Overview
Sequence
The following sequences are available for this feature:
transcript sequence >TCONS_00009223 ID=TCONS_00009223|Name=TCONS_00009223|organism=Clytia hemisphaerica|type=transcript|length=188bpRun BLAST on NCBI transcript from alignment at sc0000091:35957..36367- Legend: exon Hold the cursor over a type above to highlight its positions in the sequence below.>TCONS_00009223 ID=TCONS_00009223|Name=TCONS_00009223|organism=Clytia hemisphaerica|type=transcript|length=411bp|location=Sequence derived from alignment at sc0000091:35957..36367- (Clytia hemisphaerica) Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Position
The following features are aligned
Expression
Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Values :
GrOo_1 GrOo_2 FGOo_1 FGOo_2 EG_1 EG_2 P1_1 P1_2 P2_1 P2_2 P3_1 P3_2 PoPr_1 PoPr_2 St_1 St_2 GO_1 GO_2 PH_1 PH_2 BMF_1 BMF_2 MMF_1 MMF_2 M_1 M_2 GEC_1 GEC_2 GEN_1 GEN_2 Blast
BLAST of TCONS_00009223 vs. Swiss-Prot (Human)
Match: ARSB (Arylsulfatase B OS=Homo sapiens GN=ARSB PE=1 SV=1) HSP 1 Score: 78.9518 bits (193), Expect = 1.566e-18 Identity = 32/55 (58.18%), Postives = 42/55 (76.36%), Query Frame = 2 Query: 2 LNETFLPEILKEQGYATHAIGKWHVGMFAKEYTPTYRGFDSFYGYYLGKADYWDH 166 L+E LP++LKE GY TH +GKWH+GM+ KE PT RGFD+++GY LG DY+ H Sbjct: 124 LDEKLLPQLLKEAGYTTHMVGKWHLGMYRKECLPTRRGFDTYFGYLLGSEDYYSH 178 The following BLAST results are available for this feature:
BLAST of TCONS_00009223 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens)) Total hits: 1
|