACTCGGTGAATTG
GGACAGGTGTTTGGAGATGCAGTAGAATCTGTGGACGTTTTACCACAAGT
CCTGGTCGAAAAAGAACCTTTCATGATCGAAAACTTGCTCTCCAAGAAGG
TGACAGTAACATTGAATGAACTTCTGCAGGGACCAAATGGAGATTCGACA
ATCGAGCTAGCATCTTCTTCGAATCCTGTTGGCATTACTTTTGCTCCCAa
gaaatttgagaaacgaaAGACCAACGATCTATACACAATCAATTTAtcgG
TGGACGGTTTTCATGACATTAAAGACATTGTGGTTCAAAGAAAGCGAAGC
GTTATCTATGATCTTGTACCAATAAAACTATTATCAGCACAGTCTTCATA
TTCGATAGTGGTACAAGTGAAGACAACAGACGGACAACGTATCATCGTAC
TCCGATCACCATTGCAGTTGAAAAATCACTTTCCAATGCCGTTGGATGTC
AGCTACATTTCCAAAGAAAACCAACCAGTTAAACTGACAACAGTGGGATC
GGGAGATATCTATTCCTTCCCTTTGTTGTTAACCTACCACAGTGTTTTTC
ATCTCAAACCTGCTGGTTTCGACTACGGTGATTGCACAGAAGCTCTCAAT
TGGAGTGATTTGAAGACGAGCAACGAAAAACAGTTCTCCTGCCCTTCACC
TGACAAAAGTGCTGACCCTTTCTACATGCAGGTGGTGATGAAAGAGGAGA
CGTACTCTTCCGTACACGGCATGTTGGACTGTGTACCACGTTACACGTTG
GAGTGCTTTCCCGTCATCACGCTGCATAATTACCTACCTTGCACTATTAA
TTATAAGATCAAGGGTATGGCGAAATCGGAAAGTCTACCAGGCGGACACA
ATTGGCCTTTGTTTACCGTCAACTTCAGTGATAAACCTTCCATCTATATC
GAGATTGAGTCGTATAACAACCAAAGATGGGAAGGAGGTTTGACATTACC
AACAAAACCGGTAGATTCTTTGAACAAACCATCATTATCTTTCGTCATGA
TGTCTGGTGAACGCAAAATGGAATTGGGTGTTTATTACCAGTTAGACGGT
TCATTGAACATCACCTTATATTCGCCTTACTGGCTTCTCAATAAAACTGG
AAAACCACTTGTCTATCAGCCAGCGGGGAGCAGCATCCAGCAAGTTCACC
AAGAGAACGATGTAAATGCTCTTATGATGCTCGTCAAAGGGAAACATAAA
AAGgcgaaagtgaaagtgaaaaataGCGAGTCATGGTCAAATGAATTTTC
ATTGGATACTGTTGGCAGTGGTGGTTCCTTGAAATGCAATGGTCCAAGAG
ATCGAGTTTATGAGATTGGTTTGAACATCAGTTTGTCATACTTTGGATTG
ACGAAGATTGTGACGTTCACGCCACTCCGAATGTTATCTAACCACACCAA
GTACACCATCAGTATGGCAGAAAGTAATTCTAAATCGTCAGAATGGCACA
CGGTAAACCCTGACGAGaacattccatTCTGGCCGACGAAACTTCCTTTG
GTCAACCTTTACATTAACATCAATGGGCAAGATTCAGTGAAATTCAACCC
TGAAGTTGGAAAAACTTTACTGTTGAAGTTCCAGAATGAGGTTGGAGGAG
TTTGCGTGGATTACCAAGAAAAGGACTCGTCCTCAGTCCTTTCGTTTAAT
CCGTACTTCGCAGGTGCAGCTCCTGTGCGGCttgaaaatctttgcaaaaa
GATCGGCATGATCGCTTATAAACAAGCAGGTTCGGTAATGGGTCACGTGT
TAACACATGACCAATCAGTGTTGTACACGTGGGATGATCCAACCATGGAA
CAAGAATTGATTTGTTCCATTGTCAATGATGAAGCCAGTGAAACAAGGAT
CAAACTCGATGCCAACGATTTCGGACGAATGAGAGTTGGAGATGGTGCAA
TTTATTGGGTTTCCTTTCTGGATGGTCTTCAACGTGTTCTATTGTTCACT
GATAACTTCAAATCTGCTTACTGCGCATGTCAGgaGCAAAATTTACGCCC
AACCATGGAAGTTGACTTTGAGATTGAGAGTTTTGGTTTGTCTCTGGTCA
ATGTTGATAAGAGAATGGAGATTGGCTACTTAGCTATCCGACAAAGCAAG
ACTGTATGGGAGCAACGCAAGAAAAAGAACCGCTGGAAAGCTTTACCGCT
TGCCATGTGTGAAGCTCTCGAAGAAGGTTATCTCAATTATCAAAACAGAA
AAGGTGCAGTCAAAGAGAAAGTTCTGGATAAGGAGGTGGATTACGAGAAG
ATGTTTATTACGAAACCTGAGAAGATTAAGATCAGAAGAACGTACCACAG
CGGTCTTGGTTTCAAATACACAATCTCACCCAATGAAATGCGTGTGCATG
CTTCTATCAGCTCAATACAGTTGGATAGCCATGTTCCAGGTTCGACCTTT
CCAACAGTCTTGCATATGGTTGAACCACCAAAATCTGTTGCTTCAGAAAA
CGCTCCAAAGCCATTCTttgaattgagtttaatgaCAAGGATCGGTGATA
AAAATGTGGTCAATGAAGTcagCTATTGTCACGTGTTGATTCAAGAGATG
GATGTGAGGGTTGATATTGGATTTTTATTGGCTCTGATGGAACTCTTCAG
TCATGCAAGAGCTCGAACAACCGAGAAAGAACAATACGCGCTTGATATTG
GCCAAGCAGCAACAAAGTTTGAAGAAAGCGCTGAATTTCAGGCAGCCAAA
CAAGATCGATATTACGTTTTGAACGACTTTCATTTATCACCGCTAAAGAT
TCACGTCAGTTTCTCTTTGACGGGTGGTTCCAAAGATGAAAATGCTATTG
CTTCATTACATGGTAACGTGTTGAACTTGTTGTTACAAAGTGTCGGACTG
GCCTTCACTGAAATACAAGACGTACAATTCAAATTAGCATGTTACGAAGT
GCATAAGTCCATGCAGAGTAATTCGCAGCTCGGTGATGGAATAACTAAAC
ATTATCAAACACAGGCTATCAAGCAACTTTATGTGTTGGTACTCGGGCTA
GACGTTCTTGGTAATCCGTATGGTTTGATATCTGGTGTTGGAACCGGAGC
AAAGAATTTCTTCTACGAACCTTACCAGGGATTAATTCAAGGACCAGAAG
AATTTGCGGAAGGATTGGCGTATGGGGTGAAGAGTCTTGTTGGTGGAACC
GTGGGTGGAGTATCAGGAGCTGTGAGTAAGATTACCGGTACCTTCGGTAA
AGGTTTGGCTGCATTGACCTTGGATGAAGAATATCAACAAAAGAGACGTG
AAAACATGAGCCAACGCCCAACTAACCTCGGTGAAGGTCTCGCCAAAGGT
GGTAAAGGCCTTGTAAAGGGTATCGTGTCTGGTGTTACAGGGATCGTTAC
CAAACCCTATGAAGGTGCCAAGAATGATGGTGCAGGTGGCTTTTTTAAGG
GCGTTGGAAAAGGCCTGATTGGCGTGGTTGCACGCCCTGTTGGTGGAGTG
GTAGATATGGCCAGTAACACGTTTGATGGTTTGAAAAGCACGACATCTGG
CGTGAAAGCGATCGAGTTGAGCCGTGTTACTCGCGTCTTCCACGCAGATA
AGGTTTTACGACCTTTCAATCTGTACGAAGCAGATGGAAACAAAATTCTT
ATGCAATGTAACAAAGGAGAATACGCCAAGAAGAATTTTTATATCACTCA
TGTAGTGGACAAGAAGAACTATCTCATCCTCACTCAATCaaacATTTTGT
ATGTTGGAAAGAACGAGTTGAAAATGGGTGAATGGGAATCggtttgggtt
atcgagttcaATGAGCTAAAACGTGAACCAGAAGTGAAAGAGACAAAGAT
TATTTTCCATATCCATAATACGGACACGCGACGTTCAATTTTCAAGAAAT
CGACGAACACACGTGAAGTGATATTGGAGTCTAGTGCTGTTGCAGACTGG
TTTATCTTAAAGCTTAGAGATGCTAAAATGTTATAGatggtatttgaaTC
TTTGGTTGCTGACCTCTTGAACAAGTATCTGGGTCAATATGTGAAAAATC
TTGATGCTTCTCAATTGAAGATTGGCATTTGGGGAGGAAATGTTGTCCTG
ACAGAACTTGAACTGAAAGATACAGCTCTGGATGATCTTGACTTACCCAT
AAAAGTTGTTCGTGGATATTTGGgtAAATTGGTCTTGTCCATCCCATGGA
AAAATCTTTACACTGAATCAACTGTTGTCGATATTCAAGATCTCCACCTT
GTCGCTAAGCCTAATTTTGACATCAAATACAATGAAGAACgcgaagaaaa
atcaaaacatgacAAGAAACAACAACAGATTCACAATATCGAAGAAGCGA
GGCAAAGAGAAGAAGACAAAAAGAAAGGCGCCAAGAAAGAAGAGAGTGAC
GGTTTTGCTGAGAAACTTGCAACAAACGTCATAAAAAATCTACAGGTTAC
GATCAAGAACATACATGTTCGATATGAAGACTCAATCAGTGATGTGAATG
GACCCTTTTCAGTCGGTCTTACAATGGAAAGTTTAACAGCACAAACCACA
GATGAAGATTTTGTTCCAAAGATTATCAAAGAATCTGTCTCATTAATTCA
TAAGatggTGAAATTAGACAATTTGGCTTTATATTGGAATCCAGGAGACG
AACTGATTGATCCTTCACTTGATACCAAGCAATGGTTGgaagtTTCAACG
AAGCAAATTTCAACACACCAATCGAAGCCAGAGAAAACGAAATATATTTT
GAGTCCCATGGTTGCAACGAAGAAATTGAAGCTGAACACCAAACCAGGTT
CCAACCTTGACATCCCGAAGatgttTTTGAACTTGGTTTTGGAAGAACTT
GGTATCATCGTGGCAAGAAGTCAATATCATGGCGTGGTGCAACTGATTGA
ATCATTTGAACGAATGAATAGGAACCAACCTTTTCGTAAATACAGACCAC
ATACCTCCGTTCTTGGGAACGAAAGTATTTGGTGGAAGTACTGCATGTCC
AGCATACTGGAGGTGGATGTCAAAAGACGATCTCAAATGTGGAGCTGGAA
GCATATTCAAAAACATCGAGTTCTTTGCAAAGCTTACAAAGTGAAGTAca
aggaaaaattgaaacagaaaaATCCATCCAAACAAATTCTCACTGAACTA
GAGaGCATGGAGGATGAGTTGAATATTGCAAGCATCACCATTTTTCGACA
GCTTGCAGCTACAGAGGTTTTAACGGAACAAAAGAAGAAAGGCACTAAAG
GAAGTTTCTTCAGTTTCTTCTCCAGATCAAAAGAACCAGAAAAGTCTGCT
GCTAATAAAATTGGAGATTTAATGGGTGATGACCAGGAGAAGGAAATGCA
GAAATTGTATGACGCAATCGGTTATACTGAAAATGAAGTCATCACTCCCT
TTCCTAAAGAGTACGTGGCGATGTCAGTGGAATCGATTCTCCAGAAATTA
TTCATCAGCCTCATCGATGACACAGATAAGGCGAAAGAATTCAAAGTGTT
GGATTTTTCACTCAACAACATCATTGTAGAAGTTTTCCAAAGACCTTCTG
CTCAAGCTCTCAAATTATGTGCAAAGATAGGAGAGATGAAGTTATTTGGT
ACAGCTTCTGCTCAATGTACACCTCtcatcatcaaaaacatgttaCAAGG
TCGAGGTATGGAATTTCTGCCGTTGGTGGACTTCATCTTTGAGACGAATC
CTTTGAAGAAACCGGACATTGACCAATGTATCACTGCTATTTGTCAACCC
TTAGAAATCATCTATGATGCTAACACGATCAACCATATCATTAGTTTCTT
CAAACCTCCTGAACATGTTATCTTGCAAGATTTACAAGACAAAGCGTATT
CTACTTTCGAAGATTTTAAAGTTTCAAGTACGGCTGGTCTTCTACATGCT
ATGGAACAAAGAACGGTTATGGACATCGACATTGATGTTGGAGCATCTCA
TTTGATCATCCCTGAAAAAGGTTCTTACAATGGTTGTACAGATATGCTGG
TGATCGACTTTGGTAAAATCACGATGAGCAGCGATCCTAGTCAAATCAGA
CACCTTGACCCTAAGGACATTGAGGATGTGAATGAAGTACAAAGCAAAGC
TTATGATCGATTCTTGTTGTCGCTTCAAGCTCTTCAAATATTACTCGTTA
GAGAAGGTGAAGATTTAAAGAGTGCTAAAAGCAACGTCAGTAAAGCTTCA
TCACACATTTTGCATCCCATCAATTTCGATGGCAAACTTGCCAAAGCTAT
ACTTCCACAAGATCCACGTTTAAAACAGATATGTGTCTCTGGTGAATTAT
CTTCGCTGTTTGTTTCTGTATCGGATGATAAAGTCAGTCGTCTCATCAAG
CTAGCAGACTCGATACCACTCCCTCAATCACCTTCTCACGATAACATCGA
CGGAGAAGAAAAACCTGAAGGACTCTTCACCAAGGCGTTGTCAATGATAA
GCTTGACAGGTGACAATGACACAGGGGTGGACATCGGAGGATTTTCCATC
CCTGTACCGACATCTCCAACATCAGTGACGTCAGATGAAGATGAATACGG
GACACCACCTGATGGCTCCATATTACAGTTACAACAAGAAGCTGGTCCGG
ACTTTTCATCAGGAGTGGCGAACCAAGTCAAAGTGGACTTGAACTTTAAA
ATCCATAAAGTGATGATCGCCATTGGTTTGACTGACAAAGCATTGAAACA
GGAAAAAGAATGTCTGAAATTCATCGTGGACGACATCAATACAGAGgtGA
TACTACGAAGATGGGATTTGTTCGTCAATGCAGAAGTTGGTCGTCTGGTG
TTGAATGAAATGACATGGGGTGTTGATGGAGAACCTTTCGCCATCATGAG
TACacccaaaaacaccaaaatgttGAAATTCAGCTATCGGAGGTGTGAAT
TCAACGAAAGTTTGAATCTCGGTCCAAGTTACTTTTATTCCAAAGAAGCG
CAAGTCAGAGCTTTACATTTCAAAGATGAATTTGGCGCCACGGATCAGAT
TTTAGATGTACAAGTGGCTACTTTATTTCTGATGCTTCATCAAGAAGCAC
TTTTGAGCATCATGTCATTGATCTACCAAGTACTGGAACCACTCAACAAA
CATGATAAGGAAGCCACACAGAAGATCAAACGGAGTTTGAGTACGGCAGG
TAGTCGTTTGAGTCTCTCCatcgaagaaaaagaaaaggagaGACAGATAC
AACGAAAATTAGCCAACCCTAAAGCACTGGAAGCTGCCAACGAACTTAAG
CAACAGGTTGGcttagaagaagaaaaaaagatgaGAGTGACCGCCCACCT
GGATGGTGTTGGTATCATGATTTGTTCAGCCAAAGTTGACCTTGCACAAG
CCTTCGTTAAAGGGTTATCTGCTAAAGTACTGATGAAAGATGACTTATTA
GAAGTGAAAGCCAGCATGAAAGATATGCAAGTACAAGATAATGTTGGCGA
AACAAAGTACAAAGACATCATTAGCATGCGATCTGATGAAGTGTTCGATT
TAGAGTTGGCTATTTACGAGAATGGATCTTCTGGTAGCAAGCAATACGAT
ATGTCGTGTGTCGACACCAGTGTCAAACTGAACTTCGGTCAAATGCGCGT
TGTTTTCTTGTATAGATTCATACAAGACTTAATGTCATTCACCGAAAACT
TCGAAGAAGCACAGAAAGCAGTTGTGGAAGCTGGTAAAGCTGCCAAGGAT
AAAGCTCTGGAAACAGCGACCGATTTGAATAGACATTCTTCTCGTGTCAA
ACTAAATGTGGTTCTGAAAGCACCGACTATTATCATTCCAGTTGGATCAA
ACAATGAATTGGCTTTACTGGTGGATCTGGGTGAATTGCGTATTTACAAC
ACATTCAAACTCCTCAACGATGATCAATACCATAAGAAATCTATCATCAC
TGATAACATGACCATTAAGTTATCCAATCTGAAATTGTTAAAAGCACTTA
TTCAAGATGGTAAAGATTTCTTGCATCAACGAGCCATTATTGAACCTATG
ATGCTACAAATAACTATTGTTCGTAATTTAACGAAAGGTAACCATTCCAT
ACCGGATGTTTCAGTTCAAGCAAAGATGCCAGCTATTCTGTTATCAATCA
GTGAAGAAGATGTGACCGTAGCTCTAAAGATTGTCCAAGGGAATCTCGCC
GAAGGTGAGTCACATGCGCCGAAGAAGCAAGCCAAGCCTGCCAAACAAAC
GTTAAACGTGCCACAAGATCGTTTAGCAGACATTTACGAGGAGcctgaag
atgaagatgagaaTCGACAAGGATATCTTCAAACCAAACTATCCTTCGAT
CTGGCTAAAATTGACATCAAGCTTTACTTGAAACCATCTGATATGACATT
TGAAGATGAATTTTTAGCGAGGACGGATGATTTGTTGTTAGCTTTGTTCA
CTATTGGTAACCTGTGTGTTGATGGAGACATCATGTCCACGCAAGCTATG
AAGATGAGCGTTCGATTGGACACTTTGGTGTTGGATGATATGAGACCTAT
CGAGGAGCATGAAGGTGTTAAACGTATGATCAACTACAGTCCCGAGCCAC
TCCTTGAAGAAGTCAAAACCTCTTCTCATAAACGACCAATCGACAACTCA
CGAATGATCGAAATCCAAttcgatcaaacttcatcgcaagataaaaatat
cgacATCAAACTTTGTAACATGCTTTGTATATTCAACGTTGAGTTTATCA
TGGTCCTGTTGAAAACGTTGCAAGCTGCCATACCTAAAGATGATAGTCTG
CAACATGGCCATTCAATGAGTAGTCTAGACTCGGCGGCAGGGTCTGGCGG
CAGCGATGACGAGGACTCTTTAGAAGCCAGCGAGATTGTCCTCTGCACTG
GTGATCAAGAAAGACCTGAGACTAAAGTCTCTATCTTCGTCCATAACCCG
CAAATTGTTTTACTAGCAGATGCAAAGGATGTCAAAACAAATGCACTCTT
TCTTACAACCGagatcaattttcaatatttcgaaTTGCGAGATACTCAAA
AAATGATTGGCGCTGTTTCTAACACCGCTATTTTGTCAACTGCTTTCAAG
AATGACCATCGGAGTGATATATCAACAGTGTTGTCATTAGATTCCATCAA
TCTCCACTCGTCATCACCCATCAATGGTAAACCTCATATGAGTGTCAGCA
CAACTTTGATCAAACTGAATATCTCACCCAAAACCATCCGAACTTTATCA
GCGTGTGCTGGTTACATCTCCAATGATCCAACAGATGAAGAAATCAAAGA
AGCTCGAAAAGCCATGCGTGATTTATGGCAAATTCAAACGTTCACCAATA
AGCGACCGTGGTATTTAAACCACCCACCACAACAAGTCTTAAGTGCTGGC
AGCTTCGTCCTTGCGCGAACGAGAACAGGAGAATATAAGCATGGTTTCTT
AGCTAAAAAGGATGTCTCGTATCAAGTCTATTTTTCAGAGGAGCGAGGAA
CAGCCAGTCACCGAGCCATGGATATCTCATCTGTTGTTTTGGATATCGTA
CCGCTGATCGGTGATCTATGTGTTGGATGTAATGTTTTAGCTGTGGAATC
GAAAGAACATGGATATCGTACTGGTCGAATTACTCAGGTTTGGGATTCGA
ATGTGGATAAAGATTCTTCGGATGGCGCCAAACAATCTGTTTCTGTCAAG
ACAACTGCTATTGCTCCAATCAAATACCTTGTCAATTTCTATGACAACCA
AACGGAGAACTTCTTCCCGCCTGATGAACTTCGTATCATTGGTAAACCCA
TCAAGGGGGTTGTCCCTGGACTAGGGGCGTGTGTTTACGCCCGCTTTAAT
GATGGTTTTTACTATCGGGGCAAAGTTGATGACATCGAGGATTATCGAAT
CCGAGTGCAATTGGATGAGATCAGTGGAGAAATCGAACACGACATCGATG
ATCCGTCAGCCGTTATTTTGAACCTGACGCCTCAATACCGTCAAGTCAAA
AAGCATTTCAAAGTCATTGCATCCAAAGGAAGCACAACTAAAGGATATCA
TCCGGGGAAAGTGACCGCCATCCAAGGTGAAGGAAATAACCGATTGTATT
CGATACGCTTCGAAGACGGTACAATTAACCAAGTACCCATCacgaaattg
attttgatgccAAAAGCACCTTTTGATGCTTTACCTGAAGTTGGCACATA
CGTTTATTCCCGAGTGTCACGCGACGCTCCTTTATACGAGAAGGGTATCG
TAGCAGAGAAGAACACAATGATCTGCGTTAAACATTTAAATGGACGGAAA
TTGGCTCACGAAATACAAAACATTCATTTTGTTGTCCGAAATATCGTTCC
TCTCGTGTCATCAttgaagGTTGGTTTGGACGTCATAGTGCAACCTGACA
ATGACGATCAGAAAATGTATTTGGCTGTCATTAGGGAAGTCACCAAAAAA
GAAGGTGACAAAACGAACCGTTATCTAGTGGAGTTTACGGATGGATCCAA
GAAGAGAGTGACGCCCAGCCGGATCCGTATACTTTCTCAATACGGAAGTG
CAGAAACGAGTGAAGAAAATGCTGACATTATCACAACAAGACAGGAGGAA
CTAGTTCTCGATGTGCAAGGTATCTCATTACGTGTGGAAGGTTACTTGGG
AGGCGTGTTGACACCCATGCTCAAAATGGATTCCAAAATCACAGCTAACT
TGAAGGATTGGTCAAGCCAAATGAATGCACACGCTACTGTATCATTAGAA
GCCAGTTATTATAACGAAAACGTTGCCGAATGGGAGCCAGTTATTGAACC
TTTGATGGAGAAACGGAGGGAAAGACCGTGGCAACTCTCTGTCAATTACA
CGATGGAAGGTGACGACAATTCTGCTTCATCCACTTCCAACGAACTCGTT
TTACAAAAACCGGAATCCAACCTGAAAATCAAATCTCAAGATAATCTTGA
ATTGACAATTTCAAAATCATGTCTTGCTTTACTCGGTGAATTGGGACAGG
TGTTTGGAGATGCAGTAGAATCTGTGGACGTTTTACCACAAGTCCTGGTC
GAAAAAGAACCTTTCATGATCGAAAACTTGCTCTCCAAGAAGGTGACAGT
AACATTGAATGAACTTCTGCAGGGACCAAATGGAGATTCGACAATCGAGC
TAGCATCTTCTTCGAATCCTGTTGGCATTACTTTTGCTCCCAagaaattt
gagaaacgaaAGACCAACGATCTATACACAATCAATTTAtcgGTGGACGG
TTTTCATGACATTAAAGACATTGTGGTTCAAAGAAAGCGAAGCGTTATCT
ATGATCTTGTACCAATAAAACTATTATCAGCACAGTCTTCATATTCGATA
GTGGTACAAGTGAAGACAACAGACGGACAACGTATCATCGTACTCCGATC
ACCATTGCAGTTGAAAAATCACTTTCCAATGCCGTTGGATGTCAGCTACA
TTTCCAAAGAAAACCAACCAGTTAAACTGACAACAGTGGGATCGGGAGAT
ATCTATTCCTTCCCTTTGTTGTTAACCTACCACAGTGTTTTTCATCTCAA
ACCTGCTGGTTTCGACTACGGTGATTGCACAGAAGCTCTCAATTGGAGTG
ATTTGAAGACGAGCAACGAAAAACAGTTCTCCTGCCCTTCACCTGACAAA
AGTGCTGACCCTTTCTACATGCAGGTGGTGATGAAAGAGGAGACGTACTC
TTCCGTACACGGCATGTTGGACTGTGTACCACGTTACACGTTGGAGTGCT
TTCCCGTCATCACGCTGCATAATTACCTACCTTGCACTATTAATTATAAG
ATCAAGGGTATGGCGAAATCGGAAAGTCTACCAGGCGGACACAATTGGCC
TTTGTTTACCGTCAACTTCAGTGATAAACCTTCCATCTATATCGAGATTG
AGTCGTATAACAACCAAAGATGGGAAGGAGGTTTGACATTACCAACAAAA
CCGGTAGATTCTTTGAACAAACCATCATTATCTTTCGTCATGATGTCTGG
TGAACGCAAAATGGAATTGGGTGTTTATTACCAGTTAGACGGTTCATTGA
ACATCACCTTATATTCGCCTTACTGGCTTCTCAATAAAACTGGAAAACCA
CTTGTCTATCAGCCAGCGGGGAGCAGCATCCAGCAAGTTCACCAAGAGAA
CGATGTAAATGCTCTTATGATGCTCGTCAAAGGGAAACATAAAAAGgcga
aagtgaaagtgaaaaataGCGAGTCATGGTCAAATGAATTTTCATTGGAT
ACTGTTGGCAGTGGTGGTTCCTTGAAATGCAATGGTCCAAGAGATCGAGT
TTATGAGATTGGTTTGAACATCAGTTTGTCATACTTTGGATTGACGAAGA
TTGTGACGTTCACGCCACTCCGAATGTTATCTAACCACACCAAGTACACC
ATCAGTATGGCAGAAAGTAATTCTAAATCGTCAGAATGGCACACGGTAAA
CCCTGACGAGaacattccatTCTGGCCGACGAAACTTCCTTTGGTCAACC
TTTACATTAACATCAATGGGCAAGATTCAGTGAAATTCAACCCTGAAGTT
GGAAAAACTTTACTGTTGAAGTTCCAGAATGAGGTTGGAGGAGTTTGCGT
GGATTACCAAGAAAAGGACTCGTCCTCAGTCCTTTCGTTTAATCCGTACT
TCGCAGGTGCAGCTCCTGTGCGGCttgaaaatctttgcaaaaaGATCGGC
ATGATCGCTTATAAACAAGCAGGTTCGGTAATGGGTCACGTGTTAACACA
TGACCAATCAGTGTTGTACACGTGGGATGATCCAACCATGGAACAAGAAT
TGATTTGTTCCATTGTCAATGATGAAGCCAGTGAAACAAGGATCAAACTC
GATGCCAACGATTTCGGACGAATGAGAGTTGGAGATGGTGCAATTTATTG
GGTTTCCTTTCTGGATGGTCTTCAACGTGTTCTATTGTTCACTGATAACT
TCAAATCTGCTTACTGCGCATGTCAGgaGCAAAATTTACGCCCAACCATG
GAAGTTGACTTTGAGATTGAGAGTTTTGGTTTGTCTCTGGTCAATGTTGA
TAAGAGAATGGAGATTGGCTACTTAGCTATCCGACAAAGCAAGACTGTAT
GGGAGCAACGCAAGAAAAAGAACCGCTGGAAAGCTTTACCGCTTGCCATG
TGTGAAGCTCTCGAAGAAGGTTATCTCAATTATCAAAACAGAAAAGGTGC
AGTCAAAGAGAAAGTTCTGGATAAGGAGGTGGATTACGAGAAGATGTTTA
TTACGAAACCTGAGAAGATTAAGATCAGAAGAACGTACCACAGCGGTCTT
GGTTTCAAATACACAATCTCACCCAATGAAATGCGTGTGCATGCTTCTAT
CAGCTCAATACAGTTGGATAGCCATGTTCCAGGTTCGACCTTTCCAACAG
TCTTGCATATGGTTGAACCACCAAAATCTGTTGCTTCAGAAAACGCTCCA
AAGCCATTCTttgaattgagtttaatgaCAAGGATCGGTGATAAAAATGT
GGTCAATGAAGTcagCTATTGTCACGTGTTGATTCAAGAGATGGATGTGA
GGGTTGATATTGGATTTTTATTGGCTCTGATGGAACTCTTCAGTCATGCA
AGAGCTCGAACAACCGAGAAAGAACAATACGCGCTTGATATTGGCCAAGC
AGCAACAAAGTTTGAAGAAAGCGCTGAATTTCAGGCAGCCAAACAAGATC
GATATTACGTTTTGAACGACTTTCATTTATCACCGCTAAAGATTCACGTC
AGTTTCTCTTTGACGGGTGGTTCCAAAGATGAAAATGCTATTGCTTCATT
ACATGGTAACGTGTTGAACTTGTTGTTACAAAGTGTCGGACTGGCCTTCA
CTGAAATACAAGACGTACAATTCAAATTAGCATGTTACGAAGTGCATAAG
TCCATGCAGAGTAATTCGCAGCTCGGTGATGGAATAACTAAACATTATCA
AACACAGGCTATCAAGCAACTTTATGTGTTGGTACTCGGGCTAGACGTTC
TTGGTAATCCGTATGGTTTGATATCTGGTGTTGGAACCGGAGCAAAGAAT
TTCTTCTACGAACCTTACCAGGGATTAATTCAAGGACCAGAAGAATTTGC
GGAAGGATTGGCGTATGGGGTGAAGAGTCTTGTTGGTGGAACCGTGGGTG
GAGTATCAGGAGCTGTGAGTAAGATTACCGGTACCTTCGGTAAAGGTTTG
GCTGCATTGACCTTGGATGAAGAATATCAACAAAAGAGACGTGAAAACAT
GAGCCAACGCCCAACTAACCTCGGTGAAGGTCTCGCCAAAGGTGGTAAAG
GCCTTGTAAAGGGTATCGTGTCTGGTGTTACAGGGATCGTTACCAAACCC
TATGAAGGTGCCAAGAATGATGGTGCAGGTGGCTTTTTTAAGGGCGTTGG
AAAAGGCCTGATTGGCGTGGTTGCACGCCCTGTTGGTGGAGTGGTAGATA
TGGCCAGTAACACGTTTGATGGTTTGAAAAGCACGACATCTGGCGTGAAA
GCGATCGAGTTGAGCCGTGTTACTCGCGTCTTCCACGCAGATAAGGTTTT
ACGACCTTTCAATCTGTACGAAGCAGATGGAAACAAAATTCTTATGCAAT
GTAACAAAGGAGAATACGCCAAGAAGAATTTTTATATCACTCATGTAGTG
GACAAGAAGAACTATCTCATCCTCACTCAATCaaacATTTTGTATGTTGG
AAAGAACGAGTTGAAAATGGGTGAATGGGAATCggtttgggttatcgagt
tcaATGAGCTAAAACGTGAACCAGAAGTGAAAGAGACAAAGATTATTTTC
CATATCCATAATACGGACACGCGACGTTCAATTTTCAAGAAATCGACGAA
CACACGTGAAGTGATATTGGAGTCTAGTGCTGTTGCAGACTGGTTTATCT
TAAAGCTTAGAGATGCTAAAATGTTATAGatggtatttgaaTCTTTGGTT
GCTGACCTCTTGAACAAGTATCTGGGTCAATATGTGAAAAATCTTGATGC
TTCTCAATTGAAGATTGGCATTTGGGGAGGAAATGTTGTCCTGACAGAAC
TTGAACTGAAAGATACAGCTCTGGATGATCTTGACTTACCCATAAAAGTT
GTTCGTGGATATTTGGgtAAATTGGTCTTGTCCATCCCATGGAAAAATCT
TTACACTGAATCAACTGTTGTCGATATTCAAGATCTCCACCTTGTCGCTA
AGCCTAATTTTGACATCAAATACAATGAAGAACgcgaagaaaaatcaaaa
catgacAAGAAACAACAACAGATTCACAATATCGAAGAAGCGAGGCAAAG
AGAAGAAGACAAAAAGAAAGGCGCCAAGAAAGAAGAGAGTGACGGTTTTG
CTGAGAAACTTGCAACAAACGTCATAAAAAATCTACAGGTTACGATCAAG
AACATACATGTTCGATATGAAGACTCAATCAGTGATGTGAATGGACCCTT
TTCAGTCGGTCTTACAATGGAAAGTTTAACAGCACAAACCACAGATGAAG
ATTTTGTTCCAAAGATTATCAAAGAATCTGTCTCATTAATTCATAAGatg
gTGAAATTAGACAATTTGGCTTTATATTGGAATCCAGGAGACGAACTGAT
TGATCCTTCACTTGATACCAAGCAATGGTTGgaagtTTCAACGAAGCAAA
TTTCAACACACCAATCGAAGCCAGAGAAAACGAAATATATTTTGAGTCCC
ATGGTTGCAACGAAGAAATTGAAGCTGAACACCAAACCAGGTTCCAACCT
TGACATCCCGAAGatgttTTTGAACTTGGTTTTGGAAGAACTTGGTATCA
TCGTGGCAAGAAGTCAATATCATGGCGTGGTGCAACTGATTGAATCATTT
GAACGAATGAATAGGAACCAACCTTTTCGTAAATACAGACCACATACCTC
CGTTCTTGGGAACGAAAGTATTTGGTGGAAGTACTGCATGTCCAGCATAC
TGGAGGTGGATGTCAAAAGACGATCTCAAATGTGGAGCTGGAAGCATATT
CAAAAACATCGAGTTCTTTGCAAAGCTTACAAAGTGAAGTAcaaggaaaa
attgaaacagaaaaATCCATCCAAACAAATTCTCACTGAACTAGAGaGCA
TGGAGGATGAGTTGAATATTGCAAGCATCACCATTTTTCGACAGCTTGCA
GCTACAGAGGTTTTAACGGAACAAAAGAAGAAAGGCACTAAAGGAAGTTT
CTTCAGTTTCTTCTCCAGATCAAAAGAACCAGAAAAGTCTGCTGCTAATA
AAATTGGAGATTTAATGGGTGATGACCAGGAGAAGGAAATGCAGAAATTG
TATGACGCAATCGGTTATACTGAAAATGAAGTCATCACTCCCTTTCCTAA
AGAGTACGTGGCGATGTCAGTGGAATCGATTCTCCAGAAATTATTCATCA
GCCTCATCGATGACACAGATAAGGCGAAAGAATTCAAAGTGTTGGATTTT
TCACTCAACAACATCATTGTAGAAGTTTTCCAAAGACCTTCTGCTCAAGC
TCTCAAATTATGTGCAAAGATAGGAGAGATGAAGTTATTTGGTACAGCTT
CTGCTCAATGTACACCTCtcatcatcaaaaacatgttaCAAGGTCGAGGT
ATGGAATTTCTGCCGTTGGTGGACTTCATCTTTGAGACGAATCCTTTGAA
GAAACCGGACATTGACCAATGTATCACTGCTATTTGTCAACCCTTAGAAA
TCATCTATGATGCTAACACGATCAACCATATCATTAGTTTCTTCAAACCT
CCTGAACATGTTATCTTGCAAGATTTACAAGACAAAGCGTATTCTACTTT
CGAAGATTTTAAAGTTTCAAGTACGGCTGGTCTTCTACATGCTATGGAAC
AAAGAACGGTTATGGACATCGACATTGATGTTGGAGCATCTCATTTGATC
ATCCCTGAAAAAGGTTCTTACAATGGTTGTACAGATATGCTGGTGATCGA
CTTTGGTAAAATCACGATGAGCAGCGATCCTAGTCAAATCAGACACCTTG
ACCCTAAGGACATTGAGGATGTGAATGAAGTACAAAGCAAAGCTTATGAT
CGATTCTTGTTGTCGCTTCAAGCTCTTCAAATATTACTCGTTAGAGAAGG
TGAAGATTTAAAGAGTGCTAAAAGCAACGTCAGTAAAGCTTCATCACACA
TTTTGCATCCCATCAATTTCGATGGCAAACTTGCCAAAGCTATACTTCCA
CAAGATCCACGTTTAAAACAGATATGTGTCTCTGGTGAATTATCTTCGCT
GTTTGTTTCTGTATCGGATGATAAAGTCAGTCGTCTCATCAAGCTAGCAG
ACTCGATACCACTCCCTCAATCACCTTCTCACGATAACATCGACGGAGAA
GAAAAACCTGAAGGACTCTTCACCAAGGCGTTGTCAATGATAAGCTTGAC
AGGTGACAATGACACAGGGGTGGACATCGGAGGATTTTCCATCCCTGTAC
CGACATCTCCAACATCAGTGACGTCAGATGAAGATGAATACGGGACACCA
CCTGATGGCTCCATATTACAGTTACAACAAGAAGCTGGTCCGGACTTTTC
ATCAGGAGTGGCGAACCAAGTCAAAGTGGACTTGAACTTTAAAATCCATA
AAGTGATGATCGCCATTGGTTTGACTGACAAAGCATTGAAACAGGAAAAA
GAATGTCTGAAATTCATCGTGGACGACATCAATACAGAGgtGATACTACG
AAGATGGGATTTGTTCGTCAATGCAGAAGTTGGTCGTCTGGTGTTGAATG
AAATGACATGGGGTGTTGATGGAGAACCTTTCGCCATCATGAGTACaccc
aaaaacaccaaaatgttGAAATTCAGCTATCGGAGGTGTGAATTCAACGA
AAGTTTGAATCTCGGTCCAAGTTACTTTTATTCCAAAGAAGCGCAAGTCA
GAGCTTTACATTTCAAAGATGAATTTGGCGCCACGGATCAGATTTTAGAT
GTACAAGTGGCTACTTTATTTCTGATGCTTCATCAAGAAGCACTTTTGAG
CATCATGTCATTGATCTACCAAGTACTGGAACCACTCAACAAACATGATA
AGGAAGCCACACAGAAGATCAAACGGAGTTTGAGTACGGCAGGTAGTCGT
TTGAGTCTCTCCatcgaagaaaaagaaaaggagaGACAGATACAACGAAA
ATTAGCCAACCCTAAAGCACTGGAAGCTGCCAACGAACTTAAGCAACAGG
TTGGcttagaagaagaaaaaaagatgaGAGTGACCGCCCACCTGGATGGT
GTTGGTATCATGATTTGTTCAGCCAAAGTTGACCTTGCACAAGCCTTCGT
TAAAGGGTTATCTGCTAAAGTACTGATGAAAGATGACTTATTAGAAGTGA
AAGCCAGCATGAAAGATATGCAAGTACAAGATAATGTTGGCGAAACAAAG
TACAAAGACATCATTAGCATGCGATCTGATGAAGTGTTCGATTTAGAGTT
GGCTATTTACGAGAATGGATCTTCTGGTAGCAAGCAATACGATATGTCGT
GTGTCGACACCAGTGTCAAACTGAACTTCGGTCAAATGCGCGTTGTTTTC
TTGTATAGATTCATACAAGACTTAATGTCATTCACCGAAAACTTCGAAGA
AGCACAGAAAGCAGTTGTGGAAGCTGGTAAAGCTGCCAAGGATAAAGCTC
TGGAAACAGCGACCGATTTGAATAGACATTCTTCTCGTGTCAAACTAAAT
GTGGTTCTGAAAGCACCGACTATTATCATTCCAGTTGGATCAAACAATGA
ATTGGCTTTACTGGTGGATCTGGGTGAATTGCGTATTTACAACACATTCA
AACTCCTCAACGATGATCAATACCATAAGAAATCTATCATCACTGATAAC
ATGACCATTAAGTTATCCAATCTGAAATTGTTAAAAGCACTTATTCAAGA
TGGTAAAGATTTCTTGCATCAACGAGCCATTATTGAACCTATGATGCTAC
AAATAACTATTGTTCGTAATTTAACGAAAGGTAACCATTCCATACCGGAT
GTTTCAGTTCAAGCAAAGATGCCAGCTATTCTGTTATCAATCAGTGAAGA
AGATGTGACCGTAGCTCTAAAGATTGTCCAAGGGAATCTCGCCGAAGGTG
AGTCACATGCGCCGAAGAAGCAAGCCAAGCCTGCCAAACAAACGTTAAAC
GTGCCACAAGATCGTTTAGCAGACATTTACGAGGAGcctgaagatgaaga
tgagaaTCGACAAGGATATCTTCAAACCAAACTATCCTTCGATCTGGCTA
AAATTGACATCAAGCTTTACTTGAAACCATCTGATATGACATTTGAAGAT
GAATTTTTAGCGAGGACGGATGATTTGTTGTTAGCTTTGTTCACTATTGG
TAACCTGTGTGTTGATGGAGACATCATGTCCACGCAAGCTATGAAGATGA
GCGTTCGATTGGACACTTTGGTGTTGGATGATATGAGACCTATCGAGGAG
CATGAAGGTGTTAAACGTATGATCAACTACAGTCCCGAGCCACTCCTTGA
AGAAGTCAAAACCTCTTCTCATAAACGACCAATCGACAACTCACGAATGA
TCGAAATCCAAttcgatcaaacttcatcgcaagataaaaatatcgacATC
AAACTTTGTAACATGCTTTGTATATTCAACGTTGAGTTTATCATGGTCCT
GTTGAAAACGTTGCAAGCTGCCATACCTAAAGATGATAGTCTGCAACATG
GCCATTCAATGAGTAGTCTAGACTCGGCGGCAGGGTCTGGCGGCAGCGAT
GACGAGGACTCTTTAGAAGCCAGCGAGATTGTCCTCTGCACTGGTGATCA
AGAAAGACCTGAGACTAAAGTCTCTATCTTCGTCCATAACCCGCAAATTG
TTTTACTAGCAGATGCAAAGGATGTCAAAACAAATGCACTCTTTCTTACA
ACCGagatcaattttcaatatttcgaaTTGCGAGATACTCAAAAAATGAT
TGGCGCTGTTTCTAACACCGCTATTTTGTCAACTGCTTTCAAGAATGACC
ATCGGAGTGATATATCAACAGTGTTGTCATTAGATTCCATCAATCTCCAC
TCGTCATCACCCATCAATGGTAAACCTCATATGAGTGTCAGCACAACTTT
GATCAAACTGAATATCTCACCCAAAACCATCCGAACTTTATCAGCGTGTG
CTGGTTACATCTCCAATGATCCAACAGATGAAGAAATCAAAGAAGCTCGA
AAAGCCATGCGTGATTTATGGCAAATTCAAACGTTCACCAATAAGCGACC
GTGGTATTTAAACCACCCACCACAACAAGTCTTAAGTGCTGGCAGCTTCG
TCCTTGCGCGAACGAGAACAGGAGAATATAAGCATGGTTTCTTAGCTAAA
AAGGATGTCTCGTATCAAGTCTATTTTTCAGAGGAGCGAGGAACAGCCAG
TCACCGAGCCATGGATATCTCATCTGTTGTTTTGGATATCGTACCGCTGA
TCGGTGATCTATGTGTTGGATGTAATGTTTTAGCTGTGGAATCGAAAGAA
CATGGATATCGTACTGGTCGAATTACTCAGGTTTGGGATTCGAATGTGGA
TAAAGATTCTTCGGATGGCGCCAAACAATCTGTTTCTGTCAAGACAACTG
CTATTGCTCCAATCAAATACCTTGTCAATTTCTATGACAACCAAACGGAG
AACTTCTTCCCGCCTGATGAACTTCGTATCATTGGTAAACCCATCAAGGG
GGTTGTCCCTGGACTAGGGGCGTGTGTTTACGCCCGCTTTAATGATGGTT
TTTACTATCGGGGCAAAGTTGATGACATCGAGGATTATCGAATCCGAGTG
CAATTGGATGAGATCAGTGGAGAAATCGAACACGACATCGATGATCCGTC
AGCCGTTATTTTGAACCTGACGCCTCAATACCGTCAAGTCAAAAAGCATT
TCAAAGTCATTGCATCCAAAGGAAGCACAACTAAAGGATATCATCCGGGG
AAAGTGACCGCCATCCAAGGTGAAGGAAATAACCGATTGTATTCGATACG
CTTCGAAGACGGTACAATTAACCAAGTACCCATCacgaaattgattttga
tgccAAAAGCACCTTTTGATGCTTTACCTGAAGTTGGCACATACGTTTAT
TCCCGAGTGTCACGCGACGCTCCTTTATACGAGAAGGGTATCGTAGCAGA
GAAGAACACAATGATCTGCGTTAAACATTTAAATGGACGGAAATTGGCTC
ACGAAATACAAAACATTCATTTTGTTGTCCGAAATATCGTTCCTCTCGTG
TCATCAttgaagGTTGGTTTGGACGTCATAGTGCAACCTGACAATGACGA
TCAGAAAATGTATTTGGCTGTCATTAGGGAAGTCACCAAAAAAGAAGGTG
ACAAAACGAACCGTTATCTAGTGGAGTTTACGGATGGATCCAAGAAGAGA
GTGACGCCCAGCCGGATCCGTATACTTTCTCAATACGGAAGTGCAGAAAC
GAGTGAAGAAAATGCTGACATTATCACAACAAGACAGGAGGAACTAGTTC
TCGATGTGCAAGGTATCTCATTACGTGTGGAAGGTTACTTGGGAGGCGTG
TTGACACCCATGCTCAAAATGGATTCCAAAATCACAGCTAACTTGAAGGA
TTGGTCAAGCCAAATGAATGCACACGCTACTGTATCATTAGAAGCCAGTT
ATTATAACGAAAACGTTGCCGAATGGGAGCCAGTTATTGAACCTTTGATG
GAGAAACGGAGGGAAAGACCGTGGCAACTCTCTGTCAATTACACGATGGA
AGGTGACGACAATTCTGCTTCATCCACTTCCAACGAACTCGTTTTACAAA
AACCGGAATCCAACCTGAAAATCAAATCTCAAGATAATCTTGAATTGACA
ATTTCAAAATCATGTCTTGCTTTACTCGGTGAATTGGGACAGGTGTTTGG
AGATGCAGTAGAATCTGTGGACGTTTTACCACAAGTCCTGGTCGAAAAAG
AACCTTTCATGATCGAAAACTTGCTCTCCAAGAAGGTGACAGTAACATTG
AATGAACTTCTGCAGGGACCAAATGGAGATTCGACAATCGAGCTAGCATC
TTCTTCGAATCCTGTTGGCATTACTTTTGCTCCCAagaaatttgagaaac
gaaAGACCAACGATCTATACACAATCAATTTAtcgGTGGACGGTTTTCAT
GACATTAAAGACATTGTGGTTCAAAGAAAGCGAAGCGTTATCTATGATCT
TGTACCAATAAAACTATTATCAGCACAGTCTTCATATTCGATAGTGGTAC
AAGTGAAGACAACAGACGGACAACGTATCATCGTACTCCGATCACCATTG
CAGTTGAAAAATCACTTTCCAATGCCGTTGGATGTCAGCTACATTTCCAA
AGAAAACCAACCAGTTAAACTGACAACAGTGGGATCGGGAGATATCTATT
CCTTCCCTTTGTTGTTAACCTACCACAGTGTTTTTCATCTCAAACCTGCT
GGTTTCGACTACGGTGATTGCACAGAAGCTCTCAATTGGAGTGATTTGAA
GACGAGCAACGAAAAACAGTTCTCCTGCCCTTCACCTGACAAAAGTGCTG
ACCCTTTCTACATGCAGGTGGTGATGAAAGAGGAGACGTACTCTTCCGTA
CACGGCATGTTGGACTGTGTACCACGTTACACGTTGGAGTGCTTTCCCGT
CATCACGCTGCATAATTACCTACCTTGCACTATTAATTATAAGATCAAGG
GTATGGCGAAATCGGAAAGTCTACCAGGCGGACACAATTGGCCTTTGTTT
ACCGTCAACTTCAGTGATAAACCTTCCATCTATATCGAGATTGAGTCGTA
TAACAACCAAAGATGGGAAGGAGGTTTGACATTACCAACAAAACCGGTAG
ATTCTTTGAACAAACCATCATTATCTTTCGTCATGATGTCTGGTGAACGC
AAAATGGAATTGGGTGTTTATTACCAGTTAGACGGTTCATTGAACATCAC
CTTATATTCGCCTTACTGGCTTCTCAATAAAACTGGAAAACCACTTGTCT
ATCAGCCAGCGGGGAGCAGCATCCAGCAAGTTCACCAAGAGAACGATGTA
AATGCTCTTATGATGCTCGTCAAAGGGAAACATAAAAAGgcgaaagtgaa
agtgaaaaataGCGAGTCATGGTCAAATGAATTTTCATTGGATACTGTTG
GCAGTGGTGGTTCCTTGAAATGCAATGGTCCAAGAGATCGAGTTTATGAG
ATTGGTTTGAACATCAGTTTGTCATACTTTGGATTGACGAAGATTGTGAC
GTTCACGCCACTCCGAATGTTATCTAACCACACCAAGTACACCATCAGTA
TGGCAGAAAGTAATTCTAAATCGTCAGAATGGCACACGGTAAACCCTGAC
GAGaacattccatTCTGGCCGACGAAACTTCCTTTGGTCAACCTTTACAT
TAACATCAATGGGCAAGATTCAGTGAAATTCAACCCTGAAGTTGGAAAAA
CTTTACTGTTGAAGTTCCAGAATGAGGTTGGAGGAGTTTGCGTGGATTAC
CAAGAAAAGGACTCGTCCTCAGTCCTTTCGTTTAATCCGTACTTCGCAGG
TGCAGCTCCTGTGCGGCttgaaaatctttgcaaaaaGATCGGCATGATCG
CTTATAAACAAGCAGGTTCGGTAATGGGTCACGTGTTAACACATGACCAA
TCAGTGTTGTACACGTGGGATGATCCAACCATGGAACAAGAATTGATTTG
TTCCATTGTCAATGATGAAGCCAGTGAAACAAGGATCAAACTCGATGCCA
ACGATTTCGGACGAATGAGAGTTGGAGATGGTGCAATTTATTGGGTTTCC
TTTCTGGATGGTCTTCAACGTGTTCTATTGTTCACTGATAACTTCAAATC
TGCTTACTGCGCATGTCAGgaGCAAAATTTACGCCCAACCATGGAAGTTG
ACTTTGAGATTGAGAGTTTTGGTTTGTCTCTGGTCAATGTTGATAAGAGA
ATGGAGATTGGCTACTTAGCTATCCGACAAAGCAAGACTGTATGGGAGCA
ACGCAAGAAAAAGAACCGCTGGAAAGCTTTACCGCTTGCCATGTGTGAAG
CTCTCGAAGAAGGTTATCTCAATTATCAAAACAGAAAAGGTGCAGTCAAA
GAGAAAGTTCTGGATAAGGAGGTGGATTACGAGAAGATGTTTATTACGAA
ACCTGAGAAGATTAAGATCAGAAGAACGTACCACAGCGGTCTTGGTTTCA
AATACACAATCTCACCCAATGAAATGCGTGTGCATGCTTCTATCAGCTCA
ATACAGTTGGATAGCCATGTTCCAGGTTCGACCTTTCCAACAGTCTTGCA
TATGGTTGAACCACCAAAATCTGTTGCTTCAGAAAACGCTCCAAAGCCAT
TCTttgaattgagtttaatgaCAAGGATCGGTGATAAAAATGTGGTCAAT
GAAGTcagCTATTGTCACGTGTTGATTCAAGAGATGGATGTGAGGGTTGA
TATTGGATTTTTATTGGCTCTGATGGAACTCTTCAGTCATGCAAGAGCTC
GAACAACCGAGAAAGAACAATACGCGCTTGATATTGGCCAAGCAGCAACA
AAGTTTGAAGAAAGCGCTGAATTTCAGGCAGCCAAACAAGATCGATATTA
CGTTTTGAACGACTTTCATTTATCACCGCTAAAGATTCACGTCAGTTTCT
CTTTGACGGGTGGTTCCAAAGATGAAAATGCTATTGCTTCATTACATGGT
AACGTGTTGAACTTGTTGTTACAAAGTGTCGGACTGGCCTTCACTGAAAT
ACAAGACGTACAATTCAAATTAGCATGTTACGAAGTGCATAAGTCCATGC
AGAGTAATTCGCAGCTCGGTGATGGAATAACTAAACATTATCAAACACAG
GCTATCAAGCAACTTTATGTGTTGGTACTCGGGCTAGACGTTCTTGGTAA
TCCGTATGGTTTGATATCTGGTGTTGGAACCGGAGCAAAGAATTTCTTCT
ACGAACCTTACCAGGGATTAATTCAAGGACCAGAAGAATTTGCGGAAGGA
TTGGCGTATGGGGTGAAGAGTCTTGTTGGTGGAACCGTGGGTGGAGTATC
AGGAGCTGTGAGTAAGATTACCGGTACCTTCGGTAAAGGTTTGGCTGCAT
TGACCTTGGATGAAGAATATCAACAAAAGAGACGTGAAAACATGAGCCAA
CGCCCAACTAACCTCGGTGAAGGTCTCGCCAAAGGTGGTAAAGGCCTTGT
AAAGGGTATCGTGTCTGGTGTTACAGGGATCGTTACCAAACCCTATGAAG
GTGCCAAGAATGATGGTGCAGGTGGCTTTTTTAAGGGCGTTGGAAAAGGC
CTGATTGGCGTGGTTGCACGCCCTGTTGGTGGAGTGGTAGATATGGCCAG
TAACACGTTTGATGGTTTGAAAAGCACGACATCTGGCGTGAAAGCGATCG
AGTTGAGCCGTGTTACTCGCGTCTTCCACGCAGATAAGGTTTTACGACCT
TTCAATCTGTACGAAGCAGATGGAAACAAAATTCTTATGCAATGTAACAA
AGGAGAATACGCCAAGAAGAATTTTTATATCACTCATGTAGTGGACAAGA
AGAACTATCTCATCCTCACTCAATCaaacATTTTGTATGTTGGAAAGAAC
GAGTTGAAAATGGGTGAATGGGAATCggtttgggttatcgagttcaATGA
GCTAAAACGTGAACCAGAAGTGAAAGAGACAAAGATTATTTTCCATATCC
ATAATACGGACACGCGACGTTCAATTTTCAAGAAATCGACGAACACACGT
GAAGTGATATTGGAGTCTAGTGCTGTTGCAGACTGGTTTATCTTAAAGCT
TAGAGATGCTAAAATGTTATAGatggtatttgaaTCTTTGGTTGCTGACC
TCTTGAACAAGTATCTGGGTCAATATGTGAAAAATCTTGATGCTTCTCAA
TTGAAGATTGGCATTTGGGGAGGAAATGTTGTCCTGACAGAACTTGAACT
GAAAGATACAGCTCTGGATGATCTTGACTTACCCATAAAAGTTGTTCGTG
GATATTTGGgtAAATTGGTCTTGTCCATCCCATGGAAAAATCTTTACACT
GAATCAACTGTTGTCGATATTCAAGATCTCCACCTTGTCGCTAAGCCTAA
TTTTGACATCAAATACAATGAAGAACgcgaagaaaaatcaaaacatgacA
AGAAACAACAACAGATTCACAATATCGAAGAAGCGAGGCAAAGAGAAGAA
GACAAAAAGAAAGGCGCCAAGAAAGAAGAGAGTGACGGTTTTGCTGAGAA
ACTTGCAACAAACGTCATAAAAAATCTACAGGTTACGATCAAGAACATAC
ATGTTCGATATGAAGACTCAATCAGTGATGTGAATGGACCCTTTTCAGTC
GGTCTTACAATGGAAAGTTTAACAGCACAAACCACAGATGAAGATTTTGT
TCCAAAGATTATCAAAGAATCTGTCTCATTAATTCATAAGatggTGAAAT
TAGACAATTTGGCTTTATATTGGAATCCAGGAGACGAACTGATTGATCCT
TCACTTGATACCAAGCAATGGTTGgaagtTTCAACGAAGCAAATTTCAAC
ACACCAATCGAAGCCAGAGAAAACGAAATATATTTTGAGTCCCATGGTTG
CAACGAAGAAATTGAAGCTGAACACCAAACCAGGTTCCAACCTTGACATC
CCGAAGatgttTTTGAACTTGGTTTTGGAAGAACTTGGTATCATCGTGGC
AAGAAGTCAATATCATGGCGTGGTGCAACTGATTGAATCATTTGAACGAA
TGAATAGGAACCAACCTTTTCGTAAATACAGACCACATACCTCCGTTCTT
GGGAACGAAAGTATTTGGTGGAAGTACTGCATGTCCAGCATACTGGAGGT
GGATGTCAAAAGACGATCTCAAATGTGGAGCTGGAAGCATATTCAAAAAC
ATCGAGTTCTTTGCAAAGCTTACAAAGTGAAGTAcaaggaaaaattgaaa
cagaaaaATCCATCCAAACAAATTCTCACTGAACTAGAGaGCATGGAGGA
TGAGTTGAATATTGCAAGCATCACCATTTTTCGACAGCTTGCAGCTACAG
AGGTTTTAACGGAACAAAAGAAGAAAGGCACTAAAGGAAGTTTCTTCAGT
TTCTTCTCCAGATCAAAAGAACCAGAAAAGTCTGCTGCTAATAAAATTGG
AGATTTAATGGGTGATGACCAGGAGAAGGAAATGCAGAAATTGTATGACG
CAATCGGTTATACTGAAAATGAAGTCATCACTCCCTTTCCTAAAGAGTAC
GTGGCGATGTCAGTGGAATCGATTCTCCAGAAATTATTCATCAGCCTCAT
CGATGACACAGATAAGGCGAAAGAATTCAAAGTGTTGGATTTTTCACTCA
ACAACATCATTGTAGAAGTTTTCCAAAGACCTTCTGCTCAAGCTCTCAAA
TTATGTGCAAAGATAGGAGAGATGAAGTTATTTGGTACAGCTTCTGCTCA
ATGTACACCTCtcatcatcaaaaacatgttaCAAGGTCGAGGTATGGAAT
TTCTGCCGTTGGTGGACTTCATCTTTGAGACGAATCCTTTGAAGAAACCG
GACATTGACCAATGTATCACTGCTATTTGTCAACCCTTAGAAATCATCTA
TGATGCTAACACGATCAACCATATCATTAGTTTCTTCAAACCTCCTGAAC
ATGTTATCTTGCAAGATTTACAAGACAAAGCGTATTCTACTTTCGAAGAT
TTTAAAGTTTCAAGTACGGCTGGTCTTCTACATGCTATGGAACAAAGAAC
GGTTATGGACATCGACATTGATGTTGGAGCATCTCATTTGATCATCCCTG
AAAAAGGTTCTTACAATGGTTGTACAGATATGCTGGTGATCGACTTTGGT
AAAATCACGATGAGCAGCGATCCTAGTCAAATCAGACACCTTGACCCTAA
GGACATTGAGGATGTGAATGAAGTACAAAGCAAAGCTTATGATCGATTCT
TGTTGTCGCTTCAAGCTCTTCAAATATTACTCGTTAGAGAAGGTGAAGAT
TTAAAGAGTGCTAAAAGCAACGTCAGTAAAGCTTCATCACACATTTTGCA
TCCCATCAATTTCGATGGCAAACTTGCCAAAGCTATACTTCCACAAGATC
CACGTTTAAAACAGATATGTGTCTCTGGTGAATTATCTTCGCTGTTTGTT
TCTGTATCGGATGATAAAGTCAGTCGTCTCATCAAGCTAGCAGACTCGAT
ACCACTCCCTCAATCACCTTCTCACGATAACATCGACGGAGAAGAAAAAC
CTGAAGGACTCTTCACCAAGGCGTTGTCAATGATAAGCTTGACAGGTGAC
AATGACACAGGGGTGGACATCGGAGGATTTTCCATCCCTGTACCGACATC
TCCAACATCAGTGACGTCAGATGAAGATGAATACGGGACACCACCTGATG
GCTCCATATTACAGTTACAACAAGAAGCTGGTCCGGACTTTTCATCAGGA
GTGGCGAACCAAGTCAAAGTGGACTTGAACTTTAAAATCCATAAAGTGAT
GATCGCCATTGGTTTGACTGACAAAGCATTGAAACAGGAAAAAGAATGTC
TGAAATTCATCGTGGACGACATCAATACAGAGgtGATACTACGAAGATGG
GATTTGTTCGTCAATGCAGAAGTTGGTCGTCTGGTGTTGAATGAAATGAC
ATGGGGTGTTGATGGAGAACCTTTCGCCATCATGAGTACacccaaaaaca
ccaaaatgttGAAATTCAGCTATCGGAGGTGTGAATTCAACGAAAGTTTG
AATCTCGGTCCAAGTTACTTTTATTCCAAAGAAGCGCAAGTCAGAGCTTT
ACATTTCAAAGATGAATTTGGCGCCACGGATCAGATTTTAGATGTACAAG
TGGCTACTTTATTTCTGATGCTTCATCAAGAAGCACTTTTGAGCATCATG
TCATTGATCTACCAAGTACTGGAACCACTCAACAAACATGATAAGGAAGC
CACACAGAAGATCAAACGGAGTTTGAGTACGGCAGGTAGTCGTTTGAGTC
TCTCCatcgaagaaaaagaaaaggagaGACAGATACAACGAAAATTAGCC
AACCCTAAAGCACTGGAAGCTGCCAACGAACTTAAGCAACAGGTTGGctt
agaagaagaaaaaaagatgaGAGTGACCGCCCACCTGGATGGTGTTGGTA
TCATGATTTGTTCAGCCAAAGTTGACCTTGCACAAGCCTTCGTTAAAGGG
TTATCTGCTAAAGTACTGATGAAAGATGACTTATTAGAAGTGAAAGCCAG
CATGAAAGATATGCAAGTACAAGATAATGTTGGCGAAACAAAGTACAAAG
ACATCATTAGCATGCGATCTGATGAAGTGTTCGATTTAGAGTTGGCTATT
TACGAGAATGGATCTTCTGGTAGCAAGCAATACGATATGTCGTGTGTCGA
CACCAGTGTCAAACTGAACTTCGGTCAAATGCGCGTTGTTTTCTTGTATA
GATTCATACAAGACTTAATGTCATTCACCGAAAACTTCGAAGAAGCACAG
AAAGCAGTTGTGGAAGCTGGTAAAGCTGCCAAGGATAAAGCTCTGGAAAC
AGCGACCGATTTGAATAGACATTCTTCTCGTGTCAAACTAAATGTGGTTC
TGAAAGCACCGACTATTATCATTCCAGTTGGATCAAACAATGAATTGGCT
TTACTGGTGGATCTGGGTGAATTGCGTATTTACAACACATTCAAACTCCT
CAACGATGATCAATACCATAAGAAATCTATCATCACTGATAACATGACCA
TTAAGTTATCCAATCTGAAATTGTTAAAAGCACTTATTCAAGATGGTAAA
GATTTCTTGCATCAACGAGCCATTATTGAACCTATGATGCTACAAATAAC
TATTGTTCGTAATTTAACGAAAGGTAACCATTCCATACCGGATGTTTCAG
TTCAAGCAAAGATGCCAGCTATTCTGTTATCAATCAGTGAAGAAGATGTG
ACCGTAGCTCTAAAGATTGTCCAAGGGAATCTCGCCGAAGGTGAGTCACA
TGCGCCGAAGAAGCAAGCCAAGCCTGCCAAACAAACGTTAAACGTGCCAC
AAGATCGTTTAGCAGACATTTACGAGGAGcctgaagatgaagatgagaaT
CGACAAGGATATCTTCAAACCAAACTATCCTTCGATCTGGCTAAAATTGA
CATCAAGCTTTACTTGAAACCATCTGATATGACATTTGAAGATGAATTTT
TAGCGAGGACGGATGATTTGTTGTTAGCTTTGTTCACTATTGGTAACCTG
TGTGTTGATGGAGACATCATGTCCACGCAAGCTATGAAGATGAGCGTTCG
ATTGGACACTTTGGTGTTGGATGATATGAGACCTATCGAGGAGCATGAAG
GTGTTAAACGTATGATCAACTACAGTCCCGAGCCACTCCTTGAAGAAGTC
AAAACCTCTTCTCATAAACGACCAATCGACAACTCACGAATGATCGAAAT
CCAAttcgatcaaacttcatcgcaagataaaaatatcgacATCAAACTTT
GTAACATGCTTTGTATATTCAACGTTGAGTTTATCATGGTCCTGTTGAAA
ACGTTGCAAGCTGCCATACCTAAAGATGATAGTCTGCAACATGGCCATTC
AATGAGTAGTCTAGACTCGGCGGCAGGGTCTGGCGGCAGCGATGACGAGG
ACTCTTTAGAAGCCAGCGAGATTGTCCTCTGCACTGGTGATCAAGAAAGA
CCTGAGACTAAAGTCTCTATCTTCGTCCATAACCCGCAAATTGTTTTACT
AGCAGATGCAAAGGATGTCAAAACAAATGCACTCTTTCTTACAACCGaga
tcaattttcaatatttcgaaTTGCGAGATACTCAAAAAATGATTGGCGCT
GTTTCTAACACCGCTATTTTGTCAACTGCTTTCAAGAATGACCATCGGAG
TGATATATCAACAGTGTTGTCATTAGATTCCATCAATCTCCACTCGTCAT
CACCCATCAATGGTAAACCTCATATGAGTGTCAGCACAACTTTGATCAAA
CTGAATATCTCACCCAAAACCATCCGAACTTTATCAGCGTGTGCTGGTTA
CATCTCCAATGATCCAACAGATGAAGAAATCAAAGAAGCTCGAAAAGCCA
TGCGTGATTTATGGCAAATTCAAACGTTCACCAATAAGCGACCGTGGTAT
TTAAACCACCCACCACAACAAGTCTTAAGTGCTGGCAGCTTCGTCCTTGC
GCGAACGAGAACAGGAGAATATAAGCATGGTTTCTTAGCTAAAAAGGATG
TCTCGTATCAAGTCTATTTTTCAGAGGAGCGAGGAACAGCCAGTCACCGA
GCCATGGATATCTCATCTGTTGTTTTGGATATCGTACCGCTGATCGGTGA
TCTATGTGTTGGATGTAATGTTTTAGCTGTGGAATCGAAAGAACATGGAT
ATCGTACTGGTCGAATTACTCAGGTTTGGGATTCGAATGTGGATAAAGAT
TCTTCGGATGGCGCCAAACAATCTGTTTCTGTCAAGACAACTGCTATTGC
TCCAATCAAATACCTTGTCAATTTCTATGACAACCAAACGGAGAACTTCT
TCCCGCCTGATGAACTTCGTATCATTGGTAAACCCATCAAGGGGGTTGTC
CCTGGACTAGGGGCGTGTGTTTACGCCCGCTTTAATGATGGTTTTTACTA
TCGGGGCAAAGTTGATGACATCGAGGATTATCGAATCCGAGTGCAATTGG
ATGAGATCAGTGGAGAAATCGAACACGACATCGATGATCCGTCAGCCGTT
ATTTTGAACCTGACGCCTCAATACCGTCAAGTCAAAAAGCATTTCAAAGT
CATTGCATCCAAAGGAAGCACAACTAAAGGATATCATCCGGGGAAAGTGA
CCGCCATCCAAGGTGAAGGAAATAACCGATTGTATTCGATACGCTTCGAA
GACGGTACAATTAACCAAGTACCCATCacgaaattgattttgatgccAAA
AGCACCTTTTGATGCTTTACCTGAAGTTGGCACATACGTTTATTCCCGAG
TGTCACGCGACGCTCCTTTATACGAGAAGGGTATCGTAGCAGAGAAGAAC
ACAATGATCTGCGTTAAACATTTAAATGGACGGAAATTGGCTCACGAAAT
ACAAAACATTCATTTTGTTGTCCGAAATATCGTTCCTCTCGTGTCATCAt
tgaagGTTGGTTTGGACGTCATAGTGCAACCTGACAATGACGATCAGAAA
ATGTATTTGGCTGTCATTAGGGAAGTCACCAAAAAAGAAGGTGACAAAAC
GAACCGTTATCTAGTGGAGTTTACGGATGGATCCAAGAAGAGAGTGACGC
CCAGCCGGATCCGTATACTTTCTCAATACGGAAGTGCAGAAACGAGTGAA
GAAAATGCTGACATTATCACAACAAGACAGGAGGAACTAGTTCTCGATGT
GCAAGGTATCTCATTACGTGTGGAAGGTTACTTGGGAGGCGTGTTGACAC
CCATGCTCAAAATGGATTCCAAAATCACAGCTAACTTGAAGGATTGGTCA
AGCCAAATGAATGCACACGCTACTGTATCATTAGAAGCCAGTTATTATAA
CGAAAACGTTGCCGAATGGGAGCCAGTTATTGAACCTTTGATGGAGAAAC
GGAGGGAAAGACCGTGGCAACTCTCTGTCAATTACACGATGGAAGGTGAC
GACAATTCTGCTTCATCCACTTCCAACGAACTCGTTTTACAAAAACCGGA
ATCCAACCTGAAAATCAAATCTCAAGATAATCTTGAATTGACAATTTCAA
AATCATGTCTTGCTTTACTCGGTGAATTGGGACAGGTGTTTGGAGATGCA
GTAGAATCTGTGGACGTTTTACCACAAGTCCTGGTCGAAAAAGAACCTTT
CATGATCGAAAACTTGCTCTCCAAGAAGGTGACAGTAACATTGAATGAAC
TTCTGCAGGGACCAAATGGAGATTCGACAATCGAGCTAGCATCTTCTTCG
AATCCTGTTGGCATTACTTTTGCTCCCAagaaatttgagaaacgaaAGAC
CAACGATCTATACACAATCAATTTAtcgGTGGACGGTTTTCATGACATTA
AAGACATTGTGGTTCAAAGAAAGCGAAGCGTTATCTATGATCTTGTACCA
ATAAAACTATTATCAGCACAGTCTTCATATTCGATAGTGGTACAAGTGAA
GACAACAGACGGACAACGTATCATCGTACTCCGATCACCATTGCAGTTGA
AAAATCACTTTCCAATGCCGTTGGATGTCAGCTACATTTCCAAAGAAAAC
CAACCAGTTAAACTGACAACAGTGGGATCGGGAGATATCTATTCCTTCCC
TTTGTTGTTAACCTACCACAGTGTTTTTCATCTCAAACCTGCTGGTTTCG
ACTACGGTGATTGCACAGAAGCTCTCAATTGGAGTGATTTGAAGACGAGC
AACGAAAAACAGTTCTCCTGCCCTTCACCTGACAAAAGTGCTGACCCTTT
CTACATGCAGGTGGTGATGAAAGAGGAGACGTACTCTTCCGTACACGGCA
TGTTGGACTGTGTACCACGTTACACGTTGGAGTGCTTTCCCGTCATCACG
CTGCATAATTACCTACCTTGCACTATTAATTATAAGATCAAGGGTATGGC
GAAATCGGAAAGTCTACCAGGCGGACACAATTGGCCTTTGTTTACCGTCA
ACTTCAGTGATAAACCTTCCATCTATATCGAGATTGAGTCGTATAACAAC
CAAAGATGGGAAGGAGGTTTGACATTACCAACAAAACCGGTAGATTCTTT
GAACAAACCATCATTATCTTTCGTCATGATGTCTGGTGAACGCAAAATGG
AATTGGGTGTTTATTACCAGTTAGACGGTTCATTGAACATCACCTTATAT
TCGCCTTACTGGCTTCTCAATAAAACTGGAAAACCACTTGTCTATCAGCC
AGCGGGGAGCAGCATCCAGCAAGTTCACCAAGAGAACGATGTAAATGCTC
TTATGATGCTCGTCAAAGGGAAACATAAAAAGgcgaaagtgaaagtgaaa
aataGCGAGTCATGGTCAAATGAATTTTCATTGGATACTGTTGGCAGTGG
TGGTTCCTTGAAATGCAATGGTCCAAGAGATCGAGTTTATGAGATTGGTT
TGAACATCAGTTTGTCATACTTTGGATTGACGAAGATTGTGACGTTCACG
CCACTCCGAATGTTATCTAACCACACCAAGTACACCATCAGTATGGCAGA
AAGTAATTCTAAATCGTCAGAATGGCACACGGTAAACCCTGACGAGaaca
ttccatTCTGGCCGACGAAACTTCCTTTGGTCAACCTTTACATTAACATC
AATGGGCAAGATTCAGTGAAATTCAACCCTGAAGTTGGAAAAACTTTACT
GTTGAAGTTCCAGAATGAGGTTGGAGGAGTTTGCGTGGATTACCAAGAAA
AGGACTCGTCCTCAGTCCTTTCGTTTAATCCGTACTTCGCAGGTGCAGCT
CCTGTGCGGCttgaaaatctttgcaaaaaGATCGGCATGATCGCTTATAA
ACAAGCAGGTTCGGTAATGGGTCACGTGTTAACACATGACCAATCAGTGT
TGTACACGTGGGATGATCCAACCATGGAACAAGAATTGATTTGTTCCATT
GTCAATGATGAAGCCAGTGAAACAAGGATCAAACTCGATGCCAACGATTT
CGGACGAATGAGAGTTGGAGATGGTGCAATTTATTGGGTTTCCTTTCTGG
ATGGTCTTCAACGTGTTCTATTGTTCACTGATAACTTCAAATCTGCTTAC
TGCGCATGTCAGgaGCAAAATTTACGCCCAACCATGGAAGTTGACTTTGA
GATTGAGAGTTTTGGTTTGTCTCTGGTCAATGTTGATAAGAGAATGGAGA
TTGGCTACTTAGCTATCCGACAAAGCAAGACTGTATGGGAGCAACGCAAG
AAAAAGAACCGCTGGAAAGCTTTACCGCTTGCCATGTGTGAAGCTCTCGA
AGAAGGTTATCTCAATTATCAAAACAGAAAAGGTGCAGTCAAAGAGAAAG
TTCTGGATAAGGAGGTGGATTACGAGAAGATGTTTATTACGAAACCTGAG
AAGATTAAGATCAGAAGAACGTACCACAGCGGTCTTGGTTTCAAATACAC
AATCTCACCCAATGAAATGCGTGTGCATGCTTCTATCAGCTCAATACAGT
TGGATAGCCATGTTCCAGGTTCGACCTTTCCAACAGTCTTGCATATGGTT
GAACCACCAAAATCTGTTGCTTCAGAAAACGCTCCAAAGCCATTCTttga
attgagtttaatgaCAAGGATCGGTGATAAAAATGTGGTCAATGAAGTca
gCTATTGTCACGTGTTGATTCAAGAGATGGATGTGAGGGTTGATATTGGA
TTTTTATTGGCTCTGATGGAACTCTTCAGTCATGCAAGAGCTCGAACAAC
CGAGAAAGAACAATACGCGCTTGATATTGGCCAAGCAGCAACAAAGTTTG
AAGAAAGCGCTGAATTTCAGGCAGCCAAACAAGATCGATATTACGTTTTG
AACGACTTTCATTTATCACCGCTAAAGATTCACGTCAGTTTCTCTTTGAC
GGGTGGTTCCAAAGATGAAAATGCTATTGCTTCATTACATGGTAACGTGT
TGAACTTGTTGTTACAAAGTGTCGGACTGGCCTTCACTGAAATACAAGAC
GTACAATTCAAATTAGCATGTTACGAAGTGCATAAGTCCATGCAGAGTAA
TTCGCAGCTCGGTGATGGAATAACTAAACATTATCAAACACAGGCTATCA
AGCAACTTTATGTGTTGGTACTCGGGCTAGACGTTCTTGGTAATCCGTAT
GGTTTGATATCTGGTGTTGGAACCGGAGCAAAGAATTTCTTCTACGAACC
TTACCAGGGATTAATTCAAGGACCAGAAGAATTTGCGGAAGGATTGGCGT
ATGGGGTGAAGAGTCTTGTTGGTGGAACCGTGGGTGGAGTATCAGGAGCT
GTGAGTAAGATTACCGGTACCTTCGGTAAAGGTTTGGCTGCATTGACCTT
GGATGAAGAATATCAACAAAAGAGACGTGAAAACATGAGCCAACGCCCAA
CTAACCTCGGTGAAGGTCTCGCCAAAGGTGGTAAAGGCCTTGTAAAGGGT
ATCGTGTCTGGTGTTACAGGGATCGTTACCAAACCCTATGAAGGTGCCAA
GAATGATGGTGCAGGTGGCTTTTTTAAGGGCGTTGGAAAAGGCCTGATTG
GCGTGGTTGCACGCCCTGTTGGTGGAGTGGTAGATATGGCCAGTAACACG
TTTGATGGTTTGAAAAGCACGACATCTGGCGTGAAAGCGATCGAGTTGAG
CCGTGTTACTCGCGTCTTCCACGCAGATAAGGTTTTACGACCTTTCAATC
TGTACGAAGCAGATGGAAACAAAATTCTTATGCAATGTAACAAAGGAGAA
TACGCCAAGAAGAATTTTTATATCACTCATGTAGTGGACAAGAAGAACTA
TCTCATCCTCACTCAATCaaacATTTTGTATGTTGGAAAGAACGAGTTGA
AAATGGGTGAATGGGAATCggtttgggttatcgagttcaATGAGCTAAAA
CGTGAACCAGAAGTGAAAGAGACAAAGATTATTTTCCATATCCATAATAC
GGACACGCGACGTTCAATTTTCAAGAAATCGACGAACACACGTGAAGTGA
TATTGGAGTCTAGTGCTGTTGCAGACTGGTTTATCTTAAAGCTTAGAGAT
GCTAAAATGTTATAGatggtatttgaaTCTTTGGTTGCTGACCTCTTGAA
CAAGTATCTGGGTCAATATGTGAAAAATCTTGATGCTTCTCAATTGAAGA
TTGGCATTTGGGGAGGAAATGTTGTCCTGACAGAACTTGAACTGAAAGAT
ACAGCTCTGGATGATCTTGACTTACCCATAAAAGTTGTTCGTGGATATTT
GGgtAAATTGGTCTTGTCCATCCCATGGAAAAATCTTTACACTGAATCAA
CTGTTGTCGATATTCAAGATCTCCACCTTGTCGCTAAGCCTAATTTTGAC
ATCAAATACAATGAAGAACgcgaagaaaaatcaaaacatgacAAGAAACA
ACAACAGATTCACAATATCGAAGAAGCGAGGCAAAGAGAAGAAGACAAAA
AGAAAGGCGCCAAGAAAGAAGAGAGTGACGGTTTTGCTGAGAAACTTGCA
ACAAACGTCATAAAAAATCTACAGGTTACGATCAAGAACATACATGTTCG
ATATGAAGACTCAATCAGTGATGTGAATGGACCCTTTTCAGTCGGTCTTA
CAATGGAAAGTTTAACAGCACAAACCACAGATGAAGATTTTGTTCCAAAG
ATTATCAAAGAATCTGTCTCATTAATTCATAAGatggTGAAATTAGACAA
TTTGGCTTTATATTGGAATCCAGGAGACGAACTGATTGATCCTTCACTTG
ATACCAAGCAATGGTTGgaagtTTCAACGAAGCAAATTTCAACACACCAA
TCGAAGCCAGAGAAAACGAAATATATTTTGAGTCCCATGGTTGCAACGAA
GAAATTGAAGCTGAACACCAAACCAGGTTCCAACCTTGACATCCCGAAGa
tgttTTTGAACTTGGTTTTGGAAGAACTTGGTATCATCGTGGCAAGAAGT
CAATATCATGGCGTGGTGCAACTGATTGAATCATTTGAACGAATGAATAG
GAACCAACCTTTTCGTAAATACAGACCACATACCTCCGTTCTTGGGAACG
AAAGTATTTGGTGGAAGTACTGCATGTCCAGCATACTGGAGGTGGATGTC
AAAAGACGATCTCAAATGTGGAGCTGGAAGCATATTCAAAAACATCGAGT
TCTTTGCAAAGCTTACAAAGTGAAGTAcaaggaaaaattgaaacagaaaa
ATCCATCCAAACAAATTCTCACTGAACTAGAGaGCATGGAGGATGAGTTG
AATATTGCAAGCATCACCATTTTTCGACAGCTTGCAGCTACAGAGGTTTT
AACGGAACAAAAGAAGAAAGGCACTAAAGGAAGTTTCTTCAGTTTCTTCT
CCAGATCAAAAGAACCAGAAAAGTCTGCTGCTAATAAAATTGGAGATTTA
ATGGGTGATGACCAGGAGAAGGAAATGCAGAAATTGTATGACGCAATCGG
TTATACTGAAAATGAAGTCATCACTCCCTTTCCTAAAGAGTACGTGGCGA
TGTCAGTGGAATCGATTCTCCAGAAATTATTCATCAGCCTCATCGATGAC
ACAGATAAGGCGAAAGAATTCAAAGTGTTGGATTTTTCACTCAACAACAT
CATTGTAGAAGTTTTCCAAAGACCTTCTGCTCAAGCTCTCAAATTATGTG
CAAAGATAGGAGAGATGAAGTTATTTGGTACAGCTTCTGCTCAATGTACA
CCTCtcatcatcaaaaacatgttaCAAGGTCGAGGTATGGAATTTCTGCC
GTTGGTGGACTTCATCTTTGAGACGAATCCTTTGAAGAAACCGGACATTG
ACCAATGTATCACTGCTATTTGTCAACCCTTAGAAATCATCTATGATGCT
AACACGATCAACCATATCATTAGTTTCTTCAAACCTCCTGAACATGTTAT
CTTGCAAGATTTACAAGACAAAGCGTATTCTACTTTCGAAGATTTTAAAG
TTTCAAGTACGGCTGGTCTTCTACATGCTATGGAACAAAGAACGGTTATG
GACATCGACATTGATGTTGGAGCATCTCATTTGATCATCCCTGAAAAAGG
TTCTTACAATGGTTGTACAGATATGCTGGTGATCGACTTTGGTAAAATCA
CGATGAGCAGCGATCCTAGTCAAATCAGACACCTTGACCCTAAGGACATT
GAGGATGTGAATGAAGTACAAAGCAAAGCTTATGATCGATTCTTGTTGTC
GCTTCAAGCTCTTCAAATATTACTCGTTAGAGAAGGTGAAGATTTAAAGA
GTGCTAAAAGCAACGTCAGTAAAGCTTCATCACACATTTTGCATCCCATC
AATTTCGATGGCAAACTTGCCAAAGCTATACTTCCACAAGATCCACGTTT
AAAACAGATATGTGTCTCTGGTGAATTATCTTCGCTGTTTGTTTCTGTAT
CGGATGATAAAGTCAGTCGTCTCATCAAGCTAGCAGACTCGATACCACTC
CCTCAATCACCTTCTCACGATAACATCGACGGAGAAGAAAAACCTGAAGG
ACTCTTCACCAAGGCGTTGTCAATGATAAGCTTGACAGGTGACAATGACA
CAGGGGTGGACATCGGAGGATTTTCCATCCCTGTACCGACATCTCCAACA
TCAGTGACGTCAGATGAAGATGAATACGGGACACCACCTGATGGCTCCAT
ATTACAGTTACAACAAGAAGCTGGTCCGGACTTTTCATCAGGAGTGGCGA
ACCAAGTCAAAGTGGACTTGAACTTTAAAATCCATAAAGTGATGATCGCC
ATTGGTTTGACTGACAAAGCATTGAAACAGGAAAAAGAATGTCTGAAATT
CATCGTGGACGACATCAATACAGAGgtGATACTACGAAGATGGGATTTGT
TCGTCAATGCAGAAGTTGGTCGTCTGGTGTTGAATGAAATGACATGGGGT
GTTGATGGAGAACCTTTCGCCATCATGAGTACacccaaaaacaccaaaat
gttGAAATTCAGCTATCGGAGGTGTGAATTCAACGAAAGTTTGAATCTCG
GTCCAAGTTACTTTTATTCCAAAGAAGCGCAAGTCAGAGCTTTACATTTC
AAAGATGAATTTGGCGCCACGGATCAGATTTTAGATGTACAAGTGGCTAC
TTTATTTCTGATGCTTCATCAAGAAGCACTTTTGAGCATCATGTCATTGA
TCTACCAAGTACTGGAACCACTCAACAAACATGATAAGGAAGCCACACAG
AAGATCAAACGGAGTTTGAGTACGGCAGGTAGTCGTTTGAGTCTCTCCat
cgaagaaaaagaaaaggagaGACAGATACAACGAAAATTAGCCAACCCTA
AAGCACTGGAAGCTGCCAACGAACTTAAGCAACAGGTTGGcttagaagaa
gaaaaaaagatgaGAGTGACCGCCCACCTGGATGGTGTTGGTATCATGAT
TTGTTCAGCCAAAGTTGACCTTGCACAAGCCTTCGTTAAAGGGTTATCTG
CTAAAGTACTGATGAAAGATGACTTATTAGAAGTGAAAGCCAGCATGAAA
GATATGCAAGTACAAGATAATGTTGGCGAAACAAAGTACAAAGACATCAT
TAGCATGCGATCTGATGAAGTGTTCGATTTAGAGTTGGCTATTTACGAGA
ATGGATCTTCTGGTAGCAAGCAATACGATATGTCGTGTGTCGACACCAGT
GTCAAACTGAACTTCGGTCAAATGCGCGTTGTTTTCTTGTATAGATTCAT
ACAAGACTTAATGTCATTCACCGAAAACTTCGAAGAAGCACAGAAAGCAG
TTGTGGAAGCTGGTAAAGCTGCCAAGGATAAAGCTCTGGAAACAGCGACC
GATTTGAATAGACATTCTTCTCGTGTCAAACTAAATGTGGTTCTGAAAGC
ACCGACTATTATCATTCCAGTTGGATCAAACAATGAATTGGCTTTACTGG
TGGATCTGGGTGAATTGCGTATTTACAACACATTCAAACTCCTCAACGAT
GATCAATACCATAAGAAATCTATCATCACTGATAACATGACCATTAAGTT
ATCCAATCTGAAATTGTTAAAAGCACTTATTCAAGATGGTAAAGATTTCT
TGCATCAACGAGCCATTATTGAACCTATGATGCTACAAATAACTATTGTT
CGTAATTTAACGAAAGGTAACCATTCCATACCGGATGTTTCAGTTCAAGC
AAAGATGCCAGCTATTCTGTTATCAATCAGTGAAGAAGATGTGACCGTAG
CTCTAAAGATTGTCCAAGGGAATCTCGCCGAAGGTGAGTCACATGCGCCG
AAGAAGCAAGCCAAGCCTGCCAAACAAACGTTAAACGTGCCACAAGATCG
TTTAGCAGACATTTACGAGGAGcctgaagatgaagatgagaaTCGACAAG
GATATCTTCAAACCAAACTATCCTTCGATCTGGCTAAAATTGACATCAAG
CTTTACTTGAAACCATCTGATATGACATTTGAAGATGAATTTTTAGCGAG
GACGGATGATTTGTTGTTAGCTTTGTTCACTATTGGTAACCTGTGTGTTG
ATGGAGACATCATGTCCACGCAAGCTATGAAGATGAGCGTTCGATTGGAC
ACTTTGGTGTTGGATGATATGAGACCTATCGAGGAGCATGAAGGTGTTAA
ACGTATGATCAACTACAGTCCCGAGCCACTCCTTGAAGAAGTCAAAACCT
CTTCTCATAAACGACCAATCGACAACTCACGAATGATCGAAATCCAAttc
gatcaaacttcatcgcaagataaaaatatcgacATCAAACTTTGTAACAT
GCTTTGTATATTCAACGTTGAGTTTATCATGGTCCTGTTGAAAACGTTGC
AAGCTGCCATACCTAAAGATGATAGTCTGCAACATGGCCATTCAATGAGT
AGTCTAGACTCGGCGGCAGGGTCTGGCGGCAGCGATGACGAGGACTCTTT
AGAAGCCAGCGAGATTGTCCTCTGCACTGGTGATCAAGAAAGACCTGAGA
CTAAAGTCTCTATCTTCGTCCATAACCCGCAAATTGTTTTACTAGCAGAT
GCAAAGGATGTCAAAACAAATGCACTCTTTCTTACAACCGagatcaattt
tcaatatttcgaaTTGCGAGATACTCAAAAAATGATTGGCGCTGTTTCTA
ACACCGCTATTTTGTCAACTGCTTTCAAGAATGACCATCGGAGTGATATA
TCAACAGTGTTGTCATTAGATTCCATCAATCTCCACTCGTCATCACCCAT
CAATGGTAAACCTCATATGAGTGTCAGCACAACTTTGATCAAACTGAATA
TCTCACCCAAAACCATCCGAACTTTATCAGCGTGTGCTGGTTACATCTCC
AATGATCCAACAGATGAAGAAATCAAAGAAGCTCGAAAAGCCATGCGTGA
TTTATGGCAAATTCAAACGTTCACCAATAAGCGACCGTGGTATTTAAACC
ACCCACCACAACAAGTCTTAAGTGCTGGCAGCTTCGTCCTTGCGCGAACG
AGAACAGGAGAATATAAGCATGGTTTCTTAGCTAAAAAGGATGTCTCGTA
TCAAGTCTATTTTTCAGAGGAGCGAGGAACAGCCAGTCACCGAGCCATGG
ATATCTCATCTGTTGTTTTGGATATCGTACCGCTGATCGGTGATCTATGT
GTTGGATGTAATGTTTTAGCTGTGGAATCGAAAGAACATGGATATCGTAC
TGGTCGAATTACTCAGGTTTGGGATTCGAATGTGGATAAAGATTCTTCGG
ATGGCGCCAAACAATCTGTTTCTGTCAAGACAACTGCTATTGCTCCAATC
AAATACCTTGTCAATTTCTATGACAACCAAACGGAGAACTTCTTCCCGCC
TGATGAACTTCGTATCATTGGTAAACCCATCAAGGGGGTTGTCCCTGGAC
TAGGGGCGTGTGTTTACGCCCGCTTTAATGATGGTTTTTACTATCGGGGC
AAAGTTGATGACATCGAGGATTATCGAATCCGAGTGCAATTGGATGAGAT
CAGTGGAGAAATCGAACACGACATCGATGATCCGTCAGCCGTTATTTTGA
ACCTGACGCCTCAATACCGTCAAGTCAAAAAGCATTTCAAAGTCATTGCA
TCCAAAGGAAGCACAACTAAAGGATATCATCCGGGGAAAGTGACCGCCAT
CCAAGGTGAAGGAAATAACCGATTGTATTCGATACGCTTCGAAGACGGTA
CAATTAACCAAGTACCCATCacgaaattgattttgatgccAAAAGCACCT
TTTGATGCTTTACCTGAAGTTGGCACATACGTTTATTCCCGAGTGTCACG
CGACGCTCCTTTATACGAGAAGGGTATCGTAGCAGAGAAGAACACAATGA
TCTGCGTTAAACATTTAAATGGACGGAAATTGGCTCACGAAATACAAAAC
ATTCATTTTGTTGTCCGAAATATCGTTCCTCTCGTGTCATCAttgaagGT
TGGTTTGGACGTCATAGTGCAACCTGACAATGACGATCAGAAAATGTATT
TGGCTGTCATTAGGGAAGTCACCAAAAAAGAAGGTGACAAAACGAACCGT
TATCTAGTGGAGTTTACGGATGGATCCAAGAAGAGAGTGACGCCCAGCCG
GATCCGTATACTTTCTCAATACGGAAGTGCAGAAACGAGTGAAGAAAATG
CTGACATTATCACAACAAGACAGGAGGAACTAGTTCTCGATGTGCAAGGT
ATCTCATTACGTGTGGAAGGTTACTTGGGAGGCGTGTTGACACCCATGCT
CAAAATGGATTCCAAAATCACAGCTAACTTGAAGGATTGGTCAAGCCAAA
TGAATGCACACGCTACTGTATCATTAGAAGCCAGTTATTATAACGAAAAC
GTTGCCGAATGGGAGCCAGTTATTGAACCTTTGATGGAGAAACGGAGGGA
AAGACCGTGGCAACTCTCTGTCAATTACACGATGGAAGGTGACGACAATT
CTGCTTCATCCACTTCCAACGAACTCGTTTTACAAAAACCGGAATCCAAC
CTGAAAATCAAATCTCAAGATAATCTTGAATTGACAATTTCAAAATCATG
TCTTGCTTTACTCGGTGAATTGGGACAGGTGTTTGGAGATGCAGTAGAAT
CTGTGGACGTTTTACCACAAGTCCTGGTCGAAAAAGAACCTTTCATGATC
GAAAACTTGCTCTCCAAGAAGGTGACAGTAACATTGAATGAACTTCTGCA
GGGACCAAATGGAGATTCGACAATCGAGCTAGCATCTTCTTCGAATCCTG
TTGGCATTACTTTTGCTCCCAagaaatttgagaaacgaaAGACCAACGAT
CTATACACAATCAATTTAtcgGTGGACGGTTTTCATGACATTAAAGACAT
TGTGGTTCAAAGAAAGCGAAGCGTTATCTATGATCTTGTACCAATAAAAC
TATTATCAGCACAGTCTTCATATTCGATAGTGGTACAAGTGAAGACAACA
GACGGACAACGTATCATCGTACTCCGATCACCATTGCAGTTGAAAAATCA
CTTTCCAATGCCGTTGGATGTCAGCTACATTTCCAAAGAAAACCAACCAG
TTAAACTGACAACAGTGGGATCGGGAGATATCTATTCCTTCCCTTTGTTG
TTAACCTACCACAGTGTTTTTCATCTCAAACCTGCTGGTTTCGACTACGG
TGATTGCACAGAAGCTCTCAATTGGAGTGATTTGAAGACGAGCAACGAAA
AACAGTTCTCCTGCCCTTCACCTGACAAAAGTGCTGACCCTTTCTACATG
CAGGTGGTGATGAAAGAGGAGACGTACTCTTCCGTACACGGCATGTTGGA
CTGTGTACCACGTTACACGTTGGAGTGCTTTCCCGTCATCACGCTGCATA
ATTACCTACCTTGCACTATTAATTATAAGATCAAGGGTATGGCGAAATCG
GAAAGTCTACCAGGCGGACACAATTGGCCTTTGTTTACCGTCAACTTCAG
TGATAAACCTTCCATCTATATCGAGATTGAGTCGTATAACAACCAAAGAT
GGGAAGGAGGTTTGACATTACCAACAAAACCGGTAGATTCTTTGAACAAA
CCATCATTATCTTTCGTCATGATGTCTGGTGAACGCAAAATGGAATTGGG
TGTTTATTACCAGTTAGACGGTTCATTGAACATCACCTTATATTCGCCTT
ACTGGCTTCTCAATAAAACTGGAAAACCACTTGTCTATCAGCCAGCGGGG
AGCAGCATCCAGCAAGTTCACCAAGAGAACGATGTAAATGCTCTTATGAT
GCTCGTCAAAGGGAAACATAAAAAGgcgaaagtgaaagtgaaaaataGCG
AGTCATGGTCAAATGAATTTTCATTGGATACTGTTGGCAGTGGTGGTTCC
TTGAAATGCAATGGTCCAAGAGATCGAGTTTATGAGATTGGTTTGAACAT
CAGTTTGTCATACTTTGGATTGACGAAGATTGTGACGTTCACGCCACTCC
GAATGTTATCTAACCACACCAAGTACACCATCAGTATGGCAGAAAGTAAT
TCTAAATCGTCAGAATGGCACACGGTAAACCCTGACGAGaacattccatT
CTGGCCGACGAAACTTCCTTTGGTCAACCTTTACATTAACATCAATGGGC
AAGATTCAGTGAAATTCAACCCTGAAGTTGGAAAAACTTTACTGTTGAAG
TTCCAGAATGAGGTTGGAGGAGTTTGCGTGGATTACCAAGAAAAGGACTC
GTCCTCAGTCCTTTCGTTTAATCCGTACTTCGCAGGTGCAGCTCCTGTGC
GGCttgaaaatctttgcaaaaaGATCGGCATGATCGCTTATAAACAAGCA
GGTTCGGTAATGGGTCACGTGTTAACACATGACCAATCAGTGTTGTACAC
GTGGGATGATCCAACCATGGAACAAGAATTGATTTGTTCCATTGTCAATG
ATGAAGCCAGTGAAACAAGGATCAAACTCGATGCCAACGATTTCGGACGA
ATGAGAGTTGGAGATGGTGCAATTTATTGGGTTTCCTTTCTGGATGGTCT
TCAACGTGTTCTATTGTTCACTGATAACTTCAAATCTGCTTACTGCGCAT
GTCAGgaGCAAAATTTACGCCCAACCATGGAAGTTGACTTTGAGATTGAG
AGTTTTGGTTTGTCTCTGGTCAATGTTGATAAGAGAATGGAGATTGGCTA
CTTAGCTATCCGACAAAGCAAGACTGTATGGGAGCAACGCAAGAAAAAGA
ACCGCTGGAAAGCTTTACCGCTTGCCATGTGTGAAGCTCTCGAAGAAGGT
TATCTCAATTATCAAAACAGAAAAGGTGCAGTCAAAGAGAAAGTTCTGGA
TAAGGAGGTGGATTACGAGAAGATGTTTATTACGAAACCTGAGAAGATTA
AGATCAGAAGAACGTACCACAGCGGTCTTGGTTTCAAATACACAATCTCA
CCCAATGAAATGCGTGTGCATGCTTCTATCAGCTCAATACAGTTGGATAG
CCATGTTCCAGGTTCGACCTTTCCAACAGTCTTGCATATGGTTGAACCAC
CAAAATCTGTTGCTTCAGAAAACGCTCCAAAGCCATTCTttgaattgagt
ttaatgaCAAGGATCGGTGATAAAAATGTGGTCAATGAAGTcagCTATTG
TCACGTGTTGATTCAAGAGATGGATGTGAGGGTTGATATTGGATTTTTAT
TGGCTCTGATGGAACTCTTCAGTCATGCAAGAGCTCGAACAACCGAGAAA
GAACAATACGCGCTTGATATTGGCCAAGCAGCAACAAAGTTTGAAGAAAG
CGCTGAATTTCAGGCAGCCAAACAAGATCGATATTACGTTTTGAACGACT
TTCATTTATCACCGCTAAAGATTCACGTCAGTTTCTCTTTGACGGGTGGT
TCCAAAGATGAAAATGCTATTGCTTCATTACATGGTAACGTGTTGAACTT
GTTGTTACAAAGTGTCGGACTGGCCTTCACTGAAATACAAGACGTACAAT
TCAAATTAGCATGTTACGAAGTGCATAAGTCCATGCAGAGTAATTCGCAG
CTCGGTGATGGAATAACTAAACATTATCAAACACAGGCTATCAAGCAACT
TTATGTGTTGGTACTCGGGCTAGACGTTCTTGGTAATCCGTATGGTTTGA
TATCTGGTGTTGGAACCGGAGCAAAGAATTTCTTCTACGAACCTTACCAG
GGATTAATTCAAGGACCAGAAGAATTTGCGGAAGGATTGGCGTATGGGGT
GAAGAGTCTTGTTGGTGGAACCGTGGGTGGAGTATCAGGAGCTGTGAGTA
AGATTACCGGTACCTTCGGTAAAGGTTTGGCTGCATTGACCTTGGATGAA
GAATATCAACAAAAGAGACGTGAAAACATGAGCCAACGCCCAACTAACCT
CGGTGAAGGTCTCGCCAAAGGTGGTAAAGGCCTTGTAAAGGGTATCGTGT
CTGGTGTTACAGGGATCGTTACCAAACCCTATGAAGGTGCCAAGAATGAT
GGTGCAGGTGGCTTTTTTAAGGGCGTTGGAAAAGGCCTGATTGGCGTGGT
TGCACGCCCTGTTGGTGGAGTGGTAGATATGGCCAGTAACACGTTTGATG
GTTTGAAAAGCACGACATCTGGCGTGAAAGCGATCGAGTTGAGCCGTGTT
ACTCGCGTCTTCCACGCAGATAAGGTTTTACGACCTTTCAATCTGTACGA
AGCAGATGGAAACAAAATTCTTATGCAATGTAACAAAGGAGAATACGCCA
AGAAGAATTTTTATATCACTCATGTAGTGGACAAGAAGAACTATCTCATC
CTCACTCAATCaaacATTTTGTATGTTGGAAAGAACGAGTTGAAAATGGG
TGAATGGGAATCggtttgggttatcgagttcaATGAGCTAAAACGTGAAC
CAGAAGTGAAAGAGACAAAGATTATTTTCCATATCCATAATACGGACACG
CGACGTTCAATTTTCAAGAAATCGACGAACACACGTGAAGTGATATTGGA
GTCTAGTGCTGTTGCAGACTGGTTTATCTTAAAGCTTAGAGATGCTAAAA
TGTTATAGatggtatttgaaTCTTTGGTTGCTGACCTCTTGAACAAGTAT
CTGGGTCAATATGTGAAAAATCTTGATGCTTCTCAATTGAAGATTGGCAT
TTGGGGAGGAAATGTTGTCCTGACAGAACTTGAACTGAAAGATACAGCTC
TGGATGATCTTGACTTACCCATAAAAGTTGTTCGTGGATATTTGGgtAAA
TTGGTCTTGTCCATCCCATGGAAAAATCTTTACACTGAATCAACTGTTGT
CGATATTCAAGATCTCCACCTTGTCGCTAAGCCTAATTTTGACATCAAAT
ACAATGAAGAACgcgaagaaaaatcaaaacatgacAAGAAACAACAACAG
ATTCACAATATCGAAGAAGCGAGGCAAAGAGAAGAAGACAAAAAGAAAGG
CGCCAAGAAAGAAGAGAGTGACGGTTTTGCTGAGAAACTTGCAACAAACG
TCATAAAAAATCTACAGGTTACGATCAAGAACATACATGTTCGATATGAA
GACTCAATCAGTGATGTGAATGGACCCTTTTCAGTCGGTCTTACAATGGA
AAGTTTAACAGCACAAACCACAGATGAAGATTTTGTTCCAAAGATTATCA
AAGAATCTGTCTCATTAATTCATAAGatggTGAAATTAGACAATTTGGCT
TTATATTGGAATCCAGGAGACGAACTGATTGATCCTTCACTTGATACCAA
GCAATGGTTGgaagtTTCAACGAAGCAAATTTCAACACACCAATCGAAGC
CAGAGAAAACGAAATATATTTTGAGTCCCATGGTTGCAACGAAGAAATTG
AAGCTGAACACCAAACCAGGTTCCAACCTTGACATCCCGAAGatgttTTT
GAACTTGGTTTTGGAAGAACTTGGTATCATCGTGGCAAGAAGTCAATATC
ATGGCGTGGTGCAACTGATTGAATCATTTGAACGAATGAATAGGAACCAA
CCTTTTCGTAAATACAGACCACATACCTCCGTTCTTGGGAACGAAAGTAT
TTGGTGGAAGTACTGCATGTCCAGCATACTGGAGGTGGATGTCAAAAGAC
GATCTCAAATGTGGAGCTGGAAGCATATTCAAAAACATCGAGTTCTTTGC
AAAGCTTACAAAGTGAAGTAcaaggaaaaattgaaacagaaaaATCCATC
CAAACAAATTCTCACTGAACTAGAGaGCATGGAGGATGAGTTGAATATTG
CAAGCATCACCATTTTTCGACAGCTTGCAGCTACAGAGGTTTTAACGGAA
CAAAAGAAGAAAGGCACTAAAGGAAGTTTCTTCAGTTTCTTCTCCAGATC
AAAAGAACCAGAAAAGTCTGCTGCTAATAAAATTGGAGATTTAATGGGTG
ATGACCAGGAGAAGGAAATGCAGAAATTGTATGACGCAATCGGTTATACT
GAAAATGAAGTCATCACTCCCTTTCCTAAAGAGTACGTGGCGATGTCAGT
GGAATCGATTCTCCAGAAATTATTCATCAGCCTCATCGATGACACAGATA
AGGCGAAAGAATTCAAAGTGTTGGATTTTTCACTCAACAACATCATTGTA
GAAGTTTTCCAAAGACCTTCTGCTCAAGCTCTCAAATTATGTGCAAAGAT
AGGAGAGATGAAGTTATTTGGTACAGCTTCTGCTCAATGTACACCTCtca
tcatcaaaaacatgttaCAAGGTCGAGGTATGGAATTTCTGCCGTTGGTG
GACTTCATCTTTGAGACGAATCCTTTGAAGAAACCGGACATTGACCAATG
TATCACTGCTATTTGTCAACCCTTAGAAATCATCTATGATGCTAACACGA
TCAACCATATCATTAGTTTCTTCAAACCTCCTGAACATGTTATCTTGCAA
GATTTACAAGACAAAGCGTATTCTACTTTCGAAGATTTTAAAGTTTCAAG
TACGGCTGGTCTTCTACATGCTATGGAACAAAGAACGGTTATGGACATCG
ACATTGATGTTGGAGCATCTCATTTGATCATCCCTGAAAAAGGTTCTTAC
AATGGTTGTACAGATATGCTGGTGATCGACTTTGGTAAAATCACGATGAG
CAGCGATCCTAGTCAAATCAGACACCTTGACCCTAAGGACATTGAGGATG
TGAATGAAGTACAAAGCAAAGCTTATGATCGATTCTTGTTGTCGCTTCAA
GCTCTTCAAATATTACTCGTTAGAGAAGGTGAAGATTTAAAGAGTGCTAA
AAGCAACGTCAGTAAAGCTTCATCACACATTTTGCATCCCATCAATTTCG
ATGGCAAACTTGCCAAAGCTATACTTCCACAAGATCCACGTTTAAAACAG
ATATGTGTCTCTGGTGAATTATCTTCGCTGTTTGTTTCTGTATCGGATGA
TAAAGTCAGTCGTCTCATCAAGCTAGCAGACTCGATACCACTCCCTCAAT
CACCTTCTCACGATAACATCGACGGAGAAGAAAAACCTGAAGGACTCTTC
ACCAAGGCGTTGTCAATGATAAGCTTGACAGGTGACAATGACACAGGGGT
GGACATCGGAGGATTTTCCATCCCTGTACCGACATCTCCAACATCAGTGA
CGTCAGATGAAGATGAATACGGGACACCACCTGATGGCTCCATATTACAG
TTACAACAAGAAGCTGGTCCGGACTTTTCATCAGGAGTGGCGAACCAAGT
CAAAGTGGACTTGAACTTTAAAATCCATAAAGTGATGATCGCCATTGGTT
TGACTGACAAAGCATTGAAACAGGAAAAAGAATGTCTGAAATTCATCGTG
GACGACATCAATACAGAGgtGATACTACGAAGATGGGATTTGTTCGTCAA
TGCAGAAGTTGGTCGTCTGGTGTTGAATGAAATGACATGGGGTGTTGATG
GAGAACCTTTCGCCATCATGAGTACacccaaaaacaccaaaatgttGAAA
TTCAGCTATCGGAGGTGTGAATTCAACGAAAGTTTGAATCTCGGTCCAAG
TTACTTTTATTCCAAAGAAGCGCAAGTCAGAGCTTTACATTTCAAAGATG
AATTTGGCGCCACGGATCAGATTTTAGATGTACAAGTGGCTACTTTATTT
CTGATGCTTCATCAAGAAGCACTTTTGAGCATCATGTCATTGATCTACCA
AGTACTGGAACCACTCAACAAACATGATAAGGAAGCCACACAGAAGATCA
AACGGAGTTTGAGTACGGCAGGTAGTCGTTTGAGTCTCTCCatcgaagaa
aaagaaaaggagaGACAGATACAACGAAAATTAGCCAACCCTAAAGCACT
GGAAGCTGCCAACGAACTTAAGCAACAGGTTGGcttagaagaagaaaaaa
agatgaGAGTGACCGCCCACCTGGATGGTGTTGGTATCATGATTTGTTCA
GCCAAAGTTGACCTTGCACAAGCCTTCGTTAAAGGGTTATCTGCTAAAGT
ACTGATGAAAGATGACTTATTAGAAGTGAAAGCCAGCATGAAAGATATGC
AAGTACAAGATAATGTTGGCGAAACAAAGTACAAAGACATCATTAGCATG
CGATCTGATGAAGTGTTCGATTTAGAGTTGGCTATTTACGAGAATGGATC
TTCTGGTAGCAAGCAATACGATATGTCGTGTGTCGACACCAGTGTCAAAC
TGAACTTCGGTCAAATGCGCGTTGTTTTCTTGTATAGATTCATACAAGAC
TTAATGTCATTCACCGAAAACTTCGAAGAAGCACAGAAAGCAGTTGTGGA
AGCTGGTAAAGCTGCCAAGGATAAAGCTCTGGAAACAGCGACCGATTTGA
ATAGACATTCTTCTCGTGTCAAACTAAATGTGGTTCTGAAAGCACCGACT
ATTATCATTCCAGTTGGATCAAACAATGAATTGGCTTTACTGGTGGATCT
GGGTGAATTGCGTATTTACAACACATTCAAACTCCTCAACGATGATCAAT
ACCATAAGAAATCTATCATCACTGATAACATGACCATTAAGTTATCCAAT
CTGAAATTGTTAAAAGCACTTATTCAAGATGGTAAAGATTTCTTGCATCA
ACGAGCCATTATTGAACCTATGATGCTACAAATAACTATTGTTCGTAATT
TAACGAAAGGTAACCATTCCATACCGGATGTTTCAGTTCAAGCAAAGATG
CCAGCTATTCTGTTATCAATCAGTGAAGAAGATGTGACCGTAGCTCTAAA
GATTGTCCAAGGGAATCTCGCCGAAGGTGAGTCACATGCGCCGAAGAAGC
AAGCCAAGCCTGCCAAACAAACGTTAAACGTGCCACAAGATCGTTTAGCA
GACATTTACGAGGAGcctgaagatgaagatgagaaTCGACAAGGATATCT
TCAAACCAAACTATCCTTCGATCTGGCTAAAATTGACATCAAGCTTTACT
TGAAACCATCTGATATGACATTTGAAGATGAATTTTTAGCGAGGACGGAT
GATTTGTTGTTAGCTTTGTTCACTATTGGTAACCTGTGTGTTGATGGAGA
CATCATGTCCACGCAAGCTATGAAGATGAGCGTTCGATTGGACACTTTGG
TGTTGGATGATATGAGACCTATCGAGGAGCATGAAGGTGTTAAACGTATG
ATCAACTACAGTCCCGAGCCACTCCTTGAAGAAGTCAAAACCTCTTCTCA
TAAACGACCAATCGACAACTCACGAATGATCGAAATCCAAttcgatcaaa
cttcatcgcaagataaaaatatcgacATCAAACTTTGTAACATGCTTTGT
ATATTCAACGTTGAGTTTATCATGGTCCTGTTGAAAACGTTGCAAGCTGC
CATACCTAAAGATGATAGTCTGCAACATGGCCATTCAATGAGTAGTCTAG
ACTCGGCGGCAGGGTCTGGCGGCAGCGATGACGAGGACTCTTTAGAAGCC
AGCGAGATTGTCCTCTGCACTGGTGATCAAGAAAGACCTGAGACTAAAGT
CTCTATCTTCGTCCATAACCCGCAAATTGTTTTACTAGCAGATGCAAAGG
ATGTCAAAACAAATGCACTCTTTCTTACAACCGagatcaattttcaatat
ttcgaaTTGCGAGATACTCAAAAAATGATTGGCGCTGTTTCTAACACCGC
TATTTTGTCAACTGCTTTCAAGAATGACCATCGGAGTGATATATCAACAG
TGTTGTCATTAGATTCCATCAATCTCCACTCGTCATCACCCATCAATGGT
AAACCTCATATGAGTGTCAGCACAACTTTGATCAAACTGAATATCTCACC
CAAAACCATCCGAACTTTATCAGCGTGTGCTGGTTACATCTCCAATGATC
CAACAGATGAAGAAATCAAAGAAGCTCGAAAAGCCATGCGTGATTTATGG
CAAATTCAAACGTTCACCAATAAGCGACCGTGGTATTTAAACCACCCACC
ACAACAAGTCTTAAGTGCTGGCAGCTTCGTCCTTGCGCGAACGAGAACAG
GAGAATATAAGCATGGTTTCTTAGCTAAAAAGGATGTCTCGTATCAAGTC
TATTTTTCAGAGGAGCGAGGAACAGCCAGTCACCGAGCCATGGATATCTC
ATCTGTTGTTTTGGATATCGTACCGCTGATCGGTGATCTATGTGTTGGAT
GTAATGTTTTAGCTGTGGAATCGAAAGAACATGGATATCGTACTGGTCGA
ATTACTCAGGTTTGGGATTCGAATGTGGATAAAGATTCTTCGGATGGCGC
CAAACAATCTGTTTCTGTCAAGACAACTGCTATTGCTCCAATCAAATACC
TTGTCAATTTCTATGACAACCAAACGGAGAACTTCTTCCCGCCTGATGAA
CTTCGTATCATTGGTAAACCCATCAAGGGGGTTGTCCCTGGACTAGGGGC
GTGTGTTTACGCCCGCTTTAATGATGGTTTTTACTATCGGGGCAAAGTTG
ATGACATCGAGGATTATCGAATCCGAGTGCAATTGGATGAGATCAGTGGA
GAAATCGAACACGACATCGATGATCCGTCAGCCGTTATTTTGAACCTGAC
GCCTCAATACCGTCAAGTCAAAAAGCATTTCAAAGTCATTGCATCCAAAG
GAAGCACAACTAAAGGATATCATCCGGGGAAAGTGACCGCCATCCAAGGT
GAAGGAAATAACCGATTGTATTCGATACGCTTCGAAGACGGTACAATTAA
CCAAGTACCCATCacgaaattgattttgatgccAAAAGCACCTTTTGATG
CTTTACCTGAAGTTGGCACATACGTTTATTCCCGAGTGTCACGCGACGCT
CCTTTATACGAGAAGGGTATCGTAGCAGAGAAGAACACAATGATCTGCGT
TAAACATTTAAATGGACGGAAATTGGCTCACGAAATACAAAACATTCATT
TTGTTGTCCGAAATATCGTTCCTCTCGTGTCATCAttgaagGTTGGTTTG
GACGTCATAGTGCAACCTGACAATGACGATCAGAAAATGTATTTGGCTGT
CATTAGGGAAGTCACCAAAAAAGAAGGTGACAAAACGAACCGTTATCTAG
TGGAGTTTACGGATGGATCCAAGAAGAGAGTGACGCCCAGCCGGATCCGT
ATACTTTCTCAATACGGAAGTGCAGAAACGAGTGAAGAAAATGCTGACAT
TATCACAACAAGACAGGAGGAACTAGTTCTCGATGTGCAAGGTATCTCAT
TACGTGTGGAAGGTTACTTGGGAGGCGTGTTGACACCCATGCTCAAAATG
GATTCCAAAATCACAGCTAACTTGAAGGATTGGTCAAGCCAAATGAATGC
ACACGCTACTGTATCATTAGAAGCCAGTTATTATAACGAAAACGTTGCCG
AATGGGAGCCAGTTATTGAACCTTTGATGGAGAAACGGAGGGAAAGACCG
TGGCAACTCTCTGTCAATTACACGATGGAAGGTGACGACAATTCTGCTTC
ATCCACTTCCAACGAACTCGTTTTACAAAAACCGGAATCCAACCTGAAAA
TCAAATCTCAAGATAATCTTGAATTGACAATTTCAAAATCATGTCTTGCT
TTACTCGGTGAATTGGGACAGGTGTTTGGAGATGCAGTAGAATCTGTGGA
CGTTTTACCACAAGTCCTGGTCGAAAAAGAACCTTTCATGATCGAAAACT
TGCTCTCCAAGAAGGTGACAGTAACATTGAATGAACTTCTGCAGGGACCA
AATGGAGATTCGACAATCGAGCTAGCATCTTCTTCGAATCCTGTTGGCAT
TACTTTTGCTCCCAagaaatttgagaaacgaaAGACCAACGATCTATACA
CAATCAATTTAtcgGTGGACGGTTTTCATGACATTAAAGACATTGTGGTT
CAAAGAAAGCGAAGCGTTATCTATGATCTTGTACCAATAAAACTATTATC
AGCACAGTCTTCATATTCGATAGTGGTACAAGTGAAGACAACAGACGGAC
AACGTATCATCGTACTCCGATCACCATTGCAGTTGAAAAATCACTTTCCA
ATGCCGTTGGATGTCAGCTACATTTCCAAAGAAAACCAACCAGTTAAACT
GACAACAGTGGGATCGGGAGATATCTATTCCTTCCCTTTGTTGTTAACCT
ACCACAGTGTTTTTCATCTCAAACCTGCTGGTTTCGACTACGGTGATTGC
ACAGAAGCTCTCAATTGGAGTGATTTGAAGACGAGCAACGAAAAACAGTT
CTCCTGCCCTTCACCTGACAAAAGTGCTGACCCTTTCTACATGCAGGTGG
TGATGAAAGAGGAGACGTACTCTTCCGTACACGGCATGTTGGACTGTGTA
CCACGTTACACGTTGGAGTGCTTTCCCGTCATCACGCTGCATAATTACCT
ACCTTGCACTATTAATTATAAGATCAAGGGTATGGCGAAATCGGAAAGTC
TACCAGGCGGACACAATTGGCCTTTGTTTACCGTCAACTTCAGTGATAAA
CCTTCCATCTATATCGAGATTGAGTCGTATAACAACCAAAGATGGGAAGG
AGGTTTGACATTACCAACAAAACCGGTAGATTCTTTGAACAAACCATCAT
TATCTTTCGTCATGATGTCTGGTGAACGCAAAATGGAATTGGGTGTTTAT
TACCAGTTAGACGGTTCATTGAACATCACCTTATATTCGCCTTACTGGCT
TCTCAATAAAACTGGAAAACCACTTGTCTATCAGCCAGCGGGGAGCAGCA
TCCAGCAAGTTCACCAAGAGAACGATGTAAATGCTCTTATGATGCTCGTC
AAAGGGAAACATAAAAAGgcgaaagtgaaagtgaaaaataGCGAGTCATG
GTCAAATGAATTTTCATTGGATACTGTTGGCAGTGGTGGTTCCTTGAAAT
GCAATGGTCCAAGAGATCGAGTTTATGAGATTGGTTTGAACATCAGTTTG
TCATACTTTGGATTGACGAAGATTGTGACGTTCACGCCACTCCGAATGTT
ATCTAACCACACCAAGTACACCATCAGTATGGCAGAAAGTAATTCTAAAT
CGTCAGAATGGCACACGGTAAACCCTGACGAGaacattccatTCTGGCCG
ACGAAACTTCCTTTGGTCAACCTTTACATTAACATCAATGGGCAAGATTC
AGTGAAATTCAACCCTGAAGTTGGAAAAACTTTACTGTTGAAGTTCCAGA
ATGAGGTTGGAGGAGTTTGCGTGGATTACCAAGAAAAGGACTCGTCCTCA
GTCCTTTCGTTTAATCCGTACTTCGCAGGTGCAGCTCCTGTGCGGCttga
aaatctttgcaaaaaGATCGGCATGATCGCTTATAAACAAGCAGGTTCGG
TAATGGGTCACGTGTTAACACATGACCAATCAGTGTTGTACACGTGGGAT
GATCCAACCATGGAACAAGAATTGATTTGTTCCATTGTCAATGATGAAGC
CAGTGAAACAAGGATCAAACTCGATGCCAACGATTTCGGACGAATGAGAG
TTGGAGATGGTGCAATTTATTGGGTTTCCTTTCTGGATGGTCTTCAACGT
GTTCTATTGTTCACTGATAACTTCAAATCTGCTTACTGCGCATGTCAGga
GCAAAATTTACGCCCAACCATGGAAGTTGACTTTGAGATTGAGAGTTTTG
GTTTGTCTCTGGTCAATGTTGATAAGAGAATGGAGATTGGCTACTTAGCT
ATCCGACAAAGCAAGACTGTATGGGAGCAACGCAAGAAAAAGAACCGCTG
GAAAGCTTTACCGCTTGCCATGTGTGAAGCTCTCGAAGAAGGTTATCTCA
ATTATCAAAACAGAAAAGGTGCAGTCAAAGAGAAAGTTCTGGATAAGGAG
GTGGATTACGAGAAGATGTTTATTACGAAACCTGAGAAGATTAAGATCAG
AAGAACGTACCACAGCGGTCTTGGTTTCAAATACACAATCTCACCCAATG
AAATGCGTGTGCATGCTTCTATCAGCTCAATACAGTTGGATAGCCATGTT
CCAGGTTCGACCTTTCCAACAGTCTTGCATATGGTTGAACCACCAAAATC
TGTTGCTTCAGAAAACGCTCCAAAGCCATTCTttgaattgagtttaatga
CAAGGATCGGTGATAAAAATGTGGTCAATGAAGTcagCTATTGTCACGTG
TTGATTCAAGAGATGGATGTGAGGGTTGATATTGGATTTTTATTGGCTCT
GATGGAACTCTTCAGTCATGCAAGAGCTCGAACAACCGAGAAAGAACAAT
ACGCGCTTGATATTGGCCAAGCAGCAACAAAGTTTGAAGAAAGCGCTGAA
TTTCAGGCAGCCAAACAAGATCGATATTACGTTTTGAACGACTTTCATTT
ATCACCGCTAAAGATTCACGTCAGTTTCTCTTTGACGGGTGGTTCCAAAG
ATGAAAATGCTATTGCTTCATTACATGGTAACGTGTTGAACTTGTTGTTA
CAAAGTGTCGGACTGGCCTTCACTGAAATACAAGACGTACAATTCAAATT
AGCATGTTACGAAGTGCATAAGTCCATGCAGAGTAATTCGCAGCTCGGTG
ATGGAATAACTAAACATTATCAAACACAGGCTATCAAGCAACTTTATGTG
TTGGTACTCGGGCTAGACGTTCTTGGTAATCCGTATGGTTTGATATCTGG
TGTTGGAACCGGAGCAAAGAATTTCTTCTACGAACCTTACCAGGGATTAA
TTCAAGGACCAGAAGAATTTGCGGAAGGATTGGCGTATGGGGTGAAGAGT
CTTGTTGGTGGAACCGTGGGTGGAGTATCAGGAGCTGTGAGTAAGATTAC
CGGTACCTTCGGTAAAGGTTTGGCTGCATTGACCTTGGATGAAGAATATC
AACAAAAGAGACGTGAAAACATGAGCCAACGCCCAACTAACCTCGGTGAA
GGTCTCGCCAAAGGTGGTAAAGGCCTTGTAAAGGGTATCGTGTCTGGTGT
TACAGGGATCGTTACCAAACCCTATGAAGGTGCCAAGAATGATGGTGCAG
GTGGCTTTTTTAAGGGCGTTGGAAAAGGCCTGATTGGCGTGGTTGCACGC
CCTGTTGGTGGAGTGGTAGATATGGCCAGTAACACGTTTGATGGTTTGAA
AAGCACGACATCTGGCGTGAAAGCGATCGAGTTGAGCCGTGTTACTCGCG
TCTTCCACGCAGATAAGGTTTTACGACCTTTCAATCTGTACGAAGCAGAT
GGAAACAAAATTCTTATGCAATGTAACAAAGGAGAATACGCCAAGAAGAA
TTTTTATATCACTCATGTAGTGGACAAGAAGAACTATCTCATCCTCACTC
AATCaaacATTTTGTATGTTGGAAAGAACGAGTTGAAAATGGGTGAATGG
GAATCggtttgggttatcgagttcaATGAGCTAAAACGTGAACCAGAAGT
GAAAGAGACAAAGATTATTTTCCATATCCATAATACGGACACGCGACGTT
CAATTTTCAAGAAATCGACGAACACACGTGAAGTGATATTGGAGTCTAGT
GCTGTTGCAGACTGGTTTATCTTAAAGCTTAGAGATGCTAAAATGTTATA
GatggtatttgaaTCTTTGGTTGCTGACCTCTTGAACAAGTATCTGGGTC
AATATGTGAAAAATCTTGATGCTTCTCAATTGAAGATTGGCATTTGGGGA
GGAAATGTTGTCCTGACAGAACTTGAACTGAAAGATACAGCTCTGGATGA
TCTTGACTTACCCATAAAAGTTGTTCGTGGATATTTGGgtAAATTGGTCT
TGTCCATCCCATGGAAAAATCTTTACACTGAATCAACTGTTGTCGATATT
CAAGATCTCCACCTTGTCGCTAAGCCTAATTTTGACATCAAATACAATGA
AGAACgcgaagaaaaatcaaaacatgacAAGAAACAACAACAGATTCACA
ATATCGAAGAAGCGAGGCAAAGAGAAGAAGACAAAAAGAAAGGCGCCAAG
AAAGAAGAGAGTGACGGTTTTGCTGAGAAACTTGCAACAAACGTCATAAA
AAATCTACAGGTTACGATCAAGAACATACATGTTCGATATGAAGACTCAA
TCAGTGATGTGAATGGACCCTTTTCAGTCGGTCTTACAATGGAAAGTTTA
ACAGCACAAACCACAGATGAAGATTTTGTTCCAAAGATTATCAAAGAATC
TGTCTCATTAATTCATAAGatggTGAAATTAGACAATTTGGCTTTATATT
GGAATCCAGGAGACGAACTGATTGATCCTTCACTTGATACCAAGCAATGG
TTGgaagtTTCAACGAAGCAAATTTCAACACACCAATCGAAGCCAGAGAA
AACGAAATATATTTTGAGTCCCATGGTTGCAACGAAGAAATTGAAGCTGA
ACACCAAACCAGGTTCCAACCTTGACATCCCGAAGatgttTTTGAACTTG
GTTTTGGAAGAACTTGGTATCATCGTGGCAAGAAGTCAATATCATGGCGT
GGTGCAACTGATTGAATCATTTGAACGAATGAATAGGAACCAACCTTTTC
GTAAATACAGACCACATACCTCCGTTCTTGGGAACGAAAGTATTTGGTGG
AAGTACTGCATGTCCAGCATACTGGAGGTGGATGTCAAAAGACGATCTCA
AATGTGGAGCTGGAAGCATATTCAAAAACATCGAGTTCTTTGCAAAGCTT
ACAAAGTGAAGTAcaaggaaaaattgaaacagaaaaATCCATCCAAACAA
ATTCTCACTGAACTAGAGaGCATGGAGGATGAGTTGAATATTGCAAGCAT
CACCATTTTTCGACAGCTTGCAGCTACAGAGGTTTTAACGGAACAAAAGA
AGAAAGGCACTAAAGGAAGTTTCTTCAGTTTCTTCTCCAGATCAAAAGAA
CCAGAAAAGTCTGCTGCTAATAAAATTGGAGATTTAATGGGTGATGACCA
GGAGAAGGAAATGCAGAAATTGTATGACGCAATCGGTTATACTGAAAATG
AAGTCATCACTCCCTTTCCTAAAGAGTACGTGGCGATGTCAGTGGAATCG
ATTCTCCAGAAATTATTCATCAGCCTCATCGATGACACAGATAAGGCGAA
AGAATTCAAAGTGTTGGATTTTTCACTCAACAACATCATTGTAGAAGTTT
TCCAAAGACCTTCTGCTCAAGCTCTCAAATTATGTGCAAAGATAGGAGAG
ATGAAGTTATTTGGTACAGCTTCTGCTCAATGTACACCTCtcatcatcaa
aaacatgttaCAAGGTCGAGGTATGGAATTTCTGCCGTTGGTGGACTTCA
TCTTTGAGACGAATCCTTTGAAGAAACCGGACATTGACCAATGTATCACT
GCTATTTGTCAACCCTTAGAAATCATCTATGATGCTAACACGATCAACCA
TATCATTAGTTTCTTCAAACCTCCTGAACATGTTATCTTGCAAGATTTAC
AAGACAAAGCGTATTCTACTTTCGAAGATTTTAAAGTTTCAAGTACGGCT
GGTCTTCTACATGCTATGGAACAAAGAACGGTTATGGACATCGACATTGA
TGTTGGAGCATCTCATTTGATCATCCCTGAAAAAGGTTCTTACAATGGTT
GTACAGATATGCTGGTGATCGACTTTGGTAAAATCACGATGAGCAGCGAT
CCTAGTCAAATCAGACACCTTGACCCTAAGGACATTGAGGATGTGAATGA
AGTACAAAGCAAAGCTTATGATCGATTCTTGTTGTCGCTTCAAGCTCTTC
AAATATTACTCGTTAGAGAAGGTGAAGATTTAAAGAGTGCTAAAAGCAAC
GTCAGTAAAGCTTCATCACACATTTTGCATCCCATCAATTTCGATGGCAA
ACTTGCCAAAGCTATACTTCCACAAGATCCACGTTTAAAACAGATATGTG
TCTCTGGTGAATTATCTTCGCTGTTTGTTTCTGTATCGGATGATAAAGTC
AGTCGTCTCATCAAGCTAGCAGACTCGATACCACTCCCTCAATCACCTTC
TCACGATAACATCGACGGAGAAGAAAAACCTGAAGGACTCTTCACCAAGG
CGTTGTCAATGATAAGCTTGACAGGTGACAATGACACAGGGGTGGACATC
GGAGGATTTTCCATCCCTGTACCGACATCTCCAACATCAGTGACGTCAGA
TGAAGATGAATACGGGACACCACCTGATGGCTCCATATTACAGTTACAAC
AAGAAGCTGGTCCGGACTTTTCATCAGGAGTGGCGAACCAAGTCAAAGTG
GACTTGAACTTTAAAATCCATAAAGTGATGATCGCCATTGGTTTGACTGA
CAAAGCATTGAAACAGGAAAAAGAATGTCTGAAATTCATCGTGGACGACA
TCAATACAGAGgtGATACTACGAAGATGGGATTTGTTCGTCAATGCAGAA
GTTGGTCGTCTGGTGTTGAATGAAATGACATGGGGTGTTGATGGAGAACC
TTTCGCCATCATGAGTACacccaaaaacaccaaaatgttGAAATTCAGCT
ATCGGAGGTGTGAATTCAACGAAAGTTTGAATCTCGGTCCAAGTTACTTT
TATTCCAAAGAAGCGCAAGTCAGAGCTTTACATTTCAAAGATGAATTTGG
CGCCACGGATCAGATTTTAGATGTACAAGTGGCTACTTTATTTCTGATGC
TTCATCAAGAAGCACTTTTGAGCATCATGTCATTGATCTACCAAGTACTG
GAACCACTCAACAAACATGATAAGGAAGCCACACAGAAGATCAAACGGAG
TTTGAGTACGGCAGGTAGTCGTTTGAGTCTCTCCatcgaagaaaaagaaa
aggagaGACAGATACAACGAAAATTAGCCAACCCTAAAGCACTGGAAGCT
GCCAACGAACTTAAGCAACAGGTTGGcttagaagaagaaaaaaagatgaG
AGTGACCGCCCACCTGGATGGTGTTGGTATCATGATTTGTTCAGCCAAAG
TTGACCTTGCACAAGCCTTCGTTAAAGGGTTATCTGCTAAAGTACTGATG
AAAGATGACTTATTAGAAGTGAAAGCCAGCATGAAAGATATGCAAGTACA
AGATAATGTTGGCGAAACAAAGTACAAAGACATCATTAGCATGCGATCTG
ATGAAGTGTTCGATTTAGAGTTGGCTATTTACGAGAATGGATCTTCTGGT
AGCAAGCAATACGATATGTCGTGTGTCGACACCAGTGTCAAACTGAACTT
CGGTCAAATGCGCGTTGTTTTCTTGTATAGATTCATACAAGACTTAATGT
CATTCACCGAAAACTTCGAAGAAGCACAGAAAGCAGTTGTGGAAGCTGGT
AAAGCTGCCAAGGATAAAGCTCTGGAAACAGCGACCGATTTGAATAGACA
TTCTTCTCGTGTCAAACTAAATGTGGTTCTGAAAGCACCGACTATTATCA
TTCCAGTTGGATCAAACAATGAATTGGCTTTACTGGTGGATCTGGGTGAA
TTGCGTATTTACAACACATTCAAACTCCTCAACGATGATCAATACCATAA
GAAATCTATCATCACTGATAACATGACCATTAAGTTATCCAATCTGAAAT
TGTTAAAAGCACTTATTCAAGATGGTAAAGATTTCTTGCATCAACGAGCC
ATTATTGAACCTATGATGCTACAAATAACTATTGTTCGTAATTTAACGAA
AGGTAACCATTCCATACCGGATGTTTCAGTTCAAGCAAAGATGCCAGCTA
TTCTGTTATCAATCAGTGAAGAAGATGTGACCGTAGCTCTAAAGATTGTC
CAAGGGAATCTCGCCGAAGGTGAGTCACATGCGCCGAAGAAGCAAGCCAA
GCCTGCCAAACAAACGTTAAACGTGCCACAAGATCGTTTAGCAGACATTT
ACGAGGAGcctgaagatgaagatgagaaTCGACAAGGATATCTTCAAACC
AAACTATCCTTCGATCTGGCTAAAATTGACATCAAGCTTTACTTGAAACC
ATCTGATATGACATTTGAAGATGAATTTTTAGCGAGGACGGATGATTTGT
TGTTAGCTTTGTTCACTATTGGTAACCTGTGTGTTGATGGAGACATCATG
TCCACGCAAGCTATGAAGATGAGCGTTCGATTGGACACTTTGGTGTTGGA
TGATATGAGACCTATCGAGGAGCATGAAGGTGTTAAACGTATGATCAACT
ACAGTCCCGAGCCACTCCTTGAAGAAGTCAAAACCTCTTCTCATAAACGA
CCAATCGACAACTCACGAATGATCGAAATCCAAttcgatcaaacttcatc
gcaagataaaaatatcgacATCAAACTTTGTAACATGCTTTGTATATTCA
ACGTTGAGTTTATCATGGTCCTGTTGAAAACGTTGCAAGCTGCCATACCT
AAAGATGATAGTCTGCAACATGGCCATTCAATGAGTAGTCTAGACTCGGC
GGCAGGGTCTGGCGGCAGCGATGACGAGGACTCTTTAGAAGCCAGCGAGA
TTGTCCTCTGCACTGGTGATCAAGAAAGACCTGAGACTAAAGTCTCTATC
TTCGTCCATAACCCGCAAATTGTTTTACTAGCAGATGCAAAGGATGTCAA
AACAAATGCACTCTTTCTTACAACCGagatcaattttcaatatttcgaaT
TGCGAGATACTCAAAAAATGATTGGCGCTGTTTCTAACACCGCTATTTTG
TCAACTGCTTTCAAGAATGACCATCGGAGTGATATATCAACAGTGTTGTC
ATTAGATTCCATCAATCTCCACTCGTCATCACCCATCAATGGTAAACCTC
ATATGAGTGTCAGCACAACTTTGATCAAACTGAATATCTCACCCAAAACC
ATCCGAACTTTATCAGCGTGTGCTGGTTACATCTCCAATGATCCAACAGA
TGAAGAAATCAAAGAAGCTCGAAAAGCCATGCGTGATTTATGGCAAATTC
AAACGTTCACCAATAAGCGACCGTGGTATTTAAACCACCCACCACAACAA
GTCTTAAGTGCTGGCAGCTTCGTCCTTGCGCGAACGAGAACAGGAGAATA
TAAGCATGGTTTCTTAGCTAAAAAGGATGTCTCGTATCAAGTCTATTTTT
CAGAGGAGCGAGGAACAGCCAGTCACCGAGCCATGGATATCTCATCTGTT
GTTTTGGATATCGTACCGCTGATCGGTGATCTATGTGTTGGATGTAATGT
TTTAGCTGTGGAATCGAAAGAACATGGATATCGTACTGGTCGAATTACTC
AGGTTTGGGATTCGAATGTGGATAAAGATTCTTCGGATGGCGCCAAACAA
TCTGTTTCTGTCAAGACAACTGCTATTGCTCCAATCAAATACCTTGTCAA
TTTCTATGACAACCAAACGGAGAACTTCTTCCCGCCTGATGAACTTCGTA
TCATTGGTAAACCCATCAAGGGGGTTGTCCCTGGACTAGGGGCGTGTGTT
TACGCCCGCTTTAATGATGGTTTTTACTATCGGGGCAAAGTTGATGACAT
CGAGGATTATCGAATCCGAGTGCAATTGGATGAGATCAGTGGAGAAATCG
AACACGACATCGATGATCCGTCAGCCGTTATTTTGAACCTGACGCCTCAA
TACCGTCAAGTCAAAAAGCATTTCAAAGTCATTGCATCCAAAGGAAGCAC
AACTAAAGGATATCATCCGGGGAAAGTGACCGCCATCCAAGGTGAAGGAA
ATAACCGATTGTATTCGATACGCTTCGAAGACGGTACAATTAACCAAGTA
CCCATCacgaaattgattttgatgccAAAAGCACCTTTTGATGCTTTACC
TGAAGTTGGCACATACGTTTATTCCCGAGTGTCACGCGACGCTCCTTTAT
ACGAGAAGGGTATCGTAGCAGAGAAGAACACAATGATCTGCGTTAAACAT
TTAAATGGACGGAAATTGGCTCACGAAATACAAAACATTCATTTTGTTGT
CCGAAATATCGTTCCTCTCGTGTCATCAttgaagGTTGGTTTGGACGTCA
TAGTGCAACCTGACAATGACGATCAGAAAATGTATTTGGCTGTCATTAGG
GAAGTCACCAAAAAAGAAGGTGACAAAACGAACCGTTATCTAGTGGAGTT
TACGGATGGATCCAAGAAGAGAGTGACGCCCAGCCGGATCCGTATACTTT
CTCAATACGGAAGTGCAGAAACGAGTGAAGAAAATGCTGACATTATCACA
ACAAGACAGGAGGAACTAGTTCTCGATGTGCAAGGTATCTCATTACGTGT
GGAAGGTTACTTGGGAGGCGTGTTGACACCCATGCTCAAAATGGATTCCA
AAATCACAGCTAACTTGAAGGATTGGTCAAGCCAAATGAATGCACACGCT
ACTGTATCATTAGAAGCCAGTTATTATAACGAAAACGTTGCCGAATGGGA
GCCAGTTATTGAACCTTTGATGGAGAAACGGAGGGAAAGACCGTGGCAAC
TCTCTGTCAATTACACGATGGAAGGTGACGACAATTCTGCTTCATCCACT
TCCAACGAACTCGTTTTACAAAAACCGGAATCCAACCTGAAAATCAAATC
TCAAGATAATCTTGAATTGACAATTTCAAAATCATGTCTTGCTTTACTCG
GTGAATTGGGACAGGTGTTTGGAGATGCAGTAGAATCTGTGGACGTTTTA
CCACAAGTCCTGGTCGAAAAAGAACCTTTCATGATCGAAAACTTGCTCTC
CAAGAAGGTGACAGTAACATTGAATGAACTTCTGCAGGGACCAAATGGAG
ATTCGACAATCGAGCTAGCATCTTCTTCGAATCCTGTTGGCATTACTTTT
GCTCCCAagaaatttgagaaacgaaAGACCAACGATCTATACACAATCAA
TTTAtcgGTGGACGGTTTTCATGACATTAAAGACATTGTGGTTCAAAGAA
AGCGAAGCGTTATCTATGATCTTGTACCAATAAAACTATTATCAGCACAG
TCTTCATATTCGATAGTGGTACAAGTGAAGACAACAGACGGACAACGTAT
CATCGTACTCCGATCACCATTGCAGTTGAAAAATCACTTTCCAATGCCGT
TGGATGTCAGCTACATTTCCAAAGAAAACCAACCAGTTAAACTGACAACA
GTGGGATCGGGAGATATCTATTCCTTCCCTTTGTTGTTAACCTACCACAG
TGTTTTTCATCTCAAACCTGCTGGTTTCGACTACGGTGATTGCACAGAAG
CTCTCAATTGGAGTGATTTGAAGACGAGCAACGAAAAACAGTTCTCCTGC
CCTTCACCTGACAAAAGTGCTGACCCTTTCTACATGCAGGTGGTGATGAA
AGAGGAGACGTACTCTTCCGTACACGGCATGTTGGACTGTGTACCACGTT
ACACGTTGGAGTGCTTTCCCGTCATCACGCTGCATAATTACCTACCTTGC
ACTATTAATTATAAGATCAAGGGTATGGCGAAATCGGAAAGTCTACCAGG
CGGACACAATTGGCCTTTGTTTACCGTCAACTTCAGTGATAAACCTTCCA
TCTATATCGAGATTGAGTCGTATAACAACCAAAGATGGGAAGGAGGTTTG
ACATTACCAACAAAACCGGTAGATTCTTTGAACAAACCATCATTATCTTT
CGTCATGATGTCTGGTGAACGCAAAATGGAATTGGGTGTTTATTACCAGT
TAGACGGTTCATTGAACATCACCTTATATTCGCCTTACTGGCTTCTCAAT
AAAACTGGAAAACCACTTGTCTATCAGCCAGCGGGGAGCAGCATCCAGCA
AGTTCACCAAGAGAACGATGTAAATGCTCTTATGATGCTCGTCAAAGGGA
AACATAAAAAGgcgaaagtgaaagtgaaaaataGCGAGTCATGGTCAAAT
GAATTTTCATTGGATACTGTTGGCAGTGGTGGTTCCTTGAAATGCAATGG
TCCAAGAGATCGAGTTTATGAGATTGGTTTGAACATCAGTTTGTCATACT
TTGGATTGACGAAGATTGTGACGTTCACGCCACTCCGAATGTTATCTAAC
CACACCAAGTACACCATCAGTATGGCAGAAAGTAATTCTAAATCGTCAGA
ATGGCACACGGTAAACCCTGACGAGaacattccatTCTGGCCGACGAAAC
TTCCTTTGGTCAACCTTTACATTAACATCAATGGGCAAGATTCAGTGAAA
TTCAACCCTGAAGTTGGAAAAACTTTACTGTTGAAGTTCCAGAATGAGGT
TGGAGGAGTTTGCGTGGATTACCAAGAAAAGGACTCGTCCTCAGTCCTTT
CGTTTAATCCGTACTTCGCAGGTGCAGCTCCTGTGCGGCttgaaaatctt
tgcaaaaaGATCGGCATGATCGCTTATAAACAAGCAGGTTCGGTAATGGG
TCACGTGTTAACACATGACCAATCAGTGTTGTACACGTGGGATGATCCAA
CCATGGAACAAGAATTGATTTGTTCCATTGTCAATGATGAAGCCAGTGAA
ACAAGGATCAAACTCGATGCCAACGATTTCGGACGAATGAGAGTTGGAGA
TGGTGCAATTTATTGGGTTTCCTTTCTGGATGGTCTTCAACGTGTTCTAT
TGTTCACTGATAACTTCAAATCTGCTTACTGCGCATGTCAGgaGCAAAAT
TTACGCCCAACCATGGAAGTTGACTTTGAGATTGAGAGTTTTGGTTTGTC
TCTGGTCAATGTTGATAAGAGAATGGAGATTGGCTACTTAGCTATCCGAC
AAAGCAAGACTGTATGGGAGCAACGCAAGAAAAAGAACCGCTGGAAAGCT
TTACCGCTTGCCATGTGTGAAGCTCTCGAAGAAGGTTATCTCAATTATCA
AAACAGAAAAGGTGCAGTCAAAGAGAAAGTTCTGGATAAGGAGGTGGATT
ACGAGAAGATGTTTATTACGAAACCTGAGAAGATTAAGATCAGAAGAACG
TA