Overview
Sequence
The following sequences are available for this feature:
transcript sequence >TCONS_00069436 ID=TCONS_00069436|Name=TCONS_00069436|organism=Clytia hemisphaerica|type=transcript|length=515bpRun BLAST on NCBI transcript from alignment at scaffold_5:121077..121830- Legend: exon Hold the cursor over a type above to highlight its positions in the sequence below.>TCONS_00069436 ID=TCONS_00069436|Name=TCONS_00069436|organism=Clytia hemisphaerica|type=transcript|length=754bp|location=Sequence derived from alignment at scaffold_5:121077..121830- (Clytia hemisphaerica) Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Position
The following features are aligned
Expression
Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Values :
GrOo_1 GrOo_2 FGOo_1 FGOo_2 EG_1 EG_2 P1_1 P1_2 P2_1 P2_2 P3_1 P3_2 PoPr_1 PoPr_2 St_1 St_2 GO_1 GO_2 PH_1 PH_2 BMF_1 BMF_2 MMF_1 MMF_2 M_1 M_2 GEC_1 GEC_2 GEN_1 GEN_2 Annotated Terms
The following terms have been associated with this transcript:
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Blast
BLAST of TCONS_00069436 vs. Swiss-Prot (Human)
Match: RPC9 (DNA-directed RNA polymerase III subunit RPC9 OS=Homo sapiens GN=CRCP PE=1 SV=1) HSP 1 Score: 92.8189 bits (229), Expect = 1.335e-23 Identity = 53/103 (51.46%), Postives = 66/103 (64.08%), Query Frame = -2 Query: 227 MEVVNENVATLSNAEVFQLLEDEKLIEHRI-----------TNVATVAYETIKYLEKTPAKHQDTEAVQKFMTALAPYNFTKAEKLQLLNLRPTSIVEMQLIV 502 MEV + N A LSN EVFQLL D L E R N+ T+ YET+KY+ KTP +HQ E V++F+TAL + TKAEKLQLLN RP + VE+QL+V Sbjct: 1 MEVKDANSALLSNYEVFQLLTD--LKEQRKESGKNKHSSGQQNLNTITYETLKYISKTPCRHQSPEIVREFLTALKSHKLTKAEKLQLLNHRPVTAVEIQLMV 101 The following BLAST results are available for this feature:
BLAST of TCONS_00069436 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens)) Total hits: 1
|