Overview
Sequence
The following sequences are available for this feature:
transcript sequence >TCONS_00011372 ID=TCONS_00011372|Name=TCONS_00011372|organism=Clytia hemisphaerica|type=transcript|length=674bpRun BLAST on NCBI transcript from alignment at sc0000127:21670..22561- Legend: exon Hold the cursor over a type above to highlight its positions in the sequence below.>TCONS_00011372 ID=TCONS_00011372|Name=TCONS_00011372|organism=Clytia hemisphaerica|type=transcript|length=892bp|location=Sequence derived from alignment at sc0000127:21670..22561- (Clytia hemisphaerica) Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Position
The following features are aligned
Expression
Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Values :
GrOo_1 GrOo_2 FGOo_1 FGOo_2 EG_1 EG_2 P1_1 P1_2 P2_1 P2_2 P3_1 P3_2 PoPr_1 PoPr_2 St_1 St_2 GO_1 GO_2 PH_1 PH_2 BMF_1 BMF_2 MMF_1 MMF_2 M_1 M_2 GEC_1 GEC_2 GEN_1 GEN_2 Blast
BLAST of TCONS_00011372 vs. Swiss-Prot (Human)
Match: FZD1 (Frizzled-1 OS=Homo sapiens GN=FZD1 PE=1 SV=2) HSP 1 Score: 78.5666 bits (192), Expect = 1.369e-16 Identity = 36/81 (44.44%), Postives = 49/81 (60.49%), Query Frame = -2 Query: 233 KNSILEVQLYEPLFKAGCSDQMQNFICSYYFPKCE-LNKVLPPCREYCKDATNGCSQLMEEFGFQLPKYLKCDRFPKRNIN 472 +++ LEV + PL K CS +++ F+CS Y P C L + LPPCR C+ A GC LM +FGFQ P LKC++FP Sbjct: 144 EDAGLEVHQFYPLVKVQCSAELKFFLCSMYAPVCTVLEQALPPCRSLCERARQGCEALMNKFGFQWPDTLKCEKFPVHGAG 224 The following BLAST results are available for this feature:
BLAST of TCONS_00011372 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens)) Total hits: 1
|