Overview
Sequence
The following sequences are available for this feature:
transcript sequence >TCONS_00010886 ID=TCONS_00010886|Name=TCONS_00010886|organism=Clytia hemisphaerica|type=transcript|length=443bpRun BLAST on NCBI transcript from alignment at sc0000118:216923..217649+ Legend: exon Hold the cursor over a type above to highlight its positions in the sequence below.>TCONS_00010886 ID=TCONS_00010886|Name=TCONS_00010886|organism=Clytia hemisphaerica|type=transcript|length=727bp|location=Sequence derived from alignment at sc0000118:216923..217649+ (Clytia hemisphaerica) Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Position
The following features are aligned
Expression
Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Values :
GrOo_1 GrOo_2 FGOo_1 FGOo_2 EG_1 EG_2 P1_1 P1_2 P2_1 P2_2 P3_1 P3_2 PoPr_1 PoPr_2 St_1 St_2 GO_1 GO_2 PH_1 PH_2 BMF_1 BMF_2 MMF_1 MMF_2 M_1 M_2 GEC_1 GEC_2 GEN_1 GEN_2 Blast
BLAST of TCONS_00010886 vs. Swiss-Prot (Human)
Match: GFRP (GTP cyclohydrolase 1 feedback regulatory protein OS=Homo sapiens GN=GCHFR PE=1 SV=3) HSP 1 Score: 87.4261 bits (215), Expect = 1.561e-22 Identity = 40/78 (51.28%), Postives = 51/78 (65.38%), Query Frame = 2 Query: 65 SVQIRYENGPTRCGDEWSDTKVMEAIGAKLTEELGANFKHYECPDPPRVVLDRLNKLGFKFMGMTGCGQCVLWTLFKE 298 S QIR E GPT GDE SD ++M+ +GA LG NF Y DPPR+VLD+L + GF+ + MTG GQ ++W L KE Sbjct: 7 STQIRMEVGPTMVGDEQSDPELMQHLGASKRRALGNNFYEYYVDDPPRIVLDKLERRGFRVLSMTGVGQTLVWCLHKE 84 The following BLAST results are available for this feature:
BLAST of TCONS_00010886 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens)) Total hits: 1
|