Overview
Sequence
The following sequences are available for this feature:
transcript sequence >TCONS_00060869 ID=TCONS_00060869|Name=TCONS_00060869|organism=Clytia hemisphaerica|type=transcript|length=2817bpRun BLAST on NCBI transcript from alignment at scaffold_349:644632..672167- Legend: exon Hold the cursor over a type above to highlight its positions in the sequence below.>TCONS_00060869 ID=TCONS_00060869|Name=TCONS_00060869|organism=Clytia hemisphaerica|type=transcript|length=27536bp|location=Sequence derived from alignment at scaffold_349:644632..672167- (Clytia hemisphaerica) Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Position
The following features are aligned
Expression
Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Values :
GrOo_1 GrOo_2 FGOo_1 FGOo_2 EG_1 EG_2 P1_1 P1_2 P2_1 P2_2 P3_1 P3_2 PoPr_1 PoPr_2 St_1 St_2 GO_1 GO_2 PH_1 PH_2 BMF_1 BMF_2 MMF_1 MMF_2 M_1 M_2 GEC_1 GEC_2 GEN_1 GEN_2 Blast
BLAST of TCONS_00060869 vs. Swiss-Prot (Human)
Match: LDB3 (LIM domain-binding protein 3 OS=Homo sapiens GN=LDB3 PE=1 SV=2) HSP 1 Score: 89.7373 bits (221), Expect = 2.965e-18 Identity = 35/83 (42.17%), Postives = 53/83 (63.86%), Query Frame = 1 Query: 1150 CSACDQPLDGPFVSAIGKTWHPDHFCCSSCQMSLQNQAFVEENNKLFCEKCYNSYYAPKCAHCNNAIIG-ALHSQRDKICDEC 1395 C C+ + GPF+ A+G++WHP+ F C+ C+ SL + FVEE N ++CE+CY ++AP CA CN I+G +H+ R C Sbjct: 551 CGHCNNVIRGPFLVAMGRSWHPEEFTCAYCKTSLADVCFVEEQNNVYCERCYEQFFAPLCAKCNTKIMGEVMHALRQTWHTTC 633 The following BLAST results are available for this feature:
BLAST of TCONS_00060869 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens)) Total hits: 1
|