|
Overview
Sequence
The following sequences are available for this feature:
transcript sequence >TCONS_00011178 ID=TCONS_00011178|Name=TCONS_00011178|organism=Clytia hemisphaerica|type=transcript|length=2217bpRun BLAST on NCBI protein sequence of TCONS_00011178-protein >TCONS_00011178-protein ID=TCONS_00011178-protein|Name=TCONS_00011178-protein|organism=Clytia hemisphaerica|type=polypeptide|length=508bp MTENEHIVDTNFYALPVAGGSKQQFFPIDIGCDDQFHVNYNAQKVFKTRKRun BLAST on NCBI transcript from alignment at sc0000122:120826..131935+ Legend: exonfive_prime_UTRCDSthree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.>TCONS_00011178 ID=TCONS_00011178|Name=TCONS_00011178|organism=Clytia hemisphaerica|type=transcript|length=11110bp|location=Sequence derived from alignment at sc0000122:120826..131935+ (Clytia hemisphaerica) Coding sequence (CDS) from alignment at sc0000122:120826..131935+ >TCONS_00011178 ID=TCONS_00011178|Name=TCONS_00011178|organism=Clytia hemisphaerica|type=CDS|length=10689bp|location=Sequence derived from alignment at sc0000122:120826..131935+ (Clytia hemisphaerica) Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Position
The following features are aligned
Expression
Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Values :
GrOo_1 GrOo_2 FGOo_1 FGOo_2 EG_1 EG_2 P1_1 P1_2 P2_1 P2_2 P3_1 P3_2 PoPr_1 PoPr_2 St_1 St_2 GO_1 GO_2 PH_1 PH_2 BMF_1 BMF_2 MMF_1 MMF_2 M_1 M_2 GEC_1 GEC_2 GEN_1 GEN_2
Annotated Terms
The following terms have been associated with this transcript:
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Blast
BLAST of TCONS_00011178 vs. Swiss-Prot (Human)
Match: FMO2 (Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Homo sapiens GN=FMO2 PE=1 SV=4) HSP 1 Score: 81.6481 bits (200), Expect = 1.486e-16 Identity = 41/122 (33.61%), Postives = 71/122 (58.20%), Query Frame = 1
Query: 1723 PVIYEQSNHVGGTWVYEAITPNCDEPFSSMYENLRTNLPKEVMSFPDMSYPRNLPSFLHHTEIKKYIENYAKKFKLYDHIRFQTKVDHVTP----NTGGGWKVTTIENGDKENMETYDSILT 2076
P +E++ +GG W ++ N ++ +S+Y+++ TN KE+ F D P + P+FLH++++ +Y +AKKF L +I+FQT V V ++ G WKV T NG KE +D+++
Sbjct: 28 PTCFERTEDIGGVWRFKE---NVEDGRASIYQSVVTNTSKEMSCFSDFPMPEDFPNFLHNSKLLEYFRIFAKKFDLLKYIQFQTTVLSVRKCPDFSSSGQWKVVTQSNG-KEQSAVFDAVMV 145 HSP 2 Score: 23.8682 bits (50), Expect = 1.486e-16 Identity = 16/49 (32.65%), Postives = 28/49 (57.14%), Query Frame = 2
Query: 2075 HYSKPYYP--QIPGLKNHYRNRTTHSHYYRHPDQFSDGPQNTCFVLGIG 2215
H+ P+ P PG++ ++ + HS Y+HPD F +G + V+G+G
Sbjct: 149 HHILPHIPLKSFPGME-RFKGQYFHSRQYKHPDGF-EGKR--ILVIGMG 193 The following BLAST results are available for this feature:
BLAST of TCONS_00011178 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens)) Total hits: 1
|
Copyright © 2024, MARIMBA.