Overview
Sequence
The following sequences are available for this feature:
transcript sequence >TCONS_00070904 ID=TCONS_00070904|Name=TCONS_00070904|organism=Clytia hemisphaerica|type=transcript|length=2980bpRun BLAST on NCBI protein sequence of TCONS_00070904-protein >TCONS_00070904-protein ID=TCONS_00070904-protein|Name=TCONS_00070904-protein|organism=Clytia hemisphaerica|type=polypeptide|length=222bp MAQNMFLYWGSGSTPCWRAMIVLEEKQLSGYGQKLVSFSAKEHKSEEIMKRun BLAST on NCBI transcript from alignment at scaffold_58:122691..138862- Legend: exonfive_prime_UTRCDSthree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.>TCONS_00070904 ID=TCONS_00070904|Name=TCONS_00070904|organism=Clytia hemisphaerica|type=transcript|length=16172bp|location=Sequence derived from alignment at scaffold_58:122691..138862- (Clytia hemisphaerica) Coding sequence (CDS) from alignment at scaffold_58:122691..138862- >TCONS_00070904 ID=TCONS_00070904|Name=TCONS_00070904|organism=Clytia hemisphaerica|type=CDS|length=2676bp|location=Sequence derived from alignment at scaffold_58:122691..138862- (Clytia hemisphaerica) Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Position
The following features are aligned
Expression
Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Values :
GrOo_1 GrOo_2 FGOo_1 FGOo_2 EG_1 EG_2 P1_1 P1_2 P2_1 P2_2 P3_1 P3_2 PoPr_1 PoPr_2 St_1 St_2 GO_1 GO_2 PH_1 PH_2 BMF_1 BMF_2 MMF_1 MMF_2 M_1 M_2 GEC_1 GEC_2 GEN_1 GEN_2 Annotated Terms
The following terms have been associated with this transcript:
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Blast
BLAST of TCONS_00070904 vs. Swiss-Prot (Human)
Match: NDUS6 (NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial OS=Homo sapiens GN=NDUFS6 PE=1 SV=1) HSP 1 Score: 102.064 bits (253), Expect = 1.719e-24 Identity = 45/82 (54.88%), Postives = 63/82 (76.83%), Query Frame = 3 Query: 177 DKITHTGQQFDNEDWKKMRFTAAEKHKLVSENIAFDMVAEEPPTVVNARIVACDGGGGALGHPKVFINLDKPG-IHVCGYCG 419 +K+THTGQ +D++D++++RF +K V+EN A D++AE+P + V R++ACDGGGGALGHPKV+INLDK CGYCG Sbjct: 37 EKVTHTGQVYDDKDYRRIRFVGRQKE--VNENFAIDLIAEQPVSEVETRVIACDGGGGALGHPKVYINLDKETKTGTCGYCG 116 The following BLAST results are available for this feature:
BLAST of TCONS_00070904 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens)) Total hits: 1
|