Overview
Sequence
The following sequences are available for this feature:
transcript sequence >TCONS_00065827 ID=TCONS_00065827|Name=TCONS_00065827|organism=Clytia hemisphaerica|type=transcript|length=312bpRun BLAST on NCBI transcript from alignment at scaffold_446:27419..28347- Legend: exon Hold the cursor over a type above to highlight its positions in the sequence below.>TCONS_00065827 ID=TCONS_00065827|Name=TCONS_00065827|organism=Clytia hemisphaerica|type=transcript|length=929bp|location=Sequence derived from alignment at scaffold_446:27419..28347- (Clytia hemisphaerica) Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Position
The following features are aligned
Expression
Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Values :
GrOo_1 GrOo_2 FGOo_1 FGOo_2 EG_1 EG_2 P1_1 P1_2 P2_1 P2_2 P3_1 P3_2 PoPr_1 PoPr_2 St_1 St_2 GO_1 GO_2 PH_1 PH_2 BMF_1 BMF_2 MMF_1 MMF_2 M_1 M_2 GEC_1 GEC_2 GEN_1 GEN_2 Blast
BLAST of TCONS_00065827 vs. Swiss-Prot (Human)
Match: P20D2 (Peptidase M20 domain-containing protein 2 OS=Homo sapiens GN=PM20D2 PE=1 SV=2) HSP 1 Score: 72.4034 bits (176), Expect = 7.674e-16 Identity = 37/92 (40.22%), Postives = 51/92 (55.43%), Query Frame = 1 Query: 10 DELNNISQEIWKNPELNFEEFKAHALLTSYLEKE----GFEVAKSTPLETSFIARYGKKEG---------IKVGVICEYDALPGVGHACGHN 246 + L +S+ IW PEL +EE AH +LT + E+E + V L T+F A + E + +G +CEYDALPG+GHACGHN Sbjct: 36 ERLGALSRAIWSQPELAYEEHHAHRVLTHFFEREPPAASWAVQPHYQLPTAFRAEWEPPEARAPSATPRPLHLGFLCEYDALPGIGHACGHN 127 The following BLAST results are available for this feature:
BLAST of TCONS_00065827 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens)) Total hits: 1
|