Overview
Sequence
The following sequences are available for this feature:
transcript sequence >TCONS_00065918 ID=TCONS_00065918|Name=TCONS_00065918|organism=Clytia hemisphaerica|type=transcript|length=521bpRun BLAST on NCBI transcript from alignment at scaffold_448:561388..562037+ Legend: exon Hold the cursor over a type above to highlight its positions in the sequence below.>TCONS_00065918 ID=TCONS_00065918|Name=TCONS_00065918|organism=Clytia hemisphaerica|type=transcript|length=650bp|location=Sequence derived from alignment at scaffold_448:561388..562037+ (Clytia hemisphaerica) Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Position
The following features are aligned
Expression
Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Values :
GrOo_1 GrOo_2 FGOo_1 FGOo_2 EG_1 EG_2 P1_1 P1_2 P2_1 P2_2 P3_1 P3_2 PoPr_1 PoPr_2 St_1 St_2 GO_1 GO_2 PH_1 PH_2 BMF_1 BMF_2 MMF_1 MMF_2 M_1 M_2 GEC_1 GEC_2 GEN_1 GEN_2 Blast
BLAST of TCONS_00065918 vs. Swiss-Prot (Human)
Match: MYH11 (Myosin-11 OS=Homo sapiens GN=MYH11 PE=1 SV=3) HSP 1 Score: 78.9518 bits (193), Expect = 8.510e-17 Identity = 36/57 (63.16%), Postives = 45/57 (78.95%), Query Frame = 1 Query: 280 CYRVIQRNGRAWLKLRNWQWWRLFTKVKPLLNVTRQEDEMRLKEEDYKKLSDQNDKV 450 +VIQRN A+LKLRNWQWWRLFTKVKPLL VTRQE+EM+ KE++ +K ++ K Sbjct: 815 AMKVIQRNCAAYLKLRNWQWWRLFTKVKPLLQVTRQEEEMQAKEDELQKTKERQQKA 871 The following BLAST results are available for this feature:
BLAST of TCONS_00065918 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens)) Total hits: 1
|