Overview
Sequence
The following sequences are available for this feature:
transcript sequence >TCONS_00067881 ID=TCONS_00067881|Name=TCONS_00067881|organism=Clytia hemisphaerica|type=transcript|length=2944bpRun BLAST on NCBI transcript from alignment at scaffold_477:139829..148999+ Legend: exon Hold the cursor over a type above to highlight its positions in the sequence below.>TCONS_00067881 ID=TCONS_00067881|Name=TCONS_00067881|organism=Clytia hemisphaerica|type=transcript|length=9171bp|location=Sequence derived from alignment at scaffold_477:139829..148999+ (Clytia hemisphaerica) Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Position
The following features are aligned
Expression
Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Values :
GrOo_1 GrOo_2 FGOo_1 FGOo_2 EG_1 EG_2 P1_1 P1_2 P2_1 P2_2 P3_1 P3_2 PoPr_1 PoPr_2 St_1 St_2 GO_1 GO_2 PH_1 PH_2 BMF_1 BMF_2 MMF_1 MMF_2 M_1 M_2 GEC_1 GEC_2 GEN_1 GEN_2 Blast
BLAST of TCONS_00067881 vs. Swiss-Prot (Human)
Match: PRCC (Proline-rich protein PRCC OS=Homo sapiens GN=PRCC PE=1 SV=1) HSP 1 Score: 91.6633 bits (226), Expect = 4.788e-19 Identity = 49/106 (46.23%), Postives = 69/106 (65.09%), Query Frame = 3 Query: 1623 IDQEAMRALQGRKRRRGEEINIIDVNAQDLQVDKDEYL-KNLTVE----SGYKNKAPQDAGISSQQKRKHQITYLAFQAKEREFELRQSWADSRASKQQTQSKYGF 1925 ID EA + LQG++ R EEIN +++ D +++ K+LT E S K K Q G QQ+RKHQITYL QAKERE EL+ +W++++ S++QTQ+KYGF Sbjct: 389 IDDEAFKRLQGKRNRGREEINFVEIKGDDQLSGAQQWMTKSLTEEKTMKSFSKKKGEQPTG---QQRRKHQITYLIHQAKERELELKNTWSENKLSRRQTQAKYGF 491 The following BLAST results are available for this feature:
BLAST of TCONS_00067881 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens)) Total hits: 1
|