Overview
Sequence
The following sequences are available for this feature:
transcript sequence >TCONS_00045024 ID=TCONS_00045024|Name=TCONS_00045024|organism=Clytia hemisphaerica|type=transcript|length=365bpRun BLAST on NCBI transcript from alignment at sc0006703:495..1418- Legend: exon Hold the cursor over a type above to highlight its positions in the sequence below.>TCONS_00045024 ID=TCONS_00045024|Name=TCONS_00045024|organism=Clytia hemisphaerica|type=transcript|length=924bp|location=Sequence derived from alignment at sc0006703:495..1418- (Clytia hemisphaerica) Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Position
The following features are aligned
Expression
Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Values :
GrOo_1 GrOo_2 FGOo_1 FGOo_2 EG_1 EG_2 P1_1 P1_2 P2_1 P2_2 P3_1 P3_2 PoPr_1 PoPr_2 St_1 St_2 GO_1 GO_2 PH_1 PH_2 BMF_1 BMF_2 MMF_1 MMF_2 M_1 M_2 GEC_1 GEC_2 GEN_1 GEN_2 Blast
BLAST of TCONS_00045024 vs. Swiss-Prot (Human)
Match: PLOD1 (Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1 OS=Homo sapiens GN=PLOD1 PE=1 SV=2) HSP 1 Score: 107.842 bits (268), Expect = 1.386e-27 Identity = 50/120 (41.67%), Postives = 77/120 (64.17%), Query Frame = 2 Query: 8 EEDWPTILIGLFIPEPTPFVQSYLRHISSQRYPKSKIDIFLHSVDPHHNEDVEKWQKEFSSQYRSFTLKGPRSFLTDKEGRNMGIAHC-QKVGCDYYFSVDADVTLSNHDSLKLLLQQNR 364 +E PT+L+G+FI +PTPFV + + + YP+ + +F+H+ + HH VE++ + S+Y+S L GP + + + RNMG C Q C YYFSVDADV L+ +SL+LL+QQN+ Sbjct: 282 DEALPTVLVGVFIEQPTPFVSLFFQRLLRLHYPQKHMRLFIHNHEQHHKAQVEEFLAQHGSEYQSVKLVGPEVRMANADARNMGADLCRQDRSCTYYFSVDADVALTEPNSLRLLIQQNK 401 The following BLAST results are available for this feature:
BLAST of TCONS_00045024 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens)) Total hits: 1
|