Overview
Sequence
The following sequences are available for this feature:
transcript sequence >TCONS_00010414 ID=TCONS_00010414|Name=TCONS_00010414|organism=Clytia hemisphaerica|type=transcript|length=766bpRun BLAST on NCBI transcript from alignment at sc0000106:496651..497481+ Legend: exon Hold the cursor over a type above to highlight its positions in the sequence below.>TCONS_00010414 ID=TCONS_00010414|Name=TCONS_00010414|organism=Clytia hemisphaerica|type=transcript|length=831bp|location=Sequence derived from alignment at sc0000106:496651..497481+ (Clytia hemisphaerica) Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Position
The following features are aligned
Expression
Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Values :
GrOo_1 GrOo_2 FGOo_1 FGOo_2 EG_1 EG_2 P1_1 P1_2 P2_1 P2_2 P3_1 P3_2 PoPr_1 PoPr_2 St_1 St_2 GO_1 GO_2 PH_1 PH_2 BMF_1 BMF_2 MMF_1 MMF_2 M_1 M_2 GEC_1 GEC_2 GEN_1 GEN_2 Annotated Terms
The following terms have been associated with this transcript:
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Blast
BLAST of TCONS_00010414 vs. Swiss-Prot (Human)
Match: MALR1 (MAM and LDL-receptor class A domain-containing protein 1 OS=Homo sapiens GN=MALRD1 PE=1 SV=4) HSP 1 Score: 82.4185 bits (202), Expect = 2.098e-17 Identity = 43/125 (34.40%), Postives = 67/125 (53.60%), Query Frame = -2 Query: 4 CNFEKNFCSFTNMAGDNLNWQRHKGETGSWGTGPKVDHTQGNEQGYYAYVETSFSKQ-NATANLRSPRIAFTSGGDSVCVRFWYHMFGQHVGAFNLYQTQSSTKLGKMVWQRKGALVDDWVYGHV 375 CNFE C++ A D+ +W R +G T + TGP D+T G +G+Y Y+E+S + +A L SP I + RF+YHMFG+ + +YQ S G+++WQ G + W+ H+ Sbjct: 865 CNFETGICNWEQDAKDDFDWTRSQGPTPTLNTGPMKDNTLGTAKGHYLYIESSEPQAFQDSAALLSP-ILNATDTKGCTFRFYYHMFGKRIYRLAIYQRIWSDSRGQLLWQIFGNQGNRWIRKHL 988 The following BLAST results are available for this feature:
BLAST of TCONS_00010414 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens)) Total hits: 1
|