Overview
Sequence
The following sequences are available for this feature:
transcript sequence >TCONS_00060794 ID=TCONS_00060794|Name=TCONS_00060794|organism=Clytia hemisphaerica|type=transcript|length=352bpRun BLAST on NCBI transcript from alignment at scaffold_349:642206..642911+ Legend: exon Hold the cursor over a type above to highlight its positions in the sequence below.>TCONS_00060794 ID=TCONS_00060794|Name=TCONS_00060794|organism=Clytia hemisphaerica|type=transcript|length=706bp|location=Sequence derived from alignment at scaffold_349:642206..642911+ (Clytia hemisphaerica) Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Position
The following features are aligned
Expression
Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Values :
GrOo_1 GrOo_2 FGOo_1 FGOo_2 EG_1 EG_2 P1_1 P1_2 P2_1 P2_2 P3_1 P3_2 PoPr_1 PoPr_2 St_1 St_2 GO_1 GO_2 PH_1 PH_2 BMF_1 BMF_2 MMF_1 MMF_2 M_1 M_2 GEC_1 GEC_2 GEN_1 GEN_2 Blast
BLAST of TCONS_00060794 vs. Swiss-Prot (Human)
Match: LDB3 (LIM domain-binding protein 3 OS=Homo sapiens GN=LDB3 PE=1 SV=2) HSP 1 Score: 84.3445 bits (207), Expect = 1.968e-19 Identity = 33/78 (42.31%), Postives = 48/78 (61.54%), Query Frame = -1 Query: 17 INALGKSWHPDHFVCTFCNRGFGTDGYLVDSGKPYCEKCFEDLFSVKCGKCMRAITGGEKYVEALNKNWHSGCFTCNV 250 ++AL ++WH FVC C + FG + ++ G+PYCEK + +LFS KC C + G+K++EAL WH CF C V Sbjct: 622 MHALRQTWHTTCFVCAACKKPFGNSLFHMEDGEPYCEKDYINLFSTKCHGCDFPVEAGDKFIEALGHTWHDTCFICAV 699 HSP 2 Score: 75.0998 bits (183), Expect = 2.473e-16 Identity = 27/74 (36.49%), Postives = 41/74 (55.41%), Query Frame = -1 Query: 23 ALGKSWHPDHFVCTFCNRGFGTDGYLVDSGKPYCEKCFEDLFSVKCGKCMRAITGGEKYVEALNKNWHSGCFTC 244 A+G+SWHP+ F C +C ++ + YCE+C+E F+ C KC I G + + AL + WH+ CF C Sbjct: 565 AMGRSWHPEEFTCAYCKTSLADVCFVEEQNNVYCERCYEQFFAPLCAKCNTKIMG--EVMHALRQTWHTTCFVC 636 The following BLAST results are available for this feature:
BLAST of TCONS_00060794 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens)) Total hits: 1
|