Overview
Sequence
The following sequences are available for this feature:
transcript sequence >TCONS_00057175 ID=TCONS_00057175|Name=TCONS_00057175|organism=Clytia hemisphaerica|type=transcript|length=1092bpRun BLAST on NCBI transcript from alignment at scaffold_286:164575..190843+ Legend: exon Hold the cursor over a type above to highlight its positions in the sequence below.>TCONS_00057175 ID=TCONS_00057175|Name=TCONS_00057175|organism=Clytia hemisphaerica|type=transcript|length=26269bp|location=Sequence derived from alignment at scaffold_286:164575..190843+ (Clytia hemisphaerica) Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Position
The following features are aligned
Expression
Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Values :
GrOo_1 GrOo_2 FGOo_1 FGOo_2 EG_1 EG_2 P1_1 P1_2 P2_1 P2_2 P3_1 P3_2 PoPr_1 PoPr_2 St_1 St_2 GO_1 GO_2 PH_1 PH_2 BMF_1 BMF_2 MMF_1 MMF_2 M_1 M_2 GEC_1 GEC_2 GEN_1 GEN_2 Blast
BLAST of TCONS_00057175 vs. Swiss-Prot (Human)
Match: MED19 (Mediator of RNA polymerase II transcription subunit 19 OS=Homo sapiens GN=MED19 PE=1 SV=2) HSP 1 Score: 76.6406 bits (187), Expect = 4.975e-16 Identity = 45/110 (40.91%), Postives = 68/110 (61.82%), Query Frame = 3 Query: 213 PFHLLRRKKAAQPPSLLSMSTNL---QGLDEAFAKFSKQNIKDGLSSFLPDLPGYVDAPGTPQD-SLQSLIDKPPIGGREILPLNDSALQGFRLMPGSVPDHLKFMNKPP 530 PF+L+R + + L+ STNL L++A+ KF + +K+ LS+FLPDLPG +D PG+ + SL+SLI+KPPI P+ + L GFRL G +P+ + M+ P Sbjct: 64 PFYLMRELPGS---TELTGSTNLITHYNLEQAYNKFCGKKVKEKLSNFLPDLPGMIDLPGSHDNSSLRSLIEKPPILSSSFNPITGTMLAGFRLHTGPLPEQCRLMHIQP 170 The following BLAST results are available for this feature:
BLAST of TCONS_00057175 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens)) Total hits: 1
|