Overview
Sequence
The following sequences are available for this feature:
transcript sequence >TCONS_00058013 ID=TCONS_00058013|Name=TCONS_00058013|organism=Clytia hemisphaerica|type=transcript|length=314bpRun BLAST on NCBI transcript from alignment at scaffold_303:18271..18584 Legend: exon Hold the cursor over a type above to highlight its positions in the sequence below.>TCONS_00058013 ID=TCONS_00058013|Name=TCONS_00058013|organism=Clytia hemisphaerica|type=transcript|length=314bp|location=Sequence derived from alignment at scaffold_303:18271..18584 (Clytia hemisphaerica) Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Position
The following features are aligned
Expression
Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Values :
GrOo_1 GrOo_2 FGOo_1 FGOo_2 EG_1 EG_2 P1_1 P1_2 P2_1 P2_2 P3_1 P3_2 PoPr_1 PoPr_2 St_1 St_2 GO_1 GO_2 PH_1 PH_2 BMF_1 BMF_2 MMF_1 MMF_2 M_1 M_2 GEC_1 GEC_2 GEN_1 GEN_2 Blast
BLAST of TCONS_00058013 vs. Swiss-Prot (Human)
Match: POMT1 (Protein O-mannosyl-transferase 1 OS=Homo sapiens GN=POMT1 PE=1 SV=3) HSP 1 Score: 91.6633 bits (226), Expect = 3.562e-22 Identity = 40/63 (63.49%), Postives = 49/63 (77.78%), Query Frame = 3 Query: 6 ISYGSHITLRNTHSKQ--CWLHSHKHLYPVKYEDGRGSSAQQQVTCYAFKDINNWFIVKHPDR 188 +++GS +TLRN K CWLHSH+ YP+ YE+GRGSS QQQVTCY FKD+NNW+IVK P R Sbjct: 321 VAFGSQVTLRNVFGKPVPCWLHSHQDTYPMIYENGRGSSHQQQVTCYPFKDVNNWWIVKDPRR 383 The following BLAST results are available for this feature:
BLAST of TCONS_00058013 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens)) Total hits: 1
|