Overview
Sequence
The following sequences are available for this feature:
transcript sequence >TCONS_00067203 ID=TCONS_00067203|Name=TCONS_00067203|organism=Clytia hemisphaerica|type=transcript|length=580bpRun BLAST on NCBI transcript from alignment at scaffold_466:408368..409008+ Legend: exon Hold the cursor over a type above to highlight its positions in the sequence below.>TCONS_00067203 ID=TCONS_00067203|Name=TCONS_00067203|organism=Clytia hemisphaerica|type=transcript|length=641bp|location=Sequence derived from alignment at scaffold_466:408368..409008+ (Clytia hemisphaerica) Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Position
The following features are aligned
Expression
Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Values :
GrOo_1 GrOo_2 FGOo_1 FGOo_2 EG_1 EG_2 P1_1 P1_2 P2_1 P2_2 P3_1 P3_2 PoPr_1 PoPr_2 St_1 St_2 GO_1 GO_2 PH_1 PH_2 BMF_1 BMF_2 MMF_1 MMF_2 M_1 M_2 GEC_1 GEC_2 GEN_1 GEN_2 Blast
BLAST of TCONS_00067203 vs. Swiss-Prot (Human)
Match: RBP10 (Ran-binding protein 10 OS=Homo sapiens GN=RANBP10 PE=1 SV=1) HSP 1 Score: 82.0333 bits (201), Expect = 5.946e-18 Identity = 39/77 (50.65%), Postives = 49/77 (63.64%), Query Frame = -3 Query: 339 IQRLILSGRISEAIDAIQTLYPGLLDQNSDLFFKLKCRQFIEMVNGCDGEVK-----------TYAHSPSRSLRNSP 536 IQ+L+L GR+ EAI+ Q YPGLL+ N +L F LKCRQF+EMVNG D EV+ +Y SPS S R+ P Sbjct: 298 IQKLVLEGRVGEAIETTQRFYPGLLEHNPNLLFMLKCRQFVEMVNGTDSEVRSLSSRSPKSQDSYPGSPSLSPRHGP 374 The following BLAST results are available for this feature:
BLAST of TCONS_00067203 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens)) Total hits: 1
|