Overview
Sequence
The following sequences are available for this feature:
transcript sequence >TCONS_00006549 ID=TCONS_00006549|Name=TCONS_00006549|organism=Clytia hemisphaerica|type=transcript|length=614bpRun BLAST on NCBI transcript from alignment at sc0000067:261491..262104 Legend: exon Hold the cursor over a type above to highlight its positions in the sequence below.>TCONS_00006549 ID=TCONS_00006549|Name=TCONS_00006549|organism=Clytia hemisphaerica|type=transcript|length=614bp|location=Sequence derived from alignment at sc0000067:261491..262104 (Clytia hemisphaerica) Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Position
The following features are aligned
Expression
Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Values :
GrOo_1 GrOo_2 FGOo_1 FGOo_2 EG_1 EG_2 P1_1 P1_2 P2_1 P2_2 P3_1 P3_2 PoPr_1 PoPr_2 St_1 St_2 GO_1 GO_2 PH_1 PH_2 BMF_1 BMF_2 MMF_1 MMF_2 M_1 M_2 GEC_1 GEC_2 GEN_1 GEN_2 Blast
BLAST of TCONS_00006549 vs. Swiss-Prot (Human)
Match: H2B1H (Histone H2B type 1-H OS=Homo sapiens GN=HIST1H2BH PE=1 SV=3) HSP 1 Score: 122.479 bits (306), Expect = 8.692e-35 Identity = 59/73 (80.82%), Postives = 65/73 (89.04%), Query Frame = -2 Query: 137 GRXSKSMSIMNSFVNDIFERLAGQASRLCIQNKRLTMGSREVQTSVRLLLPGELAKHAVSEGTKAVTKYTSSK 355 G SK+M IMNSFVNDIFER+AG+ASRL NKR T+ SRE+QT+VRLLLPGELAKHAVSEGTKAVTKYTSSK Sbjct: 54 GISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK 126 The following BLAST results are available for this feature:
BLAST of TCONS_00006549 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens)) Total hits: 1
|