Overview
Sequence
The following sequences are available for this feature:
transcript sequence >TCONS_00069122 ID=TCONS_00069122|Name=TCONS_00069122|organism=Clytia hemisphaerica|type=transcript|length=795bpRun BLAST on NCBI transcript from alignment at scaffold_493:257977..258771 Legend: exon Hold the cursor over a type above to highlight its positions in the sequence below.>TCONS_00069122 ID=TCONS_00069122|Name=TCONS_00069122|organism=Clytia hemisphaerica|type=transcript|length=795bp|location=Sequence derived from alignment at scaffold_493:257977..258771 (Clytia hemisphaerica) Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Position
The following features are aligned
Expression
Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Values :
GrOo_1 GrOo_2 FGOo_1 FGOo_2 EG_1 EG_2 P1_1 P1_2 P2_1 P2_2 P3_1 P3_2 PoPr_1 PoPr_2 St_1 St_2 GO_1 GO_2 PH_1 PH_2 BMF_1 BMF_2 MMF_1 MMF_2 M_1 M_2 GEC_1 GEC_2 GEN_1 GEN_2 Blast
BLAST of TCONS_00069122 vs. Swiss-Prot (Human)
Match: COX19 (Cytochrome c oxidase assembly protein COX19 OS=Homo sapiens GN=COX19 PE=1 SV=1) HSP 1 Score: 85.1149 bits (209), Expect = 1.238e-20 Identity = 40/76 (52.63%), Postives = 50/76 (65.79%), Query Frame = -2 Query: 255 MNASQKVFRPTAPQKGSFPLDHDGDCKTFMTKYMACLRKNELNSYNCSAESKDYLKCRMEQGLMDKEEFSRLGFKD 482 MN K F+P P KGSFPLDH G+CK+F K+M CL N + C ESK+YL+CRME+ LM +E +LGF D Sbjct: 5 MNFGTKSFQPRPPDKGSFPLDHLGECKSFKEKFMKCLHNNNFENALCRKESKEYLECRMERKLMLQEPLEKLGFGD 80 The following BLAST results are available for this feature:
BLAST of TCONS_00069122 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens)) Total hits: 1
|