Overview
Sequence
The following sequences are available for this feature:
transcript sequence >TCONS_00045708 ID=TCONS_00045708|Name=TCONS_00045708|organism=Clytia hemisphaerica|type=transcript|length=802bpRun BLAST on NCBI protein sequence of TCONS_00045708-protein >TCONS_00045708-protein ID=TCONS_00045708-protein|Name=TCONS_00045708-protein|organism=Clytia hemisphaerica|type=polypeptide|length=267bp ITGMSSELPTPHDHYTMFDSDEDIDPSPGSIADQPRSIRSSTRKLREGWRRun BLAST on NCBI transcript from alignment at scaffold_100:820439..829059+ Legend: exonfive_prime_UTRCDS Hold the cursor over a type above to highlight its positions in the sequence below.>TCONS_00045708 ID=TCONS_00045708|Name=TCONS_00045708|organism=Clytia hemisphaerica|type=transcript|length=8621bp|location=Sequence derived from alignment at scaffold_100:820439..829059+ (Clytia hemisphaerica) Coding sequence (CDS) from alignment at scaffold_100:820439..829059+ >TCONS_00045708 ID=TCONS_00045708|Name=TCONS_00045708|organism=Clytia hemisphaerica|type=CDS|length=8010bp|location=Sequence derived from alignment at scaffold_100:820439..829059+ (Clytia hemisphaerica) Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Position
The following features are aligned
Expression
Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Values :
GrOo_1 GrOo_2 FGOo_1 FGOo_2 EG_1 EG_2 P1_1 P1_2 P2_1 P2_2 P3_1 P3_2 PoPr_1 PoPr_2 St_1 St_2 GO_1 GO_2 PH_1 PH_2 BMF_1 BMF_2 MMF_1 MMF_2 M_1 M_2 GEC_1 GEC_2 GEN_1 GEN_2 Annotated Terms
The following terms have been associated with this transcript:
Blast
BLAST of TCONS_00045708 vs. Swiss-Prot (Human)
Match: TRAF7 (E3 ubiquitin-protein ligase TRAF7 OS=Homo sapiens GN=TRAF7 PE=1 SV=1) HSP 1 Score: 103.605 bits (257), Expect = 1.430e-24 Identity = 48/90 (53.33%), Postives = 62/90 (68.89%), Query Frame = 2 Query: 533 LFCEPISEKLICLLCKSVFREPVITNCGHTFCRQCVLSAAKESTCPTDGTQLSVGPVNIAIRDQVGELLIHCKYGCSPASSGVPGEYEID 802 +F E S KL C LC SVF++PVIT CGHTFCR+C L + K CP D +L+V NIA+ +Q+GEL IHC++GC A SG P +E+D Sbjct: 120 VFAEQPSVKLCCQLCCSVFKDPVITTCGHTFCRRCALKSEK---CPVDNVKLTVVVNNIAVAEQIGELFIHCRHGCRVAGSGKPPIFEVD 206 The following BLAST results are available for this feature:
BLAST of TCONS_00045708 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens)) Total hits: 1
|