Overview
Sequence
The following sequences are available for this feature:
transcript sequence >TCONS_00005197 ID=TCONS_00005197|Name=TCONS_00005197|organism=Clytia hemisphaerica|type=transcript|length=1403bpRun BLAST on NCBI transcript from alignment at sc0000051:334767..345937- Legend: exon Hold the cursor over a type above to highlight its positions in the sequence below.>TCONS_00005197 ID=TCONS_00005197|Name=TCONS_00005197|organism=Clytia hemisphaerica|type=transcript|length=11171bp|location=Sequence derived from alignment at sc0000051:334767..345937- (Clytia hemisphaerica) Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Position
The following features are aligned
Expression
Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Values :
GrOo_1 GrOo_2 FGOo_1 FGOo_2 EG_1 EG_2 P1_1 P1_2 P2_1 P2_2 P3_1 P3_2 PoPr_1 PoPr_2 St_1 St_2 GO_1 GO_2 PH_1 PH_2 BMF_1 BMF_2 MMF_1 MMF_2 M_1 M_2 GEC_1 GEC_2 GEN_1 GEN_2 Blast
BLAST of TCONS_00005197 vs. Swiss-Prot (Human)
Match: CE164 (Centrosomal protein of 164 kDa OS=Homo sapiens GN=CEP164 PE=1 SV=3) HSP 1 Score: 147.902 bits (372), Expect = 1.722e-37 Identity = 63/96 (65.62%), Postives = 83/96 (86.46%), Query Frame = 3 Query: 378 INNQLILDEEYDENYIPTEEEIFEYARVIDIDPEREPELMYIARQGIVAPLPADWKPCQDPSGEIYYFNFSSGDSVWDHPCDEHFREMVAKERDML 665 I +QL+L+E+YDE YIP+E+EI E+AR I IDP +EPELM++AR+GIVAPLP +WKPCQD +G+IYYFNF++G S+WDHPCDEH+R +V +ER L Sbjct: 8 IGDQLVLEEDYDETYIPSEQEILEFAREIGIDPIKEPELMWLAREGIVAPLPGEWKPCQDITGDIYYFNFANGQSMWDHPCDEHYRSLVIQERAKL 103 The following BLAST results are available for this feature:
BLAST of TCONS_00005197 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens)) Total hits: 1
|