Overview
Sequence
The following sequences are available for this feature:
transcript sequence >TCONS_00054999 ID=TCONS_00054999|Name=TCONS_00054999|organism=Clytia hemisphaerica|type=transcript|length=3733bpRun BLAST on NCBI transcript from alignment at scaffold_248:212850..222150+ Legend: exon Hold the cursor over a type above to highlight its positions in the sequence below.>TCONS_00054999 ID=TCONS_00054999|Name=TCONS_00054999|organism=Clytia hemisphaerica|type=transcript|length=9301bp|location=Sequence derived from alignment at scaffold_248:212850..222150+ (Clytia hemisphaerica) Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Position
The following features are aligned
Expression
Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Values :
GrOo_1 GrOo_2 FGOo_1 FGOo_2 EG_1 EG_2 P1_1 P1_2 P2_1 P2_2 P3_1 P3_2 PoPr_1 PoPr_2 St_1 St_2 GO_1 GO_2 PH_1 PH_2 BMF_1 BMF_2 MMF_1 MMF_2 M_1 M_2 GEC_1 GEC_2 GEN_1 GEN_2 Blast
BLAST of TCONS_00054999 vs. Swiss-Prot (Human)
Match: G2E3 (G2/M phase-specific E3 ubiquitin-protein ligase OS=Homo sapiens GN=G2E3 PE=1 SV=1) HSP 1 Score: 105.145 bits (261), Expect = 8.127e-23 Identity = 49/116 (42.24%), Postives = 75/116 (64.66%), Query Frame = 2 Query: 578 LRTQANNAG-YFFRCPTCNNQELFQKEMSTFGVYIPQRDAAWE-KNNAFGDLLESYDKCDSAECRCPFGKSHIEDEGDWDLLRCYHCGQSGVHRACLGADVTPEYEFVCRDCNDVV 919 L+ QA NAG +FFRC CNN ++FQKEM G++IP++DA+WE + NA+ +LL+ Y++CD CRC G+ + + W++ RC CG SG H AC + + E + C +C ++ Sbjct: 175 LQVQAINAGVFFFRCTICNNSDIFQKEMLRMGIHIPEKDASWELEENAYQELLQHYERCDVRRCRCKEGRDYNAPDSKWEIKRCQCCGSSGTHLAC-SSLRSWEQNWECLECRGII 289 The following BLAST results are available for this feature:
BLAST of TCONS_00054999 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens)) Total hits: 1
|