Overview
Sequence
The following sequences are available for this feature:
transcript sequence >TCONS_00063150 ID=TCONS_00063150|Name=TCONS_00063150|organism=Clytia hemisphaerica|type=transcript|length=347bpRun BLAST on NCBI transcript from alignment at scaffold_382:118575..118921 Legend: exon Hold the cursor over a type above to highlight its positions in the sequence below.>TCONS_00063150 ID=TCONS_00063150|Name=TCONS_00063150|organism=Clytia hemisphaerica|type=transcript|length=347bp|location=Sequence derived from alignment at scaffold_382:118575..118921 (Clytia hemisphaerica) Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Position
The following features are aligned
Expression
Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Values :
GrOo_1 GrOo_2 FGOo_1 FGOo_2 EG_1 EG_2 P1_1 P1_2 P2_1 P2_2 P3_1 P3_2 PoPr_1 PoPr_2 St_1 St_2 GO_1 GO_2 PH_1 PH_2 BMF_1 BMF_2 MMF_1 MMF_2 M_1 M_2 GEC_1 GEC_2 GEN_1 GEN_2 Blast
BLAST of TCONS_00063150 vs. Swiss-Prot (Human)
Match: CRFM7 (CHRNA7-FAM7A fusion protein OS=Homo sapiens GN=CHRFAM7A PE=2 SV=1) HSP 1 Score: 73.1738 bits (178), Expect = 6.099e-16 Identity = 33/73 (45.21%), Postives = 55/73 (75.34%), Query Frame = -1 Query: 129 ERISLAITLLLAMTVFMLVVADIIPATSDVIPLVGIFFSASMIEMVIMIVVLCYIMRLYHKGPNDPPMPLWMK 347 E+ISL IT+LL++TVFML+VA+I+PATSD +PL+ +F+++MI + + +VV +++ +H P+ MP W + Sbjct: 170 EKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFASTMIIVGLSVVVTVIVLQYHHHDPDGGKMPKWTR 242 The following BLAST results are available for this feature:
BLAST of TCONS_00063150 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens)) Total hits: 1
|