Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00002294 (transcript) - C. hemisphaerica

Overview
NameTCONS_00002294
Unique NameTCONS_00002294
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length4009

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00002294 ID=TCONS_00002294|Name=TCONS_00002294|organism=Clytia hemisphaerica|type=transcript|length=4009bp
CTACAATACCATACCATTAAATTTTGGATTTAAAAATGTCTTTCGAGACA
AGGATAAAAGGATTGACCGCTTGGGCAAATCTTCGTTTACAATATGCTGG
GCATgatgatttgatgaaaaatattgtttctGATTTTATGGTTGGTTACA
ATTTGAAAGTACTTGTTGAGTGTGTCACAGGAAGACCAttcagaaaattg
aaaacatttgaaGGGCTTTCTTTAACACAAAAAGAAACTAGAATAAGATg
gattgttgaagaattgatcgAATGCGGGATCATTCCTTCAAACATAACCT
TGGATTATAGACAAATTGCATCCAACATAGCAAGCGAGgtttttgaattt
ttctggaAGATTGTTACTTATGACATCCAATTCATATGGCTGagatcaga
tttttttcaatctgGAAAATGGGAAGAAATTGTCAAATATCCATTAAATt
tcACACCACCAATGTTTGGCTACTCAGGCAATGgtgattcttttaaaaac
atcCTACAATCCAACCAAACTTCATCAAGTAGTAAAGTGACAAGCAAAAT
GGCTGCAATAAACAGGGATATCAAAATGATTAAGAAACGACACTTGAAAT
CAATACCTTCTCCATTCGAATGTATCTACAGTCTTATCAACAAACATCTG
AAGATGACAAAAGCTGGTCAGAAATTAGATGAAGTGACTtgTTTCAGAGA
TTTGGTGGACAGCAGaGTTCTCTGTGCTCTACTGAATTCGATTGTTACTG
ATACACTTACAGCTGAAGTTTTATTAAATGACAGATGGACTGTCAACCTG
GTACTTGACTTGTTGATGGAAACATCTCGATGTACAAGCTCCTTTCATGC
TGAAGATTTGGTACAAACAGATCCAATCGGTGTCGGGTCATACTTTGCAT
TCTTTTTCATGTCTGGTTACATGATGATTCAAGCACGTGCTGTTACCAAG
GAGATGGAATATTTGACCAAAGAAACTGCAAAAAGGAAAGAGGAACTCTT
AGCCTTTCCGTCGGTTATTTACAAGCAAGAAGAGTTGGATAGGAAGcaca
aaattgaagaaaaacttGTTGTTTACAAAGAAGAAATGGCATTAATCAAA
GGAGACCATGATGTAGAGAAATGTCAACTTTGGATGAATGAAGTACAAGA
AATTCAACGCAAGGTTTCGTCAAGAGTGGCAGCTGCTATGAAACAAAAAT
ATGAACTTGTGCAGGTCAACAGTGATTGTACTGTCAAAGAATTGATAGCA
AGTCAAATGATAAATACGAGTTTAACGAACAATTTTGGATTTTATGAATT
GAAAAGTAAAGAACTGTTGGTCAGTGAACGAAAGGTGATTGTCAAAAATG
AAGATGGTGAATTCCACGATGACAAAAAATATGACGGGAAAGAAACCTCT
CGGAAGCTGTTAAATCTACCGGTTCATAACAATTGTGAATTGAAAGCTGG
TGAACATTCGAATCTACAGatcTTTCTTGATGTTCTATCTGGTAATAAAC
CTCTCAAGCCTGGTAGCAAGTTTCTGTACAAGATTTTCACTGGAGATTTC
ACCAACTCTTTGACATCCTTATTTAAAGCTGTTCGTGACCAAGAACTAGA
AACTGTCCGAAATTTGGTTTCATTCTTCGACTCGGACCCAGTCTTTTTGG
GTAGTAAATATGGCGACACAGGAAATACCGCGTTACACGTTGCATGCAAA
TATAGTACATTCAATATCGTGTTATATCTATTGCAACAAAACGCCCCTTT
GAATGTACAGAATAGAGCAGGATACACGCCCCTTTTCTTGGCGGCTGAGT
GTGGGCGTAAAGAAATAAGTCAGtTACTGATAGAATGGGGTGCTGATATT
ACCATTAAAAGTAAATCGGGTTTAAACGCGATACAAGCTATTAggaccaa
aaattttcaagactTCATTCAAAGCGTTTGTGACTATTGGGAGAAACATC
GCTCAGAGCTGTTGCTAGGAAACATGGAAACTTTTGATGAGGTCATCAAC
AATCATTTAGATGGAACGCATACGTTATCAACTTTAAATACAAGATGCGT
GAATGGTAGTTCATTGTTACATGTTGCTTGCTACTTTGGTAATGTTGAAT
TGATTAAGAGATTATTATCCgccaaaattgatattgatGTTCGAGATACA
AAACAAGCGACCGTTCTCCACCGCACAAGAACGCCGGAGGTTATTGATcT
TCTTTGTCAACATGACATTAATGTGAATGCGGTAGATAACGAAGGAAACA
CTGCATTGCACGCACGTTGCTATGGTGAACATGGAAAACCTACTGACACT
GAGTGCATCAAACAATTGATAGCTAGAGGATGTGatttatataaaagaaa
caaaaagAAATTAACGGCAATTCATTGTGCAGCGATTCAGGGACGCAGTG
ACGGTATTTTGGTTATCATGGAGAATGATCGACAAAACACATTCAAGGAT
ATACTCGATAAAGAAACGGGGaGCATTCCACCAAGTCTTGTGTATTTAGC
TATTGCAAACAATTTTCTGTTATGTGCACAATGGTTGATAGAAAGAGGAT
TCCGTTTTAAAGAATTGGAAATCGAAAGATTTTTGGAGAAGATTCTCATG
GAACAGCAAACATGTGACCAACCATCAAATACAGTGAAGTTCTTGTTGGA
AAATCACCACAATCCGAAATTCATCCTCTTTTCTGGCATGAATACCATTG
TTCACCTATGTGCAAGTCGAAGAGATTTCTGTGATGTCATCGAATATTTG
ACCAGTCAGCAGTTTGATATCAATGTACTAAATGAGAATGCATTCACTCC
GTTGCATTTTGCTGTCAACTCAAATAACATGAAGGCTGCAGCAGTACTCA
TCGAAAAGGGTGGTGACCTGATGTTGAAAGACAACAATGGAAATACACCT
TTCGATTTAGTGAAGAATTTTGAACATTGGATTGCATACCCGTTGTTCGA
TGAAACTACCAAAGAACTTCTCAGAGGACACAGTATCAAACAAGCACGTG
ACCTTGTTCGCTCCATTACACAGAAAATCGATCGAACGGAAAGTCTTGGT
ACCCCGAGAAATCGGTTATTGGACGTTGATAAACCATTGAGTGGACTCTC
GTTGACCAATGAAAGAATAAGACGTgttaaatttacataatttgatTGGC
TGAAGGAACAAATGTGTTGaattcactgacctttatacatccctggacca
agttatatccgccatctttgatcgaagtttctttgaaagttggtacccac
aaagaagtcattgtagtgtttgaaactttgcctatCGACAAACGGTGCTA
CATCATTATTGTACAAGCGAAACTAGATATAGCGCCCTctccgcgggtac
caatttcaaaaaaactccgattataatatttttcttggccggcattgagt
aacttggtccagggatatataaaggtcagtgttgaATTAGCTTATCGAAG
GCGATACCTTTTTAGATTTATGGGATCTCATTGGATGAAAAACACAACTT
TGATAATGACGTAACACATGTTGAACTGGCATAAGCCAGTATATTCTATC
CTTGTATATTCTGGACTCAAGTTTCTACAAGTTTCTCCGATATGTAATTG
GTCCAGCTACCATCGTTTTATTGACaatatctttgaaaattgtGTAGATA
TNATATGTAATTAGTCCAGCTACCATCGTTTTATTGACaatatctttgaa
aattgtgtagatatgtaaacaTATGTTAACTAACGCGCGAGAAAGTAATA
TAAAAGCAGGTTGGATCTTTTGTACTCAGTATCAAACTCTTCTTCACTGA
AAAGATAACGCAAATTTGATCTTGTTACGGTTAAAAATCTAACCGAAACG
AACAGTGGGTACACGGTAGTAAGATTTTTCACGAAATATAAAGAAATCGA
CAATAGTAGCTTTGGGGAGCTAAACTTTTTGATCTCGAAATCATCAAGCA
ATTACTTTCAAACTCCATCTCAACTCATATTTGCGTTTCGAGTTACCTTA
ATGTATAAT
Run BLAST on NCBI

transcript from alignment at sc0000019:159917..215663-

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00002294 ID=TCONS_00002294|Name=TCONS_00002294|organism=Clytia hemisphaerica|type=transcript|length=55747bp|location=Sequence derived from alignment at sc0000019:159917..215663- (Clytia hemisphaerica)
CTACAATACCATACCATTAAATTTTGGGTAAGTTCTTTTTTCTAGTCTCA AAGTATATTTCTGTATTTTTACCCTAGAAAAGACAAGGGGAAAAGCAGTA TATTACAAGGTGTTGGGACCTTTTGAAAACCTTGAAATATATGGAATATA TTGCCATTATTGGGCATAAATAGCATAGGGGACCCTCCCGGCGCTCTGGA AACTTCCGGAGCAGCTAAACTAGCCGTATTGTATAAGGGCTGCGAAGCGA TCCAGACTCCACCTCAATTCGCAAGTTGCTAGCAAAATAAGAGACACTCT AAAAATCCCTTATTCTGAATATCGCAGACCTCTACAATAAAACCCCAGGT AGTATTATAGGATAGGAGCACGAATCCGTTAGTGGATGCCAGCAGCCTAA AAATCCCTCTAATAAAGCCGCTATAGAGACAGGTTCGTAAGAGCCTTAAT GCCCCAAACACACCACATAATCCACGGTGTGGCACAACACCCGCTGCCGC CCGCGCATCGCTCTTTTTTCCTTCTACTTATTCTAGTGTAAATGGTGCAT TAATAAAATCGAACGATATTCGTCAAACGATCGAACATTTTTATTCGAAT CACGAATCGTCTGTCGTAATCATCATAAACATAAAAATAAAACAAAAACA AAAATGTACTACAATTACAAATAAAGATGGCTTGTTGGTTCTTGGGCAGT TTTGATTTATTTCTTGACAAATTTGACAAATTTGATTACCTCCGTACTTC TTTATCATAGAATATCCACTTGGTTTTGCAAGGTAAGTTTCGTTCACTAA AAGAGCACTTCTTCCGCCCGCGCGACTTGCAAAAACCTCTCATTGATTGA CCTTATTTGATACTTGATACTTGCTGTTAAAAGTCAAGGGATGATGAAGA TCCTTTCTGTCACCGTTCAAACTAATTTTTTTCCATTTAACAACAAAATA AACAGAAATAAACATTTAAAACCGAAGAACCACTGCTTAGATTGCTTAGA TGCGTGCCGCCTGCGCGGCAATTTGATCAACTTCAGCTTCTAAGTCCGTG TTTCGGCTTCTGTTAATTTTGTTGCTGTTCACTGCTAGGGTACACCATTT TAAAATGGCTTTTTTCGCAGTCCTAGCTACCAAACCAAGAAAGTTTTCGT GGATTCAAGGCAAACCATTCAAGGTCATTTTGATAAAATCATCGGTTTGA AGATGTGATTTATATATAATATAATAATAATGCTATACAAGTTCGCAGGC CACCGTGCGAGCACATGGGCCTCTATGAACCGCTCTTTGTTCGGTTTACA ATTTTCTTAAGATAGAGTTTTTTTCTAGGGCTCCCCCTGACTTTGAATTT AAAGCTTGCATCCTTAAGTGACGTGTTCATTTCTTGGGCTTTCATACACC ACTCTTGGATTGTCTTCCTTTCACTTTTCGTAAGATCTTCTGTCACACGG AAGGGCAATTTTTCTCCTTTAGTGATTGCTCTTAACACTGTATTTTTGTC TTCTTCGTTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNT TCGATTGCACTTTTTACATTCAAGTGTGTCTTTGGATCTTCCTTCTTCAC TTGTAACACATTCAGATGGGCTGCAAAGGTCGTAAATTGATGCTGAATTC TGTTGTTTTCGTAGATTTTCCTGAATTTTCTCCGCCATCTTTACATCTTT TAACAACACATCCGTTCAGTCTTTATTTGACAAATTTTATAGCAAATTTT CGCTTGGGATAGAAGTTTTAAAGGTATATACGTGCACACAATATAGCAAA ACTGCTTCGCTAATAAATTCGCTTCGCAAAAAACACTATTTTTCTCTCCT GATACTTCCGGAGCTCTTCCGGTGCTTCCAGAGCAAGTGATTTTTAACGC ATTCTAAAAAAACGTTTAAACATGATTACAAAAAAATATTTGTCCCCAGT GATGGACTTACACAGTCTTTTTTGAGAGGATGGGTTCAGCAATTAATGAA ATTGAATTTGTCGCATTATATTTGAAAGGATCACTGACAGTATAGACTTA AACTCGTATATCAAGATTACAGGATTTTGAGTACGGGCTGATTTTACTTT CGTTTTGAGTGGTTTCATTTTCGATTTCAAGCCAACATCTTAGCAACGGG GTGCTCCCCCATAGTTACAGGGGTTTGTGCAAAAAACTTAACATACCGGG TGCGTCAGAAAAAACTTTGGACGTTTGGTGAGCCACTGGGACCGAGCAAA GTCTTTTTGAAACTCAAAANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNAGCACTTTGTTGACAATCTAACTCTTGCATCAAATTTCCGCTTTCTT CAGTAAATTGAAGATGAGAAAAAACCTAAGCCACTGATCACGGATTGAAA CAAATACCATGAAGGGTGGGATTTTACAACTGCTTGCCATGCAAGGCACT GAAAAGCCACAGGTGCCAAAAAAAAGGGTTGTTTGAAATGCGGCAACCTC ATTGGTGGAAATTTGATAAACAGCTGCAGAGGAGAGCTGGGAAGCAATCA GTAGAAGAGACCACTTTCGTTTTTGTTGCAGATTTCTATAAAAACTTCTC TCAGGGATTACTTGTCAATGCACATGTACACCATGTGTTGTGTCAACTTG TCAGCATTGTATTGTTGTAAAGGAAAAGATAAAAGAGGTAAGACTAGTCT AGTTTCTAATCCTGATATAGGAGTTTAAGTTTAGACTGACTGGTTGAATT ATAAAAACTACCATGAGTTGGCTGATTAAAAAAAAAAATGCCCCTGCGCA GTTAGTTTTCACATGATTAGCATAGCGAGTGATATTGTAATTATATCGCA GATATCTTGCTCCGGAACAACAGAAGTGCACTGCCAACCATGCCAATCTG TGAAAAACGTGCTTTCGGAACACTGGAAGTGCTCAGGAATCTTCCGGTGT TCCGGAGCACAAAAAAAACAGCAGGGAGGGTCCTGACATAATAAACCAGG AGATGTAAAACAAACTGTTCGATTACCGAACTAATCAAACAATGGGTGTT TGATTAAGGACCCTCCCGGTGCTCCGGAAGTTTTCCAGAATAAAAATTTT CAAACGTTCGACGGATATTGTTCGATTTTTTTTTAAAGGGACCATAATTA CATTTAGAAGAACTATGTAGAAGGAATAGAAGAACGTTGCGCTGGGAAGT AGGACTTGTGTCTTACCGTTGTTTGTGTGGTGTGTTTGGGATATTATAAG GCTTACGACCTTGTCTCTCTTGGGTTTTATCAGAGTGTCTCTTATATTTT GCTAGCTACTTGCGAATTGAGATGGAGTCTGGATCGCTTCGCAACCCTTT TAGAATACGGCTAGTTTTCATTTTTGGATATGTTTTTAAAGTACAATGAA CTGAGTGAAATATCTTGGTCTGAAAATCGATAATAGCGGATTTTATGCTT ATTTGAAGTTTTTGACATTTTTGAGCATTGCTCAAAGTTTTTCGATATAG AAGGTGAACTTTACCAACCCCCAAAAAAATCTTTATTATTAACCTGTTTG TTTTTGTTAAATGCAGTTAAATAAGCCCAAAGTTCAAATTATCCAAAGAA AAGGAAAGATTTAGGAATATTTTGTACTTTTATCCTTATATCTAAGTATT TAAGAGTAGAAAGGTTGATGGCAAAGTTGTTTTTAGAGGTTAGTAAAATT CATCGTTTAAGATTTAAGAGTTAAGTTAAGCATTATTTTGACAGACTTGA TCCTTAAATTGTAGACCAGGAGGTAAAGATCTTGATGAAAGCTTGAACGA TCCCCATGAAACTTTCCAAAAAGCAAGATTTCATTTTTTATTGCAATCAC TTCAATTGGATAGACCAGGGACTGAACTATCAAAAATTATTATTTTGAGC AGGAACAAACTCCCCTGGGATGGGTCAGATGGCTCTAAAATACCCCTAAA ATCAAGTTTGTAGTGTTTTTGTGACGTCATAACTCCAGCTATCGTTTTGA AAATTTAGATTTTTTTGAAAATTGTATAGTTTACCGGCCATAGTTTCAGA ATCACCAAAAACCAGTTCCTCATTTTGATTTGAGAAAGCATGGTTCTTCT ATATCGAAAAACTTTTTAAGTGCAATGCCCAAAAATGTCAAAAACTTGAT AATTTTGATACACGGGCATAATTTATGGGAAAAGCTGACGCTCTGCAGAA AAAAGGAAAACAAATGAAAATGAAAGCATAAATCCATTTAGAAACAAAAT GGCTGTTGACTGGAAGTCTAAATACATGTGCCTGATGTTTCAATGTGGTT TTTAGTAGTTTTGAAAGTCTTTAGAGCTTGTGAAAGAGTTTTTATGGTAA GTTGGTTATATGTGTGTTTGCATGGGTTTCCAAAGTTCAAAAAGTCTGTC AACAAGGGTTCACACACAGACTGTAACTTATAACATTCTGTGTCAGACTA ATCTACCTAATCAAACACTGAGGTCTTTGAGATGTTTGCTTTTTTGAAGC CAAAATTCTGCAATGTCACAAAACATCTTGGCATCTTCTTCAATTTTGTC AAATATCTTGGTTGGCTTGTCTATTAGCTGAAGTTGTCCTGAGTCTTGGC AAAATGCCACAAAGAACAGGAATTCCAAATCAATTTGACATTTCACTTTT AATGAGATAACACATTCTTTTTTTTAGGATTTTAAAAATAAACAGATTTA AAAATGTCTTTCGAGACAAGGATAAAAGGATTGACCGCTTGGGCAAATCT TCGTTTACAATATGCTGGGCATGATGATTTGATGAAAAATATTGTTTCTG ATTTTATGGTTGGTTACAATTTGAAAGTACTTGTTGAGTGTAAGTCATTT TTCCATTTTAAAATGCTGCAAACTCATAAACATTATTTATTTTATGTGAA AATATATATAAAGCAAATTGAATTACAAAATGCTCAAAAAAATTGGAAAA AATTCAAGGGAATATTGTTAAATAGAGAACTAGTCCTGTCTTGCTCTTGT ACATGGCTTGTCTCGAAATGTATCTTAAAATTTTAACCAAATTTTTATAT TCGTTATGATATACTCAAGCTGGATTTGTGTGGCTATTCAAAAAAAGGTT TATTTTTACATCTATCTGCAGACACATGTTTCGTCCTTCCCAGGACTCAT CAGTGTGGCTTGGGTAAGCGAGCATAGACTGCTGTTGTCACCAAAGTGCT CAAAACACTTAAGTCTTGAGCTTTGCATAATGTTGTTTTTATGAAAAATG ATTTTCTTTTACACTAGGTGTCACAGGAAGACCATTCAGAAAATTGAAAA CATTTGAAGGGTAACTAAAATGTCTCTTATATTTAGAATAAAAAATATCC CTTTCAGAAATGTTTAAAGTTACCAACAATATGTATACAGGCACGACAGA AGGAAATTTATACAATTTTATAGCGATTTTACCGACGAAGAGGAAAATTT CGGGGGTTTTGGCGAAAATCTGATACGGCGACTGCTGTATCTTTTGAAGC AATATGTGGCGATTTTTATGAGGGTGTCCTGAAAAAAAGTTGCCAGCCCC TGTATAACATTACTGGAAACGTTTAAAAAGACAAATTCAATACGAAATTC TAACACTTTGATTTACACACATATTTTTATCTTTTTTATTTTTTATTGTA GGCTTTCTTTAACACAAAAAGAAACTAGAATAAGATGGATTGTTGAAGAA TTGATCGAATGGTATAGAAGCGTTTTTTAAAACATCTTTCAGCATTTTTT TTTTTTTTTCGCAACATATTTTCCAAATTTTCATCTTGCGCCAATTGCAC AAAAATATCCCTTTTTGTACTCGATTAATCTTCATAAACTATTGTGGGGA AAATGAAATTAAGAAAATCAAGGGGAAAATACCTAGCTACTGGATGTCAT CCCTTTTTTAACCTGGTAAGATTCATTCTTTGCTTTTTTCTCTTAGCGGG ATCATTCCTTCAAACATAACCTTGGATTATAGACAAATTGCATCCAACAT AGCAAGCGAGGTAAAAATATTCATATATATTTTGGTTTAAAAATGGTTCT TATTTTCCGATATTTTGTTAATTTCCCATCTGCGATCATTGAAACACTTT CTCTGTCTTTCTCTTCCAGGTTTTTGAATTTTTCTGGAAGATTGTTACTT ATGACATCCAATTCATATGGCTGAGATCAGATTTTTTTCAATCTGGAAAA TGGGAAGAAATTGTCAAATATCCATTAAATGTAAATATGTTATTTCTTTT TAAAATGTCTCATAACCTTGAAATTCAATCAAAAATTCTAAAGCTAGACT TAAAAAATATTTTCAACAACCATTTTGAAGCCAGTTGACAATTTGAAATT TACTTCTGTATCTTGCATGTACCCCATGTGGAAGTTTTTCTAAAGTGTCT AGTTGTGACACTTGGGCTATTCTTTTATTTTTTAGTTCACACCACCAATG TTTGGCTACTCAGGCAATGGTGATTCTTTTAAAAACATCCTACAATCCAA CCAAACTTCATCAAGTAGTAAAGTAAGTAATCACGGAGCAGAGTCTGATA TTTTGCACATGGCACTAGTATTCAATCTAAAGGCCATGACTTCGTGAATG AATTAGCCCAGTGTGGCGTACCACTTTGATCTTTTGCATTTAGATTTGAG ATGAATATTGTTGGTATAATGTAACATTCTCAATCGTACCAATTTGCAAA ATTTCTCAAAGCTACCCCTTTCTCAAAAGAAAAACGTAAATTTATCTTGA ATTATTTTTCTCTTGCATTGCTACCAATTCAGCTTTTAGTTTTACTTGTA TTTGATGCTCCTTTTATAGGTGACAAGCAAAATGGCTGCAATAAACAGGT ACTTTCAAATTATTTTTTAATTTTTTTGTAGTATGAGCTAGCATTCTTTT CTTATTTGAATTTCAGCTTATAATAATTATAGTCTATTTTTCTATGTTTT ATAAAAATATGTTTCCACACCCAACCAAGGGGGTACTGACCTTGTTAACC AAATGGAAAAGCTACACCGGTGGTTTGTAAATTGACCTTGTCAGATGATT ATGCAAAAGTATTAAGGGACCCTATAAGTGACAAGTCCCTGTTCCCATTT TTAAGTTCCTTCCAAAGCTAAAACATAACGTATGGTTCTTAAATTCAATA ATGATTATGTTCTTCAAAATAGGGATATCAAAATGATTAAGAAACGACAC TTGAAATCAATACCTTCTCCATTCGAATGTATCTACAGTCTTATCAACAA ACATCTGAAGGTTTGATAATAATTAGTTTTCATTCCATAAGTAAATAATA AGTGCATATTATTATGTAATGAATTGATAAAGTGCATTCCAAGCAAAAGG TTGCAGGTTCAATCCTTTCTCATTTCATAGGGATTTAGCAATCTATTCAT CCTTAATTCATACACCCCTTCTCACAGGCCCACTGGGACCCCTTCCCACT GAAAAAATTGGCCAAAATATCTTCTATAGTGGAAATTTATACTCCAATTT TTGTCCCCATTGAAAATTATCAGATAACCAAATCCTCACTGCAAAATATT GTGCTATTTTCTCATATCCACTGAATTTTCTGGCTCGAAAACAGTGGAAT TCAAATCCCCAGCCATAAAAAACATGGGAATATCAATCCCCATTGAGTTT TGGTCCCGGTATTGTTATCCCCACTGACTGAAAAAATCCCACTGGGTCTC TGAGAAGGGGGCGTATTTATTGTTTTAATAATCACCTCTTTCGAATTTAC TAAAGATGGGTATTGAGAGTACAATATATAAAGTGCTTTTAAATGATACA GATGGTTTCATGCTTTAGTGACTTTTTGTTAAATTTCTGTAGGTTCCGCC TAAGTTTTTGCCTCGACCTTAGAAAATTTATGTTTATAATGTTTTGGATC ATTCTATTTACAGATGACAAAAGCTGGTCAGAAATTAGATGAAGTGACTG TAAGGACCTTCCAAAAATTATCATCTTATGGTTTCTTATCTTCCTTATAA ATAGCTGATTCTTGGAAACTTTTCTGGATTATTTTGGAGTTTCAACGAAA TTAATTTATGTCGTATTTTTAAAACTTGAGTCCGAATTACAAGTCCATAA ATTATTGGCTCTTCCATTGAAATTTGTTTCCGGCCAAAGTTTGATGTTTG TATACATAATAACCATTCATTATCCTTTTTTTTTCTTTTTAAGTGTTTCA GAGATTTGGTGGACAGCAGGTTTGATTCTTTGTTCATGTGGAATAATTGG TCATTTCCCTATTCAGTTCATGAAGTTCTTCATGAAATGAGTAAAACCAC ACGCTTTTTTATAAGAATATACTTTATAAGAATATTCATGATGAAATTGG CCAAAAAATCAAGAATATGCTAAGAACATCACCATCATGGAATTTAGCTA CTAAACCTAAGAATGCCATTTCAGGGTATATTTAACTGTGAACTGTCAAT CATTTCTCAGTATTTAAGCTCAACATTTTCACAAAAATGCCATTTTATGC TTTGGACGTATGTAATTTTAATACATGTTAAATCTAGTTTGAATTTTGAC TCTTAACCTAAGAATGCTGTAAGAATATTTTAGGATAATTTTTCCCAAAA AGTTAAAGGGACATAAAAGTACTGACGAAATTTGTAAACAAACCGTATGC AGCGGGATACAAAATCAAAACAAATGTCAAATGTCAAAATAAAAAAATGA TTGTTTCAATATTGTTTTACAAGTTTGTTTTGGACAGCAAGACAAGTGTT CCCATCCAAATGTTTGTTCATTTTATAGATAGCCGCGCCATCTAAAAGTC CTAAAAGTCCTAATTACTGGGCCATCTATTCACGTTAACTATGGTATCGA CCTTATCTATAACTGCCTTTTCTCAGGCTCCTTTAGAACTAACTTGCCTC TGTTTGAAAGCATTTCTTTTAAAACGGATATTTTAAATTTCTTCTTTTAT AGAGTTCTCTGTGCTCTACTGAATTCGATTGTTACTGATACACTTACAGC TGAAGTTTTATTAAATGACAGGTCAGTAAAGTTTTTTGACATTGACTGGC CGGGGGGGGGAGTACTAGAGCAAGATGGGTTACGAGGATGCTCCGCTGGT CAGGGTACCTTTTTTAACCTCCACGAGTCCCAGGTAGGGTCGCAAAAACA CCAAAATAGAAAAATCAGTCCCTCGTAGGGTGCCTATTTTTGGAAAATTT GGCCTTGGGGAAAAAGTAGAAAATTTGAGAACATTTTGGAATTTCAATCC CATTCAGGGTCACTTTTTTCGCTAATTTCGAGTCCCACGTAGGGTCCATT TTTCGAACCTCAGCGGAGTACCCCCGTCGGTCGACAAGGGTAGTACCCCC CTCCCCCCCCGGGATTGACTGGTTGACTCACAAAAATGTCTATGGGTTTG ATGGACATTGTATGTTCCAGTTTTTAAGTGAAAAATAGCTTTTGAAAAAT CGTACATATCTTTGCCATATTTTACCCATTAACCCTTTTTTTGAGGTCAG CTGGTCATTAGTCAGAACCGAAAGCACTTTTTTGGATTATCTAATAAGTT GAGAGTAGCTTAACCAATTAGAGTATACAAAAGGGAAATACCTAAAAGAG TATAATCATTAAAATATGTTAATGATGACAATCTTCAATGGTCGATCCTT CCTTGTTCTTGCTTTTTCCAATTGTGTTCAAATACTCCAATTATTTAGAT CAATAGTACAGCCGAGCCTCAACAATAATTTACTGGTCCTTATAAAAAAC GATTGTACTTTCTACCTTACATCTGTTTGATCTGGCAGACGGGGTGATCT GACGAAAAGTCTACCGACTGCATCTTAAAAAAATACAGTTAATTCTCTCT AATTCGAACCTCTATTATTCAAATCTTTCTGCAATTCAAACTAAAATATT GGTCTCCTCAGCTGAAAAGTGGTTTAAATTATTCTCTGTAATTCGAATCT TTCTCTAAATTCGAAGAACATTTCTGGCCCCTCGAAGATCGAATTACAGA GAGTTAACTGTATTGAAAAGTCTCAAATCTTTAAAAGTATCAATCTTCTT ACTTTTCCACACCAATCCCAGCTGGCATACAACGTTGTTTCAACGTTTAT CTAACGTTCACAACGTCCATATAACGTTAAATGAACGTTGAAACAACGTT GTGTGCCAGCTGGGATACTTCTATACTTTAGATGGACTGTCAACCTGGTA CTTGACTTGTTGATGGAAACATCTCGATGTACAAGCTCCTTTCATGCTGA AGATTTGGTACAAGTGAGAAACAAAGATTAAAAAGTCTTTTGAAATAAAG AGAATATGTTTTGACAGGAAATCTGTAACCTTAAGGTTCCTGTAATCAAG TCGACTTTCATCCCTGCCTATTCTAATTGCTAAAGTAGGCAAAATTGAGC ACAAAGTTTGCAATTAAAATTTCTTCTTGAAAAAGATTGACGTCAAAAAG GGAATTGCATTGACTTTAGACTGCCAACTTTATGCCCACTTTAATTCATA ATTAGAGTAGGCAGGGCGAAAAGTGGATCGTCTAAAGGTTCTCACAAGGT TCTGAATTGCCTTTTTTAATAACCTATCCTATTATTCATTGAGCGATAAC CAAGTTGTCAAAGGCGTCAGCGTTACAAACCAGGGTTTTGCGGTTCGAAT GCTGGTCTATCGACGTTGAATATTTACTCTACTTTCTATTCATGACCTAC CCATACTATGCTGTTGTATATTCAGTAGCTCTCACAGAATTGAGACTTTG TCCATATGTATGTTATGTTCTGTGTCTTGTCTCTTAGGGTCGTAATTTGT CTGATAGCGTCCATTTTTTTTTTGGTTACGCATCTTTTTGTCTCATTATA TTTCACTTATTATCTAATCTATTTTTCTTTGCAGACAGATCCAATCGGTG TCGGGTCATACTTTGCATTCTTTTTCATGTCTGGTTACATGATGATTCAA GCACGTGCTGTTACCAAGGAGATGGTATGGAAAGAGCCTTCTTATAACTT ATCCACTTAGCCTCATTATGCTTATGCTAAACTTATGTAATGACGTAAAT ATTCTATGATAATGTCAAACGACATAAAGTTTGTTCTTCGAAAATAGAAT AAAATACTTTTGAAAATGTGTCTCTGATTTTGTTTCTAGTAAATTTTAAA ATTACAGAAATTAAAGTAAAACTTAAGTTTTGAGATTTCGTAAACTGAGG TTAACAACATATGCTTGGTCAAGCTTAAGTTTTTTCACGATTTAAGCCTG GATGTGTTTATAAGTAAGCGTTAACTTGTAATCAATTGAATAGTATTAAA CTGATTCGTCTCTTTACCAAAAAATGCAAACTGTTGTTATTTTTATGGAA TAAATTTCTTTATACATTTTTTTATGGAAAGAATTTCTATGGAATGCAAG TTCATGTCTTTATTTACAGGAATATTTGACCAAAGAAACTGCAANTCTAA GGGTATGATTTTCACTGATTTTTGCTGCACTGTAAGGGTGCAATTTTAAA AGCCAATTTTTGGCCCGCACATACCGTCAGTCCGCAAACCCAGTGCCCAC CCCCCCCCGGGTGCTAAACTTATGTAATGACGTAAATATTTTATGATAAT GTCAAACGACATAAAGTTTTTTCTTCGAAAATAGAATAAAATACTTTTGA AAATGTGGAATTGTCTCTGATTTTGTTTCTAGTAAATTTTAAAATTACAG AAATTAAAGTAAAACTTAAGTTTTGAGATTTCGTAAACTGAGGTTAACAA CATATGCTTAAGTTTTTCACGATTTGAGCCTGGATGTACTTATAAGTAAG CGTCTTGTAATCAATTGAACAGTAGTAAACTGATTCATCCCTTCACAAAA AAATGCAAACTGTTTTTATTTTTATGGAATAAATTTCTTTATAATNTTTA CCAAAAAATGCAAACTGTTGTTATTTTTATGGAATAAATTTCTTTATACA TTTTTTTATGGAAAGAATTTCTATGGAATGCAAGTTCATGTCTTTATTTA CAGGAATATTTGACCAAAGAAACTGCAAAAAGGAAAGAGGAACTCTTAGC CTTTCCGTCGGTTATTTACAAGCAAGAAGAGTTGGATAGGTATTCGTTTC ATTTCAATGTTAAGTAGTTTGCTTCAGAAAAATTAGCAATTCTTCATTAA GTGGAAACATTCTCATATCAACGATCAACATTGATCATTTAACGTCCATT CTACCCTCAAAACATTTATTAACGTTCTTGAGGGTACGTAAGTACCAATA CAATATATCCGAAAAAGGTACCTTATATTTCTTCCCTTGCAAGGCACAGT GATGCCTTCAGATTTGCGCCCCATCTCTGAAGACAGTATTAATTTAGTGC TTTCTTTATTTTTGTTTGAAATATTTTCAAAAAGCTGGTGGAAAATGGAA AATATTTCTTGCAATCTAGCATTTTTATCAAAACCACGACGGCGACAGTT CTTAGGTTGCTTCAAATATCTTACGCCTCTAGCTTTCGACTTTCTCTTAT TTGTAAAGACGGACGCATGCCTAAAACTTATTAAATTTCACTTAATTTGA GCATCATCATTTTGGAATACTATTATGGCATTTTTATAGGAAGCACAAAA TTGAAGAAAAACTTGTTGTTTACAAAGAAGGTATGGACAATGATTTCATT CATTCACAAATGATTTGTACTTTAAACAGTTATTACACGTTTTTTTTAAG AAACTAGTTTTACCAAGCAGCCTAGCAATGTTTCTTAAGAAATCGGCCTT TTGAGCCTTAAATGTTTTTTACATGTATCTAAACTTTTTGACATAATGAG TCTCATGGAAGGCTGGATTGGAAGGTTCTTAAAAGAAACCGAATTAAACA ATGTTATTTTTCTCATTCTCAGCCTCAGCATCTTTCTTAGATGTTTCTTA GGCATTCTGAGCTTCATGTTTCTTAAAAGTGTGTTCTTAAAAAAGAAAAA ACCTGTAGTACTAATTGATTATGTCTATTAAATCCACGATCTCAACTTAT ACCATCAAGCTACTTAGACGGCTTTTTGTATATCACCATTCTTTACAAAC CTTGATACCCTCGAAGACCTATGACAATTAAATATAAGGATAAATTTTCA ATTTTAATTTAACATGGGTACAAAATCCAAGTAAATTGACCAACATTGTA TAGTAAAAAGTGATAAAAACGAACCCAGGTAGGTTTTTCAAGAAACCTTT TGGCATCTATCTGAGAGTTTCAACCAAAGAGAAGGGAATCAACATTAATA TCCCCTGTCAAGTCATTATGCTTAGGAGTAACGCAGTCTAAATTCTATTG TACACGTTTTTTTTTTATAAGAACGTCAAAAATTTTCGAAGCCTTCGGAT GTTCTTAGTTTTTTGGATTTGAAGCCTAAAAATGTTCTTAAAATGNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNAAGCCTAAAAATGTTCTTAAAATGTTCTTATTTTCAGCAT TTTTTGAGCATTTTGATGTAATTTCTTAAGAAAATGCATGTTTTTAAGTC TCCGAAGCCTTAGGATGTTCTTGGAATGTTCTTAAATTTTTGGGCCTCGA AGCCTTATGTTCTTATATAGTTTGTTCTTATAAAAAAAAACGTGTATTAT TCTCTTTTCCACAGAAATGGCATTAATCAAAGGAGACCATGATGTAGAGA AATGTCAACTTTGGATGAATGAAGTACAAGAAATTCAACGCAAGGTAGTT ATTTCTTTTCTTTTTTATTGGTGTTACATTATATATATATATGCATTGTC TCCTTTACAGTGGGGTCTCCGTCGACACTCAAGTCTCTAAAAATTAAACC TTTATAACTCGAAATGATTTACAATTACGGAAACTCCACGTTAATACCTG AAGTGGATAAATTTACGCGAGGATTATTTCGTGACTTTCGGGAGTTTATC CAAAACTATGCTCGCAATATTTTGAAACCAGAATTTTTGCAAAAATACTT GTTCTTTTGTAAAAACCCTTGGGAAAATGAAATGAATTAGCTGAAAAAAG GTCAGATTCAGATTCACGAAAAAGTCCCGCGTAAGTTTATCCACTTAAGG TATCAACATTTTTTAGGTTAAATCGGTAAAAAGCTTTCTTTGTATATACA ACACCTTGATTTTCTTCTCATGTTTCCGAGTAATATAATTTCGAAAGCCT TTGGCTGGTTAAGTATATGTGTATATTGTGATTTGTATCAATCAAAACAC TTCAAAAAGATCAGACGAACTCAATACAGCGCGGCTAAATTTGTCAGCAT AGCCATCATACAAGCTGCAGTTGGCAACGTCTTTAGGGGATTGTAAAATT TAATTTAGAACATAAATCTGTCCTGATCTAATATCAAAGTTCATCTTTTT TTCAATTCACAATTGTGACAATTGGTTTACTCGGTCGATCACAGTCTATC ACTGCGTAGAAAAGTGTTGTTTTACATTCAACGCTTTATTTACATCTAAT TTTTTTCAATAAAAAGGCTCTCACCTCACGTACAAAAAAGATTTAAATCA CTGCATCTGAGATCATCCCCCATCGGGGCCTCAGCGTGGCTTAATTAGTC CATTATCATCGGTTACTCCTGGCAATCTTTTAGGTGATTGTTAAACTTGG TCCTGGTCTTATGNCAATTATCATCAGTTGCTCCTGGCAATCTTTTAGGG GATTGTTAAACTTGGTCCTGGTCTTTTATCAGAGAACATATTTTTTTCAC AATGATCAATTCACAACATGCAACCATTGGTCAGACGGTCACTTCGCGCA AATTGTTTTTACGCCTATTTACATCTAATTTTTTTCAATAAAAAGGCTCT CACTTCACGTACAAAAAAAATATAAATCACTGCATCTGAGATGATTCCTA TCGGATAAAAAGCTGCTGCTATTCTCAAGATGTACGGTCTTTTAATCTTT AGCAAGATGCAAATGTAGTACCCGACGTCTGGTATAGCGATGAACAATAC AAACGTTGTTAGAAGCCAAACTGGCACCAAAATTGTCTTTTTGTGTCGCA ACATGTCTTTACGACGGCGATTCCTGATGTTACTAGAAATTGTTGATTCT TTACGAACCCTTTGAGCAAGACTACGCTCTAATTTCAATGTCTTTGCTTG TGATTGAGATGTTGATTTTTGGACAACAGTATTTGCCATGGAATATTTCC TGGTTGTTTGGATTTTAGGTTGTGACGGGCGAATGATCTCGGAAAGTTTT CTAATAGGATTCAGTTTTGGTTGTGGAGTCGCTATTTCGGCTGTTTCTCC GATATCAGAAAGTTGTCTTGTTATACTGAGCTTCGGTTTCCAGCCTATAC TGATGCTTGAGAATCGCCTAATGGAAATGTCATCTCTGGAGAGAGGCAAT GGTAATTCATGGACACTTGTCTTATCTGATTCCTCTTCAAAGGATTTTTC GCGATAACAAGATACTCTCCATATGATGTACGCGTAAATAACAATCAAAA AAATAATGAAAAAAATTTCCAAAGGGAACCAAAGATACATTGAGAATATA GCAAGGGTGTGTTCCAAATTCTGCAGTGTCAACAAAAATGTGATCGTTGC TGACAAAGATATTGTAAGACAGGTTAAGAGTACTAACTTTGAACGGCGTC TTGTCCAGACCTGTAGATATCTGATGTTTAANTTAAGAAAATGACGTTGA GAATAAGAGAGATTAAAAAGCATATTAAAAGCACTATTTTAGTTCGACGG TTCGTTTTATGTTTAAGGTATCTTAGATTTAGATACACGGTAAAAAATCG GTCCACGGTCAAAACAATAAGGATTAATAAGAACCAAATAAAAGAACCAC CACCAGAGCAAATCATCATAAAATTCATCCAACGTTCATTTCCAACTAAT TTGAAGCCATAATAATGTGCCAAGAAAATGGCGTGTACGTTTTCAGCGAC ACTCAAATTCAACAAATAAAAACGTTGCATGACGATATAAGGGTTTGTTT GTTTGACGTTCCATAAAACAATAAAACCAAAAGTATGCATCAGTGATGCG ATGATGGATAACGAAAGACGTAACACGTTCCAATCCATTTTCCCAATCTA AATGACTTCTGTTTAGCCTCAGTGATTTATTGCCAATTTTCTGTTATACA CTTAAAATATAGCAATAATAATATAATCTTTTCAACAAAGTCTTTTTGAA TAATTTTTTCAGTTAAAACCATTCATGCAACGCAATCTTCTTAATCTAGT AAATTTGAACCAGTATTTTGCTTTAGGTGGATCTTATTTGAGATCATTTG CTCGATGACACAAATCCTATTTCTTTGTATTTTAGCTTTTTTTTTCTTCC GCGAATTTTTGCTAGAAAGGAAAGAATGTATAGATGTTTATCAAGTTGTT TTGATTCAAAGTAGCCATCTTCACGAAAGAGAAAATATGAAAAATGAAGA AAATTGAATTTTTACGGAAAGCAAAATAAACCAAACAACACTCTACCTAT ATGTTTCGAAAATGAAAAAAAATCGTCTCTTGCGTCACGAATTAAAAGAA GCCACGGTCAAACGCAAATAAGATACAAACTTTTTCCTTTTGAATTTCGA ATTTTGAATTTCGTGCTAGTGTCATTTTTTTACAAGCTATCTCTTGATTG GCCTTTCATTTTGTTTTGAGTATCCCATTCAACCAATCAGAATAAACCTT ACAAATATTTTTTGCAAGGTGTTAACAAAAGTGATGTCTTCTCTGAGAGA CAGGCTTTTTCTTTCGTTTACAACGTACAAGCCCGAATGACACATTTTGT AATAGAAATCATCAAAGTTGTTGAAAATGACCATGATAAAAAATTCTTCA TTTTTGACACTATTTCTTTTTAATTTTATTTTCCTTCCCAATAGAAATGT GTAATTTTCTTCTTAAAATTTTGCTTTCAAAATTTGGAAGCTTTACAAAT ATTAGTTTTATTGCTTAACGAAATTTAATAGTATTTTTGGAAAGTATATA TTTGATATGAGGTGATAGACTCAAAAAATAGAAAACAGGAATCCAAAAGT GCAAGTCTATCCATTAAAACTCTAGCCTTATTATTCCCAACTCTTTTCCT TACACGACATAGTAGAAAGAACTAGAGTCTATTTCATTTTACAGTTTTTC TATTTAAGCTATACTTGAATTTTAGTGTAAACACAAAACTATCTTTTTTG GTACCAAAAAATAGAAATAGGCCAGCGTCCAAGGTTCAGAAAAGGCCTTA AAAATGTTTTTCGTAGGGCACCCCTTAGATCAGGGCAAATTTTTGATATT ATGCTCCTAATAGGGTGTAGAATTGACAAAAAAAATTTGCCCTGATCTAA GGGGAGCCCTACGAAAAACATTTTTAAGGCCTTTTCTGAACCTTGGACGC TGGCCTATTTCTTTTTTTTCTTTTTAGTCGATATGTTGATGGGGTGAAAC TAAAATTCAAGTATAGCTTAAATAGAAAAACTGTAAAATAAAATAGACTC TAGTTCTTTCTACAGTTTTTCTATTTAAGCTATACTTGAATAGAAAAACT GTAAAATGAAATAGACTCTAGTTCTTTCTACAGTTTTTCTATTTAAGCTA TACTTGAATAGAAAAACTGTAAAATGAAATAGACTCTAGTTCTTTCTACA GTTTTTCTATTTAAGCTATACTTGAATTTTAGTTTCACCCCATCAACATA TCGACTAAAAAGAAAAAAAAGAAATAGGCCAGCGTCCAAGGTTCAGAAAA GGCCTTAAAAATGTTTTTCGTAGGGCCCCCCTTAGATCAGGGCAAATTTT TTTTGTCAATTCTACACCCTATTAGGAGCATAATATCAAAAATTTGCCCT GATCTAAGGGGTGCCCTACGAAGTGACACAATTCACTACCTCGGCCGCTG TTCTAAAACGAAATGAGAAAATTTGGGCAATTCAGAAGGATTCCTGAGAC TTTTTAATCTCAAGCATCTGGTTTTAATACGACCCTGATAAAATTTGATT CGTGCCTTAGCATAATGTATATCCCTGCACAATGTTTCTCAATCCTGGCC AAGCAAAATCTTTGATCGGAGCTTTTTGAAAGGTGGTACACGCAAAGAAT CCACTATTTACCACTTTTCAAAAAGCTCCGATCAAAGACGGCGGATATAG CTTTGTCTAAAGTTTATTGGCTGTCACCAATTTACTTTTCTACTACTCAC TAACAAACACAATCTTTATTTCTCCTTCCTCCAGCAGGTGAATTTCTATA GAATACTCCATGAGTACTTACATTTTTTACCACTAAGAAAGAATGAACAA GTGAAATTATATTTTAAATTAAAATACTCAAATATCAAGCCACATGAAGC CATAGTTGATTAAAACGAGTACTCGTTAAAAATCGTACTTTTACTCTCAA AACTTTAATAATTGAAATTGTTGTTTGTCTTTAGATAGAAAACTTGAGAA TTTTACTAATTGTACAAAAAAGCTTTACGAAAAAAGGTTAATACAAAGAT CCCGACTTGTAATGAGCTACTAAAAAAAGATCTTGGTTCCGATGTCAATT CCCACTTATTTGAATACTTTTAAATGCCTCACGAGAATTACATGTCACAG GGACCAATATTATAAAAATTTCCACATGGCAAAAAATAATAAATGAATAA CTGATAATCAAAATTATTCCCGGCATGAGCCATATTGGACATAAAGTGTA AAGCGAGTAGTTGCCAAACATATAACTGTTTCATTCAAATTTGGATGATT GAAAAAATTAGTTGCTTCAAAATTATTGCTGTACCAATATTGAAAAGTTT CGGATTTTCATTGATAAGTACCTCTTTTTAAAGAGGGTAAAAATTTGGTA AAATGATCTCTTTTTTATACCATAAAGATTGAATATTAAATTCTTTATTG AATAATTTGCACCAATTCCAATGGTTTTATCATGATTTATATACAGCTGA CAGATGCATTTTATACTCGACATTAAAATTAAAAGGGCAGGAATCTTTGC TACAAAAAAGCCTTTTTAACTCTAGGTATAAAACCCTTGATCTATCAATC ATATTCTGAATCCAAGAACGTTCGTGAACTGAAAAAGTCTGCTGGTTTTT CGATTGATAAGGATGGCAGATAATTTTTTCTAAGAAAACATCAAATTTAT AAAACAAAAACCAAAACAAATCTATCATCCTACAATGTGACGTATATAAG TTTATTTTTCCTTCCGCTATCAGTTCTAAAAATTCTCCGAATACACGTTT TTTTAATAAGAACATCCAAAATTTTTGAAACCTTAGGATGTTCTTAACTT TTTGAATTTTAAGCCTAAAAATGTTCTTAACGTGTTCTTATTTTTACCGT TTTTTGAGCGTTTTAGTCCATTTTCCTATGAAATTCGGTGTTCTAGAGTC CGCAAAGTCTAAAAATGTTCTTAACTTGTTCTTAACATTTTGGCCATCGA AGCCTTATTTTCTTATGTAGTTTGTTCTTATAAAAAAAACGTGTAATCTT ATCATTGAGTTTAAGCAGGTGTGCTTTTCTGCGAAGAAGACAGCTAGCGT CTGCTTTGTCTACTTCCTGATTGACTGAGGACGATGATAAATCATCACTT TTACTGTCCTCGATTTTGCGGGTCAAAACTGCGGGTTATTCCAAATCACC TCAGTCACGCCGCCGTCCTCAAAAAAGTAAATACGTAAACGAGAATAATG AGCAGATTAAAACCATCATTCCGAAAAACGAATACATGCCAGAAACTTTA CCTTTACTTACAAAGTTTAATAGCAACTGAAATTAGTTTCAGAAAACTTG CAGCCTGGGAATTCGAAAGGCCTTCGAAGANTAATAGTAACTGAAATCAG TTTCACAAAACTTGCAGCCTGGGAATACGAAAGGCCTTCGAAGAAGGCTA AATCCGAGTGTCTTGCGTTGACATGACTCGATTAGACAACGTTTAAAAAG TGTTACGTCGATTGAATGAATCCGTTGAAGTTTTTTACCATCTCATTTTT TACAATGATCTCCATGGCAAAAAAATGTTTTATTTACGAGATGCTTAGAT CGAGAGATTGACAGGCGGGGCTCAAAAATGCTTTAAGGATGCTTAAGCAA AATCTTAGGGAAATTCTGAAATTCCGTAAAATCCCACTTAAAAGCAGCCA AAATCAGGCAAATACATTTTTCGTAGACTCAAGGTAAATGCTAAGCATAT GCTTATTTTATGCCATATCTGAGCCCATATATGCTTATAAGTGCAATGCT TATAATAAAAACATGTAACTGATCACCAATTCTCATTCACAACCCCTTTT AACAACAAAAAATTTTGAATCCAAAATATTCCTTATCCCCAAATGTTACC TACGTATCTTAGTTATCCTAGACGACTAATTCAGACATAATAGAAAAGTT GAAAGCAAAAATAAACGGAAGGGGCAAATGGAAGGTTTATACAAACTGAA ATTATCACGAAACAATTATATATCACTGTATAACACGGATTACAAACGAA TCCAGTCTAGCACAACTCATTTTAATAAAATCAAAATATTAGACAAACGT TTGATTGTAAGTAGCTGGCCATAACGACGAGGTTCAAAATTGGTTGATAA GACCATGATAAAGCTTTCTTAGAATCTCTCTAGCACACGTTATTGAATTT ATAGTGAACAGAAAGAATTATGACGCCTCCAAAGTGGATGAGCTGGAATT TTTACAAGATGCTTAACTGATTGGTTATTTCTAAACAATAGGGATGACGC GTTCTTTAGAAAAAGTAATAAATACGTTTGTCTCAACATCTAACGACCAA CGGAGTCATCAAAGAGCTTGTAAAAACTCCAGCTTGACCCCTCCAAAGTA ATACCCTACAATGTGAAAAGGTCACAAAATGACAAATCACTACAACCTCT ACTTCCGGTTTTGTGGTGGTGGTAACCCATACAGTAATTTGGAACGAAAA CTAATTACTTCATTTTGAATACTAATTTTGTAATGATGTTGCAAATTTGG CATTTAGCCAAGAACTACACACATATTCATTTTTCTTAACTTAACACCCA CATCTGTATACATTTGTCATTGTTAATTAGAAAATATCAAAGTATTAAGA AATTCGAGTTTCTTATTACTCAACCAATGATGTTATGGGGTGAGGGTGGT CCACAATAATTGTCATTTGGTACGTGGGCTTTACAGAGGATACAATTATG TTTATCTGAAAAATTGACCAGATTTTAAGATTACCCTTCCATTTTCAGTC ATATTCGTTCGGGAAGATTGAAGCTCTGTAGGGTTTGTCGAAAATTTATG ACAGAGTGTCGATTCCGGGGAATGGGGGTACTAGGTTTACAGGATGACGG AGGTGCCGCCCGCTTTTCGCCCCTCGGATCCTTAGCGGGACTAAAAATTG GAAAATTTTGTGAATTTTTATGACCCTTATCGGGACAAATCTGACCAAGT TTCGATGTTTTTAGGGTAAAAAAAATTAAATGTTCTTATTTTCCCGACCT TTAATGGGACTGAGATTTATTCTGATTTTTCCCACCCTTTCAAGGACTGC CAGGTTCGAAAAAGGCACCCTTAACGGCGGCACATACCTGTACCTTCACT TGCCTAAGTACCCTCCTCCCTCGGGTGCCTAGCTCCTTGGTTAAATATTT AATATATGAATGTCAATACATGAATTTTGAACTTCAAAATTACCAAGACG TAATGTAATTTGTAATTTTATTTGTTTATTTGCGAAAGTTTGAAATTCCA AAATTCAGGAAATTTAGAGTTATGACAGAAGTATTTTAGCTTAGACGATC CTATCGTCCGTGTAATATATTAGTATGATATTACGATATAACATAGTTGT ATATTATTATAAAACGTAATATGTTGCGTGGCGGAAAATAGAGTTCGACT ATTTTTCGCCCGCGCGGACAAAATTTCTGCCCGACTGCTAATTTGCGTGT TTAAGGTTATCCTTTATTATTCGAATTCGTCTTAGATTTTAGCTTGGTGC ACTCCCGGACTTATTGATGGGATAGTTTTCTTCATCCTTTGTACTTTACA ATTTCAATCAAGTGATATAAGATAAAAGCGAAACAAACGTGTCTCCTTTC AGCTGCAGTCTTTTTTATCACTGAAGATTTTGTTTGAAGCTAACCTAGCA CTTACCCTAAGCCTAGACCCAGAGATGGAACAATGGGTGATGAAATCCAT TATTAGAAGAGTCTTTTGCTAAAAGTGCTATGAAGTTCCATGAAAACTTT GAAAATGATAGCAAATATTGCAAGTTTTGTTGATCCCTGGTTGTGCTTTA AATTTTAAAAATTGTTTATTCACGACTGTGTGGCCACAGTACTGCCATTA TGAAAATAACTGCTATTCTGATTTCATATATAGACCCGTACGTGGAGCAA TTTTTGCAATCTTTGTTTTGATTGCAGAAGCTTGCGGTTTTAACTATTTT TGCTGATAGGTAATTTGCAAGTTTATTTACAAAAGGTGCTAAAGTTTTGG ATAGAAAAAATTGAAATGAGTGCACTTATAGTAAATATAGCAAAAGTAGT GATGAAACAAATAGGCCCTTATATTGACGCCCGTTGGTCTAATCTAAGCT CGGGTCGCTTGAAGATCGAATTAGAGAGAGTGAACTGTACGTGCTTGAGA GGTCAGTTTATAAGAACTTATATTGACGCCCTTTGGTCTAATCTAAGCTC GGGTCGCTTGAAGATCGAATTAGAGAGAGTCAACTGTACGTGCTTAGGAG GTCAGTTTATAAGAACTTATATTGACGCCCTTTGGTCTAATCTAAGCTCG GATCTAAGCTATCACAGGAGGTTAATTCTTAAAAGATGGGGAGCAGTCAC TGTTATATTTGATTAAGATTTTAAACTCGTTTGACGCAAAACGATTAATG TTATTGTTTTCCTTTGTATACTTGTATTTTAATCACATTCTTTGAAACTA CTAAAAACGTGAGCTAGAATAGATAAAAGTGAATGGTCGGTTATTCTGCG GGAACAAAATTGAGGACGAGAAAGAATACTTTTTAAGTTAAAGGAATGCA CTTGTCCTGGGTACGAGGTTACTGAAATGGAATGAATATTATTTCCTTAG TGGTTGAATTAGAGACAAGTTACGGAAGGAGTTTTATAACTGTGAATAAA GTTACCTTCCGTGCAATATACTAGATTCCTTCTGTTTTCATTTTAATACA AGGCGTCGATTGCTCCCTAGGAGTAGTATGTTATAACATCCAGAAAGTTT TCTAAATCACCCTTCTGACGGCAGAAAAAATTATATTGAATTTTTTTGCT ATAGTTTTTGAACTGTTATTAACTAATACCAATTATTGTTAACTTAATAT CAAACTATATACCGGGTGCACCAAAAAAAAGTATACAGGTTTGTCAAGAT ATTGTGAGCTTCAGGATTTAAATTTTTTGTTCATTCTTTTTTTATTGTAT AGAGGACTGCTCTAACTTGAATTTTGAGCTAATATACATTAAATTTGAAA AAGCAGTTCGAAAGTTATTTCTAAAAAACTAACTTTTTTTCCATGTCGAA ATTTCAAAAAATCATTAAAAACAGCAATCACGCTATAAATAAGACAAAAT GACAAAAAAACTATTTCATTGTTTCTTTTATTCTTTTTTCTCTCGTATTA TATTTTGTCAACAGTTTGCCCATCTTATTTGCACGTCATGAACATTTCCA ACACCATCAAATTCAATGCAGGCCCAAGTTCTTTGAACAACTAGTCGAGG AATGGTGATCTATTTTTTCAAAAATTTTCTCACATAGCATAACATCAAAA CCTTGGAGATTTCCAAAAAAAATTTTCAGCTTTTCCAAAAATATTATCTT ACATAGGAATAGCTTGTTTTACCATATTCTTAAATTCCGCATGAACTTCC GTGACGAGTTTTGATGAACACAGTTGCATTTTTTGGTATTTTTATGTGTA AACAAGGTAAGTGTCAAGAGAAAAGTTTGCTCGCTTTGATGGTTTTTTGA AATTTCGATATTAAAAAAAAGTCCGTTTTTTTTAAATAATTTTTGAACTG CGTTTTCAAATTGAATGAATAATAGCTCAAAATTCAAGTGAGAGCATCCT CTATACAATAAAAAAAGAATGAACAAATAAATTAAATCCTGAAGCTCACA ATATCTCGACAAAGTTGTATACTTTTTTTTGGTGCACCCGGTATATATGT CCAGTCCAGTTTATGTAATATAGTTTTAGGGAAGTCTAGACTTGATTGAC GATGTGTCCGTAGATTCTCAAAGAGGATTTTCGTTATGTACTAGTTGTCA GTGATCTATTGATAAACCAAAACTGAGAGAGATTAATAGACTTGATAAAC CTAGTTTACAGGGTTTACAGGCTTCTAAAAATGATAAAGAAAATTGTAGA AGATTGAATTTGAAGGTGAAGGGAAAAAATATTTGCATAAAAATTTAGTA AAGTCTTTCTCAATATAATTTGCAGTGGGGACAACAAAGGTTGTAACTTT TGATGAAATTCGAATTAAATAACGGTTTTGTGCTTGTTGAAAAGATAATC AGGAGTGGAATATTGTCATAAAGAAAAAAACTCAAAAAAGGTCGGAAAAT GAAGATTGAAAATGAAGAACAAAAAGATTAACTTCTTCAATAAAAGTGAG CTTCAATTATCATTTTAACATTTTAACAATTATCATTTTAATTTTGTTGA TTCTTTGATCTTAAAGCATCACCAATGTGAAATAATTGTTTAAAAAAAAT TCAAACAAAAGTTTGACTGATTGACTTTGAAAACCTGCAAAAAAAGACCC CTTCTTCAAGTCAACCAGGGAAAAGTTTTCAGCTGTAATTTTTGTCTGAA TAATTCTACAAGAAGTTGATTTTTTTTTTCACTTTTCACCTTAATTTTTT CCTTTTAAAATTCCACTCCATAATATCTATTCAACGAGCACAAAACCGCT GAGTTCTATCAAAAGTTATAGCCTTTTTTGCCTCCCTTCAGATTATATTG GGATAGATTTTATAAGGTATATTGATTTAACAGAAGTGATCACTAAATAT AGCCATATGTAAGAGACAAGATGAATATTTTTCATACGAAAAGTAAAGTG GATTAATTAGGGTGATTTAGTCCAAATTACAAAAGTGAATATATTTGGAA ACCGATATCAAGAAAAAATTTTTCTTTCATTTTTAGATTATTTCTACAGT TACCTAATTTATATTTAGCTCTTTCAGAAAAAAAAACGTTCATTTGGGGT GGAGGATATATTATTTTTTCAATGAAGACCCCTGGACATTTTCATTTTTC ACCCCATGGATATGGGTTATACCCATAGACATTCATCAAATGCAATTTTT AGGACTTTTTTTGGGACAATTCATCCTCCACCTCCCATGAACGGTTTTTT TCTGGAAGAGCCCATTGTTTCGAGCATAGTCACAGGTAGTAGTATGGCCT ATACTAGGGGTTTGAGAATTTGTACATAGTTTTTTACGGTGGACGCTTAG TGTAGACAACTTGTTGTTACTTATTTGAAAAGGACTATTTTGAAAAATAT TTCAGCCATATTTTAAAAGCCTGCTAAAATTCATACTCTGGTGGAGGCTC GTAGCGATTCTGACGTACAAATCGATCGTCAATCTTGGGTGTAGTGGCGA AAGACTAATCGAACCATCTAGTAGTTGGTTAACGCTATTGCAAAAAGTAG ATTGCATCAATTTTGGAATAGAATGGAAGATTTTTTTTCTAATCAAATAT TTTCCATAGATCTTCTCTATAGATAAATCATTTGGAGACTATATATTTTT TAAATTCCATTCTTAAGATTTATTGTCTCCTAGATTGAATCTGATAATAT AATCTTGTGGTCTCTAAATCGATTTAACAAAAAAAATGAATAATATTCCT CAAGCCTTGATATTAGTTTTATTTAATCAATTTTTCTTCATTTTTTACTT GCATGGCTCATGGCTCTGGTGTGAGTGCCTGGTATCAGGGATATGTTATA GCGGAGCTGGACGAAGGACGAGAATTCCTTAGCGGAGCTGGATGAAGGAC GAGAATTCCTTAGCGGATTGCTTCTTTGTCTTTTCTATTGTAAACTGTTG ATAATAGAAATCCATCTCTGTCCCCTTAAGTGTTCTATTTTTATAAGAAA AATGAAGCAGACAAAATATTCATGCAGTACGTTTGCACATATTTTGCTAT GATGTTCCCGCTTTTCATTAGCCTGGGTATCCAGACTCAAGATTTTAGAA AGAAAAACTCTTACCTCAACATACAAAGTTTCTAAAATTTTAGAGTCTGG TGCAACTAAAAAAGTCTGATACAGTTTTGAATGCCACAGTCTGTGAGTGA ACCCTTGTTGACAGACTATCAAAACTTTGGAAACCCAGGCAGACACACAT AATTACAAACCTTATTTACAAACTCAATAAACTTTCAAAACTACTTTAAA CTACATCCAAACGTCAGCCACATTCATAAAGGCTCCTTTCCATCAGCCAT TTTGTTTAGAAATGAACCTGGTTTTTCATTTTCATTTGTTTATCTTTTTT TGCAATGTCAGCTTTTTCCATAAATTATGCGCGCGCATCGAAAAATATCG AAAACCCCGCGAAAATTCCGCTCAGTGACTGGGCGCGTACTGACCAATTA TATACACTCGCATATGCAGGGACAGATATCCCTGTAGAGGATTTAGTTGG ACCAGACCGTAAACCAGAAACATGATCTTAAAAGAACTAGACGGTGAAAT AGTTTACGGTCTGGATATCCAGGCTAGCTTTTCATCAAAATAATATTTGT AGAAGATACCCCAAAAGCTTCCTTGTAAATGAAATCTATTTTTATCAGCG TGTGTTATGAATTTGAGAAGCTTTCATNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCAGAATC ATTGGCTAAGAGGAAATCCAAATTTCACGAGTTTGTAATTAAAAAAGTTA AATTTCATATCAAATTTTAATGTCAGGGACAGAGATAGAACAAGGATTTT TTAAATGTGCGCTATCCAGCTGCGCTATAACATATCCCTGCTGGTATCAA CCAGTCAAATGATACAGTGCCTATGTTTATGGAAACAACTTAAATGGACA TTTCATTTTTTCATGCTGTGGATTTATGGACACAATTACAAACTTGAAAC TGTACAGGGTGTCCCTAATTAAAGTATCGAGTTTGAACATGCGATTGAGT AGAAAAGTTTGTGTGTGTTATCGCTAAAATATAAGAACGTTCTCCATCAC ACAGGCTTATTACAAAAGGTAGTAACAACGTATAAATTAATCGTAATGAC AAAGAAAAAAGAGGGAGAGCTTAAAATACAATTTTGTGAATACACACATA AAACTTTCTACTCAAAGTTGTGTTTCGACTCGATACTTTAATTAGGGACA TCCTGTATTGGCATTGAGGAGACAGTCTTATAAGCATTTCTTAGAATTAT TTAGCTTTCGATATTCTCAGGAGAATATGGGGGAGTTTGAACTTTTAAGG TGAGACAGGATTGGCCCTTTTTTAGTACGGTATTACGGAATTTGACGAAA AAAGAGACGGGAAAACGGTATTTTAAAATCAGACGGTGACGGTATTTAAG TATATTTTTACCCTGTACAAGCCGGTGTGACGGTGTTATTATTTTTTCAA TTTTCGGGATTCCGGGATTCAGCAAAAATTTTGACGGGAAAACGGTATTT CGAACCCCTACAACCCCCCCCCGAATATTATACATGCCACCGGGTGAAAA AATGTATTTTTGAATCCCACATTTTAGAAATTCGAAATCCTCCCTCCATA TCCAAAGTCAACCAGAAATAGGGCTATTATTAAACCATACCGACGTCCCC TGAGATGAATCATGCTATCGTCTGTTACACGTTTTTTTTTGTAAGAGCAT CCAAAATTTTTGAAGCCATTAGATATTCTTAACTTTTTTAGTTTTAAGCC TAAAAATGTTCTTAGCATGTTCTTATTTTTGACCATTCTGTGATTATTTT TGGCCATTTTCCTAAGAAAAAGGGTGTTTATGAGACCACAAAGCCTTAAA ATATTCTTAAATTATTCTTAACATTTTTCATTTGTGCACAATTTACAGAC GCAATGGGTGGTTTAGGGTAAAAAATGGTGTCAATAAGGTTTGGAACAAA CGTTATAAGTTTGACTATTCGCCCGCTAGGTCATATTTAGATTTTCAAAC GTCTAAATTGTGTAAGAACGATTGTGTAGGTCGCTATCCGCTGTGAAGTA ATCGGACATTAAGTTTGTAGGTCTTCGACCGCTGGAAATCCCCGCGATAA AGTTTAGAAGGTCTACGGCCGCTGGTGAAAGTCTTCTTCCGTTAACGGAA AAGAAGTCAGCGCAAACTCAAGGCCGGTCTCCACCTCCGCGCGAAATGAG CGAAAATTTTTTAACGTTTTTGTAAGGTCATTGGTCGGTTGAAAAATGAA GCAATTCCATTGGTCATAATTGACGAAACGGTTGAAAAAAGTTGAGCTTC CTTAAACTTTTTTTTTGTTTGCGCGAAACTTTTTTATGACGTAATCTTTT CTTTAGGCAAAAAAGGTTGAGAAAAAAACTGTCGCCCATTTTGCGCAAAA GTGGATACCGGCCTTCAGTCTCTAATTTTAAATCGATGCTTGGAAACCTA ATTCATGGAACCTTTTGTTAAAACTTACGTTTTCGCTATAGAAAATTTTA AACAAAAAAAGTTGAGCGGACTGTATTAATTCGTTACTTAGGAAAACTAG TTACTTAGGCAACTCTCCCTTCCTTCTACACGTTTTTTTATAAGAACATA ATATATCATTTTATATAAGAACATAAGGCTTCGGTAGCCAAAATCTTAAG AATAAGTTAAGAACATTTCAAGGCTTTGTGGACCCAAAAACACCTAATTT CTTACAAAAATGGCCAAAAATACCCAAAAATGGTGAAAATAAGAACATGT TAAGAACATTTGGAGGCCTCAAAAATATTGGATGCTTTTATAAAAAAAAA CGTGTATGTAACATTCATCCGAACTTTGTAGGAGGCAATTAGCGATAGAT GTACATCGAACCGTAATTAATCACAATTCTCTCTATCATTTATTTTGCCG TATTCCCTACTGGGATCTCAAGTAATTCACGAATATATTTTAAACTTACT CATTTTTTTTCAAATTTCTTTATTTTCACAGTAATTGCTAACAGTTTATG TATTGATAACATATTGTTTTTGAAGTTTCTATTTACCTTTATATGAAACT GATGAATATTCGAAAATTTAGCTAGAATTCAGATCATTAATCAGGCGTTT TGAATGAGACTTTGGGACATTTTATTCGGGTTTTGGTAATAGATGCTCAT TTTTGACGATCCATACTTTCAAAAGGTTTATTTCTTGGGAATATAAGGCT GAAAAGGGACCATAATAAGGCATATCAGGTGGTCAAAATCAAAATTTTCA ATCGAAATTTTCTTCTGATCAGCGAGAACCATGGTTGCGCACATACACGC TTTATTTTATAAGAATAGTGTTTTTTCATTTCATCTTGGATATTCTTAAC TTTTTGAGGAAAATCATCCTAAAATATTCTTACGGTATTCTTAGGTTAGG ATCCAAATACAACCTAGAATTGACATGTAAGACATACCTGAAGCAAAAAT GGCATTTTTTAAAAAGGTTTTCCTGGGGGATAGTTGGCAATTTACAGTTA AAAATTCTCTAAAAGGGGCATTCGAAGGTTCAGTTGCAAAATTCCGTGAT TGTGATATTCTTAGCGTATTCTTAATTTTTTGCCCAATTTCATCATGAAT ATTCTTTAAGGGCTAGATGTCGTACTTTTGCTGAAAAGTGTGCCTTAGTT AGGTAGGAAATCCTACTTAGGTCACGTGACATTGCAATAGAATTTCAGCG CTTGACCAATCAGAAGCTTCGTGGGCTTTCGAAAACAATAGCAGTAATAT TTTTTGCGATATTCACTTTTTTTTTGCTTAGAAGAGCTTAAAGCACGATG GGTAGCCTTTCGGGCTTTACAAATCTATGGTTGCGCATCCTTAGTCGCTG TATTTTTTGCCCCTTCCACTTTGCTACAATCTAAACATCTTTGGATCATT TTTTTATTCCTACTCCCTGCNTTAGTCGCTGTATTTTTTGCCCCTATTTA AACATCTTTGGATTATTTTTTTATTTCTACTGCCTGTTCTAGTTGTTTAT TTTTTTACAACTTTCACCTGAATTTTAGAAAAATTTGATTAAAATCGAGA ATTTAGAGACTTGTTTCGACGAGGAAAATGGATTGGAACGTGTTACGTCT TTCGTTATCCATCATCGCATCACTGTTGCATACTTTCGGTTTTATTGTTT TATGGAACGTCAAACAAACAAACCCATATCTCGTCATGCAACGTTTTTAT TTGTTGAATTTGAGTGTAGCTGAAAACGTACACGCCATTTTCTTGGCACA TTATTATGGCTTCAAATTAGTTGGAAATGAACGTTGGATGAATTTTATGA TGATTTGCTCTGGTGGTGGTTCTTTTATTTGGTTCTTATTAATCCTTATT GTTTTGACCGTGGACCGATTTTTTACCGTGTATCTAAATCTAAGATACCT TAAACATAAAACGAACCGTCGAACCAAAATAGTGCTTTTAATATGCTTTT TAATCTCTCTTATTCTCAACGTCATTTTCTTAATCACGTTACCAAACCTT GACAGAACATTGACTGTCTTTGCAATGTATATATGGTTCCCTTTAGAAGT CTTCTTCATATTCTTCTTGGTTATAATATACGCGTACATCATATGGCGAG TATCTTACACGCGAACAACAGTTTTACCAAAGAACAAGGAATCGCCAGTG GAAAATCATACTGAAGATTTCCCATCCACTCCCAATTCCAATCGAGTCAA ACCTGAAGTAACAGTCAATAGTAATGTCTCCCAGGCTAATTTACCGAACA GGGAATCCCCATTATCAATCACGGAATTACCCTCAACAATCTGTTATAAT CAAGACATCCCCTTATCTCCAGCAAAACCAAAAACATCGAAACAGGTTCA AAAAGTGGCTAAGAAACATATGAAGCAGTATAAACGCAGCCGAACGGATA TGTCTAAACACAAGAAAGCTATTTTAGTACCGGCTTGGTTGGTAACAACT TTTGTAGTCTTTATTGCGATACCAGATGTAGGTTACTTCATTACAGTGAC TTTGATGAAAATGCCACGACCGTTTGCGTTGAAAGTTGCAGCGGCTTTTT ATCCAGTGGGGATCATTTGTGATGCAATCATTTACATTTTCTTCGTAAAA GAAGTTCGAACGTATTTATTGAAGAAAATTAAATGTTGCTGAAATCATAC TCGATTAAAATGAGTAGTACAGTTTGACTCTCTCTAATTCGATCTTCATG CGACCATAATTGTTTTTCGAATTAGAAAAAAATTCGAATTATATTGAGTA ATTTAAACCAATTTCCAGCTGAGGGGAACCAATATTTTAGTTCGAATTAC AGAGAGATTCGAATTAGAGAGAGTCGACTGTACATATCGCGAGAAAACTT TGTACCATCCAATAATGAGAAAATCCAAAAACTTGTTTAAAACGAATCGT TTTTTCAATTTTACTTTTTTTGATTAACTTTTAAGGCATAATACCGGGTG TCCGGAAAAAAGTATCGAGTTGAAACAGAACTACAAGACAAAAGTTTTTG TGTATATTCACAAAATTGTAGTTTGAGCTCTCCCTCCTTTTTTTTCTTTG ATTTTTTATAGACGTACATTTGTGCAATAAAGAGCTGTCAATTAATACGT TAAAACAAAATATTCTATTCAGCGGAAGTGGGGAGACTGGGGAGACTTCA GCCTCCCCACTTTTGAGCAAATAAGATTTTCTTCTCAAATTCCTAGCAAA TTTTATATCATTTTGAGCCTTCAGCCTCCCCACTTTAACGGTTGTTTCCG CCGCGGGCCTGCATATTTCTCTTATTTTGACAGTAACACACACAAACTTT TCTACTTTAATGTTATGCATAGACTATGCTATAGTCTAAGACAAATCACT ATCTAAGAAATAAGCCCATATACCAATAACAAGTCAATATCTCCACAATT CTCCAATCAAGCTGCAATTTACTTCTAGTTTTGTCTATTTTCTTTTAAGT CTCTAGTCTCCCAAGTTGTCGATAAGATAATAAATAGTTTATTTTCTATA TTTCAAATTTAAACTATTATATTTTTAGTACTTCATGTTTAGCCATTTTC AAGCAATCGAGTTTTTTTTACCTTCAATAGCCGATCACGATCTCACTTCT TTTTTTTTCACAAGGTTATTTTCAAGCATCAATCCCACATTCAACAACAC TACTTTTGCTCTTCTTTTGTTCCGACAAATTATTATTGTTTAAAATAAAT TTTTATTTTATTGCTTTTTAATTTATTTCATATTTCTCAATCCAATTCTG ATGAATACTGTCTGACACTATACTTAGTCTCCACCATTTAGAATTTCTCC GAGTCCAAAGCCTTGCCTGCAGAGTTATATCTTTCAGAAGTGAATAGGCC TCACTGAAGAGATATATAGCTCTGTATTTCAACTTGCCCAGATAGGGCAG TTGTACAATTTTATNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNTATAATTTTTTACATAATAATTTATTTATTTATT TAGTTTACTTATTATAAATAGGACGAATAGCCATTGAGATATATGGAAGT GCCTGAAATACAATTAATAAATAATAATAATAAAATAATAAATAAGCCTG AAGCCGAAAAAAATTCGCAAACACGTTTTTTGCCGAAAAGATTTTACTAT CGGTAGAGTTTGCCAGTTATTTCTTCGAAACTCTCCCGCCGTAACGCCAC ACTGTCATATTTTCCCGCCTTTACTATCATTGCAACGGACGATAACATCG TCTATGTTATTTAAAAAAAAAATTTTTCTTCGAACACCCTGTACGAAGAA GAAATATCTATGACTCTTTCATACACTGTTTTAAAAATTTCTTTGTGTTT CTGCATTTTAAAAGCTTACTAGTATGTTCTTTACAGTAATTCCCGTAAAT AGCCACATGAGCACGAAGTAAATGTATCGACAAAGGATATAGATGTCGTA AAAAGATAATTTGCCGCCGCAAATTTAGCCTAGACGTCCACGTTACTATG TACCAGGGTGTATCTCACGTTCAACATAGCGTAGTACTCTGTGGTAATGA ATCTTGAAATTTCCGTATAACAGACAATGACCACGGGCGAGATTTACTCT TTAGCTAGTTTTAGCATGCTGTGTTTTCTATGATGGAGGCGGTTAGACGG TTCTCTGTACACAGACCCAGTATCTACGGCTAATTTCAAAATTCATTGCC GTACAGGGTGTGTTGTCATTGTCTTTTCTCATTTTTTTATCAAACAGACA ATGCGCACAGAGTGTACTGCGAAGCGATAAACGTGAGATACACTCTGATA GAGAGTAGTTAGACGGAGGAGGACGGTAAATTAGCGCTATTACAGTCCTC GATTTTTTGTATCAAAACTGCCAGTTATTATTTCCAAATCGTTTTCAGTC ACTTCTTCATTTTCAAAAGGGTAGATACATATACACGTTTTTTTTTTTAT TAGAACNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNATT TAAGAACATTTTAGGCTGAAAATTGCTAAAGAAAATAAGCACATCCAGGC TCAGCCAAATTTTAGGTGTTCTAATAAAAAAAAAAACGTGTATAAAATCG CCTTTGAAAGTAGTAGTGGTCTGAAGCAAGCGAGATAAATCCACTTATCT TGATGTAAACCCTGGAGGCAGTTTCTCAATTTCTGCCAAGTGAAATCTTT TGATCTTTTGACTTTTTTTATAAATTTTGTTTTAAAAACACACGGGTCGC CTGTTCTGTAAATAAGTGGCTTCATATTTCATCCAGGAGTTTCAGGTCTA GCACCTTCGGGGTTTTGAAATCAATGGCTATACCCTAATGGTTCCACTAC ATTGTGTTGGTGTATTGACCAAGGAAGCTGTGTATACTTCTCCTAGAATG TTCATGATGTAGCGCCGTTAAATGTTAGAGAAAGTCTTAAACACTGCAAT GATTTTCTTGCGGATTCTGCTTAAAAAAACGCAGGTCAAAGATGGCGGAT ATAGCTTGTCTAGAGTTTATAAAGGTGAGTCAATTCAATAAGATTTATCT ATTTACAGATTGACTTTCCCGAGTCTGTAATTGTATACTTATTGCCGTCA AAAGCTATCGGTAAATATTTCTCCTTTTTTAATTTATCAGGTTTCGTCAA GAGTGGCAGCTGCTATGAAACAAAAATATGAACTTGTGCAGGTCAACAGG TGACGTCCATTGTATTGATTGCATAATTATAGTATAATGGAGCCTCTTTA ACTCAAACCTCTTTAGATCGAATGCCTCTTTGACTCGAACAAGTTTTATG GCCCCTTCCCGGGGTCCCTTCAGTTAACAATGCCTTATAAACCTTGTTCG ATAAGTCGGACAAATTTGTCCCCACGCGTGTCCGAGTTATGGAGACTCCA CTGTATTGTGATGTATTACGTCATGTGCAATGATATCTGTACAGTTCCTC GAATGCAGATTTATTTACGTCGGCAAAAGTTGTATTTACGTCGATATTTA CGTCAATCAACTCCAAATGCTGTCATGCGAATCAGAAAAAACTGCCGTGG ATCAATGTTAAAGCAGTGTTTGCTTAAAATTGTGAGAGATCTTCCTTTTG ACACAGCTTATTTTTGAACTCAACCATGGCTTGGCTTTGCTATGACTATT GTACTAGGGTGGCGAGATGACGGGTATATGCCGCTCGACACTTTAGACCC TCAGATCCTGAGCGGGTTTAAAAAGGAGAAAAAAAGGAAAATTTTATGAG TTTTACGACGACTGATTTGACCAAATTTTATTTTACCGGCGCTTAGTGGC ACTAAAATATAATTTTCTGATTTTTTCAACAATTACAGGGACTTTCAAGT TCCAAAAAAGCACCCTTAGGAATGACACATACCCGTACCCTTCATTTGTC TAGGTGCCCCCATCCCGGGGGACTTAACGCATCAACGATAAAGTAAACTA CTCGATTCTTACTCTTTTTGTATGTAGTGATTGTACTGTCAAAGAATTGA TAGCAAGTCAAATGATAAATACGGTGGGTTCATTTTATCTTTCAGTCTTT TTATAATGTAAGAACAAGTACCAAAAAAATTCAATAAATTTTTTATTTAG GGCGAGAGAATAAGGTAGACAAATTTCATTTTGCATTTGGCTAATTTAGA AATGAAAATGGAAGAGCTAGAAGGGAATTCGCGAGGGCTAAAGGCCGGTC TGGACTTGTGCGCGCTTCGATTGCACTTTTTCGAGCAAAGCTTCCACGCT ATTTGGTCAAAAGAAAAATGAGGCAACTCCCATAGGCGCGATCTGACGTA ACGGTTGAAAAAAGTTGAAATGTGTTCAACTTTTTTTTCGAGCGCGCGCT ACATTTTTATGACGTAATCTTTTTTCCAAGCACAAAGGAATGAAGCCAAA AGGTGCAATCGCAGCGCGCGCAAGTGGCGCAAGTGGAGACCGGCCTTAAG CAGCATACTTGTGATGATGTAGCGCCATTTGACATTAAATCTTAACACTG CAATGGCTTCTTTGCGGGTATCACTTTCCAAAAAAAAAGAAGCTGCGATC AAAGATGGTGGATATAGCTTTGTCCAGGTTTTTTTAAAGTCAGTGATTCC AAAATGGGATCAATGAGGGTACTTGCTAAGAATGCCATTTTTTCATCTCT ACACATTAGAGTTTAACGAACAATTTTGGATTTTATGAATTGAAAAGTAA AGAACTGTTGGTCAGTGAACGAAAGGTGATTGTCAAAAATGAAGATGGTG AATTCCACGATGACAAAAAATATGACGGGAAAGGTAAAGTTCTTTCTTTC TTTTTATATTGAATTCTACTTAACGATTTTTTACAGTGAGTCCCAAAATA AAGGACATATTTTTATGTAAAGTAAAATCTAAACTGGAAATAATTGAAAA GATTACGTTACGTTGACTCTGTTGATAGAATAAATATTTAATTCCAAGAG ATTTTTGAGAGTCATCAAATTTGGCATAAATTATAAGGATTTTAAATTAT ATAAAAATGTGTCCACTTATTTTGGGACACACTGTATGTGTTGAGCGTCT CAACTCACATTCATCCTGATAATAATGGGGCTCGCGTTTCTGGATAAATA TCGGCTCGCTTTTCATCTTACATCCGATCCCAATGAACTTATAGAAAAAA AACATCATTTAAAGGCGATTTATTTTTTCAAATTAAAACCAGATTAAAAT CCATAGTTGAGAGAATTTTCAAATTACAGAAAGATTCAACTTATAGAGGT TCATGATAGAGACAGTTGCCTGATTTATTTTGCTGAACATTTTTTTCGAC CAACCCCGTTACCTTATTCAAATTAGTGACAGTCTTACAGTAATTTGAAT AAGGTTGCGGCCGTGGTCGAAAAATTTTCAATAAAATAAATCAGTGGGGA GACGAAGGTGAATCGTTGGGAAAAATTGTGTACAAGTTTTCAAGGCTTTT TACTTCTAGTTTCTTGGGGAGGGATACCTGGAAAATAATGAGTAATAAAT ATTGGAAAGCTCTACACAGCAATAGTTTTTAAATATCCGTAAATATAGGG TATTATGTTTGCAGACACCTTAGATTATGGTTAGGATAAGTATCAACCTC CATGAGTATTATTTGTTTTTTTATGTTTACTGATAGTACTAGATAAAACA TCAGCCTACACCAGGATTTTCTTTGGTATCCATCAATAACATATATAAAG CCTGACATACAAGGGCGCGAGATGAGTATTTCATTTCTTTTTTCCAATAG AAACCTCTCGGAAGCTGTTAAATCTACCGGTTCATAACAATTGTGAATTG AAAGCTGGTGAACATTCGAATCTACAGGTAAGATGAAAGCAACCATAGCA TAAAGGTTTTTATGGTTTTTTTAGTTGTGTGAACTCCACCATTATTGAAG CAAACGTTCAATTTGCATAAGGGAACGCCTTCACAGGTTCTAACGTTTGC TTTCATAATGGTTGAGGTTACGTAACTGAACAAAATATGGAAAACTTCTA TAAAGGTACAGTACACAAGATTCCGGGCCTGGCCCTTAACTAGTGCGCAG GTTTTGCTACCTAATGCCTCTTTGCCCAATGCTCAACACCTGGAGCAAAT GATCAAAGATAAATGTATAAATCCGGGGAAAGTAATGGCGCCCGCTCTAA CCTGCGAGTTGAAAGCTAAGAAAAAAGGGAGCCTTGACTGCCACAACTGC AGTCATAAATCTACAACTTTTAATTTTTTTACGCCCACGACGTGGGATTT TCTGTATTGAATAGAGAGATTTATTTTGCTTGAAAACAATGAATTACTGG GTCCGGCAGCTTCTGATTGTTTTGTTTCTCGGTTGATTCGGATTAAATTT ACCTTTGTTGAAATTTTCTTTTTTTTTTAGATCTTTCTTGATGTTCTATC TGGTAATAAACCTCTCAAGCCTGGTAGCAAGTGAGATTCTCAATTTCCTT TAAAAAACATGCTTTTTAGTGATCCCTAAGTTATTTATGGTGATTTCCCC AATCATGCTATTGAAGAATTTTGTATATGGGCATTCGCATCTTCCAATTT AAAATGTTTTTTTTCTATAAAGATATAGATAATATAATATTATAAGAATA TAATATTTTAAAACGTTTGCCGTCGCTGGAAGAGAAGAAAGTTCTTTTGT CTAAAATACTGTGTAAGCAAATGGCAGGAGATACGATAAATGGCGTCCTT TTAATTCATTGTATGCTTGCTTCCTTCAGGTTTCTGTACAAGATTTTCAC TGGAGATTTCACCAACTCTTTGACATCCTTATTTAAAGCTGTTCGTGACC AAGAACTAGAAACTGTCCGAAATTTGGTAAGGTGATTTTGTTGTCAAAAA AAATTTGGTAAGGTGATTTTGTAAGCGTATCGATGAAGTTTCTATGTTTT TCTATGTTTAGATATGCTGATGAAGTCACGAAAGATGACGAAAACTTCAA CTTAAGCAGTTGCTTCATTTTTTTGTTTTCTATATTTGCTGCTTCAACAT TTTACGTTTTCGATGAAGTTTCTCTATGGGGTTGTTTTATCAGACATTGA ATTGAAGAGCAGCTCTATTCGTTGAATTATCGATTGCGAAGTTTTTGGTC TTAGTTTTTAAGTCTCTTTTTAGATCATTCATTCGAAAAAAGCTGGAAAA TAACGAAATATTTCTGCAAACTATCGCTCTATTTTCTAGGTTTCATTCTT CGACTCGGACCCAGTCTTTTTGGGTAGTAAATATGGCGACACAGGAAATA CCGCGTTACACGTTGCATGCAAATATAGTACATTCAATATCGTGTTATAT CTATTGCAACAAAACGCCCCTTTGAATGTACAGAATAGAGCAGGATACAC GCCCCTTTTCTTGGCGGCTGAGTGTGGGCGTAAAGAAATAAGTCAGGTAA GTTTTTCAAGTCTGCAAATCAAGGATTTATTATACACTGGATATACAAGT AACAGATTTTTGCCGATTTCTCGTGTACTAGCTATGTCCGCACTAATGAT ATTATTGTTCACTCTCCTCCGCATTTTTATTGCATTTCTTATCGAAAATC ACACATCCAATTCCCAAAAGAGATTTAAAACTTTCCTGTGAGAGTCATTC TTCCACTTAATTGCTAATTATAAGTCGTTATGACGTTTCAAGCTGTTTGA AAGATGCAAAAGACGTGTTGTATATGAGAAATTTAATGTTGACACCGGAA ATTTTCAAACTTCAACCTCAAAAAAACCTCCTTGCCACCACGTGCCTCCG AAGGATTTTCATACCACAGTGGAGCCAAGACACTCAAGTCTTATGTATGT TAATTTCAGCTCTTCTGGGGACAGTTTTGGAAAGATATTTCCAATTGAAA ATTTAGTGACACTATAAGCATTTTGTCTGAATTTCTTGTCTAATGATGTT TTTCTCACATTAGATTTCACAAATATATCCAGCTTGGTATTCTAGCCTTA CTTTCAAAGTTTTTTTCCTGCAAAGGTACGAAAAGAAAACGCTAGAGAAC TTTTTTTAAATGAGATTAATAAACATTTTTAAAAATTAGACATCTTCGAG CCGCCATGACAGTTGTCCTTTGCGGACAAAGCTAGAACATCAATTGTTTT CTGAAACAATGAAAATACAATGATCGTTCTCCATCGTTTTATGAGTCGTT TATCCAGTGTATAATAAATCTTTGTGCAAATTATCGGTTTCGTCTTACGT ACACGAGACTGTGGTTCTCAGGCATTAACGTCGTTAAATGATTAATGAAA AACTTTTTTTAGAAAAATACACGTTTTTTTATAAGAATATAAGGCTTCGA TGATCAAAATACTAAGAACAAGTTAAGAACATTCAAGGCTTTAGGGACTC TGGAACACCCGATTTCTTAGAAAAGTGGACAAAAATACTCAAAATATGGG GAAAATAAGAACATAATAAGAACACTTTTAGGCTTAGAACTCAAAAAGTT AAGAATATTCAAAGGCTTCAAAACTTTATTTTCTTAAAGAAAAAACGTGT ATTATGCTCAAAACAATTATTATGAACAACTCAAGGAACGAAATTGAGCC AGGAGTCGTTGAATTTAAGAGATTTAAGAGTCTAAGTAAAACATTGATTT AAAGCTAAAAATTCCTCAATTTTAATCCAACAATAAGAACAGAATAAGAA CAATTTGAGACTCAAACAAAGTCAGAACATGTGGTCCTCAAGAAAAGTTT ACCGACTCTTATGGTACATGAAAAGAGTGCACTTTTATTAAAAGGAAATA TTTTTTTAATATCCAACGATATTTTTTTAATTTTATGTTTCTAACTTTAA AGAGCTATCAGATAAAGATCTACAATTATACCCATCCCCTGTCGCGTTTT TTCATACATTTTTTTTTTTACTTTATAGTTACTGATAGAATGGGGTGCTG ATATTACCATTAAAAGTAAATCGGGTTTAAACGCGATACAAGCTATTAGG ACCAAAAATTTTCAAGACTTCATTCAAAGCGTTTGTGACTATTGGGAGAA ACATCGCTCAGAGCTGTTGCTAGGAAACATGGAAACTTTTGATGAGGTCA TCAACAATCATTTAGATGGAACGCATACGTTATCAACTTTAAATACAAGG TTTGATTGAAGGTGTTTTTTCCTTGTATATAATATCCCAGAATCCTTTAT CGGTAAAAAAAGGTTGGTCGGGTAAAAATTGAGTTGAAGTAAAGTTCGGT CACATTAGGACATTTAAGACCAAATGAGGTGACGAGCTCTTGATAGCACT TCTAAGGTCTATCTGTTATAGTTAGTAATAGTATGCTTCTTATAAGCCTT AAAAAATGAGCTGTCACCCGTTATTCTGATGTTGGCCGCCCACGCTAAAG CTCTGAAGAAGCGGGTTGAAGACGATTGATACTCCCAGTCGGGTTCAACT GCCTTTGGGCCTCAAAATATTTCGGGTAAACGCGCCAATTTCCGAAAACG TGCAGGCCTCCCGCTGATAAACCTGTGATACGGATAGGCGAAATTCCGTA ATCAAAGCCTTCCATATGTTGAAAATTATACCGACAAATTATTCACAGAG CTTTAGTGTTTCGGAGGAAATCTCTACATCAGTTGTTAGATACATAGAGC TATAACTCTATAACTATAACTCGCAGTGTCAATTCAAGACAGACTTAAGT CCATTTTTTCGAAAATTGACTTAAAATCATAACCCCCTATTTCAGCATGC ACGCTTTCCAAAAATGGCCTTAAGTCCACATAATTCTAATGGGAAAGAGG TGTATTTTGCAATTCAAAAAAAAAATAAGAATTTAGAATGTTCCATAATA TATCAACCATAAACAGCCTTAAGTCCTAAATTTTTGTGCAAATTTTATTT TCTATGAAGCATTGACATTAAATGAGTAGCCTTAAGTCCAACACATCTCA ACCTTTAAAGTCAATTATCTCAAAATGAAAAAAATGGACTTAAGGCTATC ATGAATTGACACGGCGAACTATAATTCCCCGTGCGTATCCGAGTTACGTA TAGAGAATCAGTCTTTGATATGTATTTGATTTACTTAACTCTTAATGAAG ACTACTTGTCTTATTTTAGATGCGTGAATGGTAGTTCATTGTTACATGTT GCTTGCTACTTTGGTAATGTTGAATTGATTAAGGTACTGTCTACATTTTG TTTTTTATCGATACCAAAAAGTGTATAGAATTTAAAGAGTTCAGTATCTT TACAGACTTTATTTTTAAAACTTTGCAAAGTTTAACTCATATATGTAGAT TGTGTATTTTTTAATAAATCTTTTCGAAGGTCAGGTTCACATCCAATTCA CTTTTTAGAGATTATTATCCGCCAAAATTGATATTGATGTTCGAGATACA AAACAAGCGACCGTTCTCCACCGCACAAGAACGCCGGAGGTTATTGATGT GAGTTCTAATTTTCATTTTTTTGCATTTCCACTTTCAAGTGACCAAGAGT TTTCTTCGGATTATAGAGACCGTTTTACACTACTTTTTATAATGACTATG GTGCTACGCTGTTCTACCATCTTATAAGTCCTAGAGATTTTATTTATAAT ACAAACGCCCCTGCTACCGCCTACCTTAAAGAAGCAAGCTGCAGATCATT CTTGTTCTTCTTGTTGCAATATAAATTGCTTGATATTATGAATTTCATGG AAATCTATGAAAGAGGTGTAAAATGTGTTTATATTTACGAGACACGAAAT ACAGTAGACTCTCTCTAATTCTAATTCAAAATTTTCAAGTGACCAAGAAT TTTTCTCGAATTCCAGAAATTTTATACTAATTTCTAGCTGAGGGGACCAA TGGTTTAGTTCGAATTAAAGAAAGATTCGAATAACAGAAGTTCGAATTCG GGAGAGTCTACTGTATTTGGTATTTGACCAGCCATCCTATTTTATCCAAG CCTTTGATGGCAATTTCGAAAAAAGAGCCTTGTGAACTACTAACAAACAG ATCATTAGTAAACTTAATATTGCCTTCGTCATTAAATAGCGAGATTATGT ATCTGGAATTCCTTGCGGCTACGGTTAAAATGGCGAGGGAAATGGCGGAT GAAAGCAAGTTCGATATTTGACGTACGGCATTATGTCGACTTTGCTTATA CAGTGTTTTGCTGTTTTTCCTGTACAGAGAAAAGTAGACAACGAAATGTT GCCTTTGGTGACGACCCGCAGGACAGCCCCGCAACCGTAGCCGTAGAATA TCTCCGGTATAATTATAATCTCTCTAATGTTGTCGGTTATGTCGTTTATG ACGTTAGAGTTGATAAGTTAGGTATCTGTATGTAGAGCCGTACCATTAAG AGGGGAGGGTTTAATGGGGTGCCCGATTCCTCCATTCCTTCAATATTTTA CTTGAATTTCGTCAAACCGTCTTTTGTTTTAAAAAGAGTTTTCTAGGAGA ATTTTCTTTATTTTTGTTTTATTTTTTCTTAGCTTCTTTGTCAACATGAC ATTAATGTGAATGCGGTAGATAACGAAGGAAACACTGCATTGCACGCACG TTGCTATGGTGAACATGGAAAACCTACTGACACTGAGTGCATCAAACAAT TGGTATGATTCACAGATATTCTTTTAAACACTAGATAGGCTATATTGCTT ACAGGCTTCCCGTGGAAGTTTGTCCATTTTTGAGGTCGACTAGTCCGCCA AGTTATTTTCCAATTTACCCTAAATTTTTGAACGTTCGAATTTCAAAACA TTCGAATCGCACTGTCGACGATCATAATTGAAAACAAGATAGTGGACTAG TCAGTCCTAAACCTAGGCACGTTTCCTATTATATACGGGTAGCAGGCACG ACGGAAGCTTTTTATATCTGGTACGGCGAATGAGGAAATTTAAGCGATTT TATAGCGATTTGACCGACGAAGAGGAAAACTTCGGGTATTTTTGTGAAAA TCTGGTACGGCGGCCGCCGTACCTGCCGTACCCGTTGCGTCGTGCCTGGG TAGCCCGATGCAGTCAAGTATTCAGAGATCAGTTTTAAGAACATCTAAAA GGGTTGGGTTCGAATTTACATGGATCATTTGCTGTTGACGATATAAAACA ATTACTTCTTGTTTCTACCAGACCGAAAGGGAATTAAAAAAAACTGTGTC TAAGAGGCAATAGCCTCGCTACAATTAACGTAAGATAAACGCCTTTGTAC AGAGTACACAAAATCTGGACAATCCTTTACTCGGGTGTTCGCACCCAGTT GTCTAACCGAGTTACGGTAATAATATGGTGGTTACTGTATCTAAAAGCTC TAAATGTTGAGCTATAAACTGTAAACTTTTGCTTTTTGATTTCCATATAA GCGTATTACCTGTTTAATTCGTCATCTCTTTTTCATTATTCCTTCAGATA GCTAGAGGATGTGATTTATATAAAAGAAACAAAAAGGTACATCATTATCT TCGTCTTCATCATCAACATTCTAAGAGCTATTTCACTAAAGTCTATCTCA AAAGTAAGTGGACACTTTAGTTTTTTGACATTTTTTCAGCGCCCATTCAT GCTATATGTTAGAAAGTTATACACCGTTATAATGCCCTTTGAAGTAGGCC TAAAACGTCCAAAAATGACCAAAAATAGCAAATGATCAAGTTCATAATGC TGTAACTTTTTATCTTAGAAAGATACAAAAAATCTGTATAGAGATTTGAA GTCAGCAAGGTTTAAATTTTCTAAATAGCCTGATGCCATGATTTTTAAAG AAAAAATCTTCTTTTTTTTCATCTTCATATTTCAATCTTTCAAAAACTGT TTATCCTTTATATTAAACATTCTCCTTGAAAATACCTTTCCAACTGAGTA AACTTTCTAACATAACATGAATGGGAACTGAGAAAATAATGTCAAAAAAC TAAGGTGTCCACATACTTTTGAGACTCTGGGAACTTTATCATCAGAGCGT GTCATAGGCTATTAAATGGATTAATTTCCACAAATTTAGAATCTAAAATT TTCTTGTGGACTAAATTTTGCAACTCGGCCTTCTTTTGACCCATTTCTTT CATTTTTCTAAGGGTTTTGGTTAACATTCCGGACTTTAATTCTTTTTCGA TAACAAAACTGCGATTCCTACTTCTTCAGGAGTGGGACCTATCCCAAATG CATTCGGCGGGCTCATAGCTACATACCTATCTAATTTCTTTCCCGTGTTT TATCGTTAGAAATTAACGGCAATTCATTGTGCAGCGATTCAGGGACGCAG TGACGGTATTTTGGTTATCATGGAGAATGATCGACAAAACACATTCAAGG ATATACTCGATAAAGAAACGGGGGTACAGTTTTAAACAACTTTAATTTGT TTTGTCTTGAAAAATACGGAAAATATTTCAGAGAAATTACACAGCACACA CAATCTCAGACCGAACTAAGGGAACTTTTTCTGGTGAGAACTAATTTAGG GGAATTCGACGAAATTTTTAACTAAATTTACCAAAAGTAGCTCTCGTGAA AATTTAAGGATTGATTCCTCGCAAAAATTGTGTTTCTATGAAAAATAACC CCTGATTTGAGCCCTGCACTTGCCCAAATTAGTTCTCGCCCTACTTATTT CTATTAAGGTATATATCATCCTATATCCATGGTGAAAATCCAAACGATAC TTTTACGTGGATAGTTTCATTTATCCAAAATGATTTCATTGTATTTTGAA TCGCCTCCCTCTACTCCAACCAGTCAAGCTACTACAAGTCTTTCGTGCCT TTCCGATAAATCCAAAGTACACCCCTCGGTATCACAGGCCCGTTTGGACC CCTGATGCCCCACTGGAAAATTAGGCCTAAATTTCGTCACCGATGGGAAA AGTATACAACCATTTCAGCCCCACTGGGACCTTATGCTTTGAAAAAAGCC CTATTGAATTCTTTTTTAATTTTTGAACTGGGAACAATAGAAATTCCATC CCCATTTGAATTTTGATAGAAATTTTCATCCCAATTGTGGGAAAAAGTTC CACCGAGGCTGTGAGACAGGGGTGTTCTTATAAAAAAACGTCAAAGTTAA AAACGCCGCGTTTGTAGTAATAGATCTTATTGGAGTTTTTGATTTTTCTA AAAAAGCGATGCATTGTGGGATTGTTTTTTTGGGAGTATTACAATAGAAA TCTCTTAGGAATTCTATTGTAATACTCCCGAAACAATTGTGATTAAGACC ACGTGACTACCCATGTACTGTATATTACATTGTATTTTTGCATAATACAT GTATTTTTATTTCATTAGAGCATTCCACCAAGTCTTGTGTATTTAGCTAT TGCAAACAATTTTCTGTTATGTGCACAATGGTAAAAGTTAATTGCACTTC TTCCCTTCCTTATTCCACTTTTCTGCACTTTTTTATTCATATCAAGATGA TTTGAAATTGCACAGTCTTGAGAATTTTTCTTTTACTGTCCATTTGCTGC TGTCACTTTAAGTTCAGTCACTCGTAGAGTGACGTGGAGTTTGATTTAAA TATCTAATTTTTGTTGGAACAGTAGAGTCTCCATAACTCGAACCTCTCTT GCCCGAATGCCTCCTTAACTCGAACAAGTTTTCTGGTCCATTTATATAAT AACGCTTTATAAACCATACTCTTTAACTCGAACGAATTTGCGTTCTCCGT GCACTTTTGAGTTATGGAGAATTTACTGTACTGAACAAGTTTGAGTTTAT CTACCCAGTGATATTCATATTGGAAATTTATCGTGGCTTAGATCACAAGA TTTACGTTTGGCTGCGTTTCTATGGTAACATGGGGGGGGGGATTCACACC TTGTAAGGAAATTACACTTGACAGAAGGTCTTAGTACTAATAGTGGAGAA AACATTCTCCATTTTGCACGATAATGGGAGAAGAATCTCTCGAAACGTAG CCAAACGTAAATCTCGTCATCCAAGCAACGATAAACTTCCAATATGACTT TACTGTACCTTGATCTTCCTGATTTTTATATCTTACTTTCTTACGCTTCA GGTTGATAGAAAGAGGATTCCGTTTTAAAGAATTGGAAATCGAAAGATTT TTGGAGAAGATTCTCATGGAACAGCAAACATGGTATATTGAATTTGATTT TTTTTTATCGTCGTTCGTTCCCTGATTCTGCTACTTACAATCAACCTCGA ACCCAGTCTCTTAGTTGGCTTCTTTTATTTTGTTTAAATGTAGCCTACAC TAGACGTCAACGCGTTTTATCTAGGCAAGTAACAGCTATTCCACTTTGTG ACTTTTTTGAATGTTTGGAGCCCAGGTTTTCGAGCTCCAAATATTCGATT TTTTGACGTCACTTTTAATTTTCCAAGCTCCTGCAGTAGCGAAAAAATTG AATTTGCGTCAAAGCACTTGAAAGGCTAATTTTCGAAATTCATCAAAGTC GAACTCACTAAGAAACAGAATGAAAAATCCCGGTTTTTGGTGATGAGGTG TTTAACGGGCGCTCGTTCAGAAAGTGGTGCAAGTGTCCATAGGTGCGAGA TTACCTCTGTACTAACTTGGTCACCAAGAGAAACAAGGAAAAACCCCTAA GGCGAAAGCGTACAGGAATTTGCTCCGGGAGTTTTATGCATCTGCTAGGC CTAGTTGAGGCCGCAAACACACTGAAATGGAAAATTCAATTCGTAATAAC AATTTTCAGTAATTTATTTGGAAATTTGGACCCCTTGAAGACAACATGGT ATAGTAAGAAAAGGTTGATATTTTATGAGGATAGTAAAGTAGGGCTAGGG CTTTTAGGTAATCTAATCGAAGGAGCGGGAATTCGAACCACGAACCCCTG GTTGAAACACAATGAGTGCTTTTTTCGCTCTTATCAGAATATACTTCTAA CTGGTGACAGTAACAAATTACATTACATACATTTTTAGTGACCAACCATC AAATACAGTGAAGTTCTTGTTGGAAAATCACCACAATCCGAAATTCATCC TCTTTTCTGGCATGAATACGTAAGAAGATTCGAACTGTAAATTCTTCAAT TAAAGTTTTGAACGTTTTTTTATAAGAGAACATCCCAAATTGAATCTTTC GAATATTCTAGACTTTTTGAGAGTTCCCAGGTGATCCCCCATCCGAGTAC TATCCCGGCCCGACGATGCTTAACTTCCGTGATCTGACTGAGTTTTAAGC CTAGAAATGTTCTTAAAATGTTTTTATTTTCGCCATCTTGTTTGTGTTTT TGTGCGATTTCTTATGAAATTGGGAGTTTTAGAGTCCGTGAAGCCTTTAA AATGTTCTAAACTTGTTCTTAATATAAAGCCATCGAAGCCTCGTGTTCTG ATATAGTTGGCTCTTATAAAAAAACGTGTACTGTATGTTGAAATAAGAGT GACATCGTTTGCTTACTCGTCTATTTTAATCTACAAGTTTTTTTTCATTG AATTGACACAGATGTGGAGCATGATTGGTCAGAAAGAGGAAAAGAAAAAC AATTTTTTTGCTCATTCAGCACGAATTGAACACAATATAACAATAGGGAG ACACGTTCCTTATATAAGATATGTGTCTAATATGAAACGGGAACACGAAC ACTAAAACCTTTATAATCATACTCACCTTATCCTAGCATTGTTCACCTAT GTGCAAGTCGAAGAGATTTCTGTGATGTCATCGAATATTTGACCAGTCAG CAGTTTGATATCAATGTACTAAATGAGAATGCATTCACTCCGTTGCATTT TGCTGTCAACTCAAATAACATGAAGGCTGCAGCAGTACTCATCGAAAAGG GTAAGGGAATTTTTATTTCATCAACTTTCTTGTACTGCTAATAGGCACAA CGCAGCTTGTGGAGCCGGTGATGTACCAGATATCTTAAAATACCCCTCTA ATTCCTCTCACAATTCCTGTACAATATTTCATCATTCGCCATACTAGATT TGGATCCCGGGATGAACTGGAGTTTTTAGACTTACCTCGGTGGAGGTCCT ATAAATTAACCTTCGTCCGTTCGTTCGTTCGTTATTAGCTTTCCTCATGA TTGGCTCATTAGTTTTTCTGATTTTTTGCACAAAGATGCATAACTATGAC CCCTCGAATGTGCCGATTTTCGAAAAAAAAAAATTTTGGGCAAATTTAGG CGCCAAAAAACGGCTAAAAAACAGGTTTTTTAGACTTTGTGAAAAATTGG ATCATTAATTTTTTCTGATTTTTTGCATGAAAGTAGGGTACCATCATAGG TAAAAGATGGCTCAAGCAGATTTTTGAAAAAAAATTTTATTGACTCAAAA ATGCATGTTTATCTATAAGACTCAGTATTAAATAAGCATAGATCAATGTT CTTAGTCAAATTACTCAATTTTTTTGCTCATGAGGGCTTACTGTTAAAGA ATATGTGTGTTTAGACATGAAATTTTGGTTGCTTGGCGTGTTTTTAAAGA AAAACTGGCCAAANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNATTCAATTACTTAGGTATTAGCTTTTCTCGAGATTGGCTCTTT CATTCTTTATGATTTTTTGCACAAAGATGCATAACTATAAACCCTCGAAT ACGACGGAGCTCTATTTTTGGGAAAAAAATTTTGGGGTAAATTTCAGCTA AAAAACGGCTAAAAAAGGGTTATTTGAATGTTGTGAAATATTGGATCAAT GTTTTCTTCTAACTTTTTGCATGAAAGTAGGTAAAAGATGGCTCAAGCAG ATTTTTGTAAAAAAAGAATTTTTCAGCTCAAAAAACGCATCTTTGTCTAC AATCATGGTTGAAATATAATGAGAATTCCGGTTATTTTAATGCTTTTCAA GATTTAAAGTTCCAGCGAGAAAGTCGATTTTGGGCTATCCCTTTACCTTA ATCGAATATTTCAATTTGGGAGGGGTTGGCAGATTTCCAGGCTATATTCT GAGCCTTATTGGACTATTTTTGAACTTTTGGATCCTCAGATCATAAGGTA GTAAGTCTAGCGTTAAAACTCAGAGTTAAAACTCTACCTTTCGAACCTAC TTTAGAGCACTTACAAATCGATTGTGGTTTCAAAACTTACCGGTGGATTT CCCTTTTTTCTCACATATTACGGACCTTGATTGTATAAGAATCACTATTA ATAAGCATACATCAATGTTCTTAAAATTACTGAATTTTTTTGATGAGATT TGTTTTTTTGCTCACGAAGTCTTGAGTATGAAAGAATATTTCAAGAGCAT GAAATTTTGGTTTCTAAATGTTTTTTTATAAGAAACAAACGACTAATTTT AATAGATCGTGNNNNNNNNNNNNNNNNNNNNNNNNNNNTGTTCTGAATGA TTGTTTAATGGTCACGCTCACGTAGATATCAATTATATATGTGTTAAATG CATAACCAGGTAGGTCCATAAAAGTATCACTTGTTATCAGATGCTTCACT AATTGGTCATTGAAGTATAATAGAGGTGATGCGTTGTTTAGAAAAAGTAA CAAAATTGTTTTATTACAGGTTAACGACCAACCAAATCAAATAAGTGCTT GTAAAAATTCCACTTTATCCCAGATTTGGAAAGCTTCAGGGATCATTTAT AGATCGATTCCAAAGCTGCAATTTCGGGAGTTTGCTATGGACTATTACTA AAATCAACAGTGACTCACGTGATCAAACAAATGACATAAGTTGAAACCTG AGTTGCTTAGGATGACAAAGGATTGTTTTTTTTTCTACCAACCAATTCAA AGGCTACTACAAAATACGATAGAGAGAAATTTCCTGATCACCAAATTTTG GGCAAATGTTGAACTGATTTGTCCATCTTTTTGTCCATCTTTTTGTCATC TTTTTGTCTGCTTGGAACCTTTAGGTGGTGACCTGATGTTGAAAGACAAC AATGGAAATACACCTTTCGATTTAGTGAAGAATTTTGAACATTGGATTGC ATACCCGTTGTTCGATGAAACTACCAAAGAACTTCTCAGAGGTTAGTCTG AATTGCATACCTTTAAAGATAGATCAAATTCCTCTATAAGAAACCTTTTT GTTAGAGAATGAGCAGAATCCTATACTCAGAGATGACTCTAGCAGAAAAG GTTTTTTTAATTCTATTCGGGATTTCTCAACTTTAGTTGAGCTAGAATCT GAGAATNTCTAAAACAAGCAAAAAAATTCCATAATTATATTTGACTATCA AAAGTTACAGGCATTCTTGTTTCCACTGCCAATTATATCTGGACAGACTT TAATTGGTCATTGAAGTATAATAGTGATGCGTTGTTTAGAAAAAGTAACA AAATTGTTTTATTACAGGTTAACGACCAACCAAATCAAATAAGTGCTTGT AAAAACTCCAATTTATCCCAGATTTGGAAAGCTTCGGGGATCATTTATAG ATCGATTCCAAAGCTGCAATTTCGGGAGTTTGCTATGGACTATTACTAAA ATCAACAGTGACTCACGTGATCAAACAAATGACATGAGTTGAAACCTGAG TTGCTTAGGATGACAAAGGATTGTTGTTTTTTTTACCAACCAATTCAAAG GCAACTACAAAATACGATAGAGAGAAATTTCCCGATCACCAAATTTTGGG CAAATGTTGAACTAATTTGTCCATCTTTTTGTCCATCTTTTTGTCATCTT TTTGTCTGCTTGGAACCTTTAGGTGGTGACCTGATGTTGAAAGACAACAA TGGAAATACACCTTTCGATTTAGTGAAGAATTTTGAACATTGGATTGCAT ACCCGTTGTTCGATGAAACTACCAAAGAACTTCTCAGAGGTTAGTCTGAA TTGCATACCTTTAAAGATAGATCAAATTCCTCTATAAGAAACCTTTTTGT TAGAGAATGAGCAGAATCCTATACTCAGAGATGACTCTAGCAGAAAAGGT TTTTTTAATTCTATTCGGGATTTCTCAACTTTAGTTGAGCTAGAATCTGA GAATGCCTGTGTGTGTATCTGTGTGTCGGTCTGTCATCCCAAAACTTTGG GGCAGGCTGAAGACTTCAAAAATGTTCGGATTCGGCTGAGATTTTGCACA TTTGTTTCTTGGGTGAATACCTAGGACTGTTCTTTTCATTTATTCAAAAT TTTGATTTTCAGGGGCTTGGTCACGAGTTTTATCCTCAAACGAGGCTAAA AACTTTGTGGCACGCTGGAGACTCAAAATTTGTTTTATTCGGCTGAAATT TTTCACACTTATTCCTTGGGTGAATATCTGTTTTTTTTTTCTTTTTTTCA AATATTTTGATTTTTATTGGCGGGATTACGACTTTTGCGCCAAAACGAGG CTAAAGCTTTTCTTTTATCAAAATTGTTTACAATTTTTACAATTGGGCCT ACGAGTAATTTAAAAGATACTGAAGTTGAGCCAGTGCGGTTAGCACGTTC GACAGTAACAGAAAAGGTTTTATAAAAAACCCTGGTCTGGCAATTTTGGC AGTTTTAGCTTTTTGTTCAATTTTTTTTACAAACAAAAGACAAGTTGTAT ACTTTTTGATCACGTTACCAAAATCTCCTCTTGGGATTGGTCTATTTTCT AATCACATGACCAAAAACTAATTTCTAACTATTGTGATACAGTCAACTCT CTCTCTAACTTAGAATTTTTATTATTAAGATCTCTCTGTAACTCAAACTA AAATATGAGAAGGTTGAATTAGTTTTTTCCGATGTTTTCTAACTGAAACT TTCTTCATTAAGCGAAAATATTTGAAATTTATTTCATTGTAAAGTTTTTT GTTAAACATTTTAGGACACAGTATCAAACAAGCACGTGACCTTGTTCGCT CCATTACACAGAAAATCGATCGAACGGAAAGTCTTGGTACCCCGAGAAAT CGGTTATTGGACGTTGATAAACCATTGAGTGGACTCTCGTTGACCAATGA AAGAATAAGACGTGTTAAATTTACATAATTTGATTGGCTGAAGGAACAAA TGTGTTGAATTCACTGACCTTTATACATCCCTGGACCAAGTTATATCCGC CATCTTTGATCGAAGTTTCTTTGAAAGTTGGTACCCACAAAGAAGTCATT GTAGTGTTTGAAACTTTGCCTATCGACAAACGGTGCTACATCATTATTGT ACAAGCGAAACTAGATATAGCGCCCTCTCCGCGGGTACCAATTTCAAAAA AACTCCGATTATAATATTTTTCTTGGCCGGCATTGAGTAACTTGGTCCAG GGATATATAAAGGTCAGTGTTGAATTAGCTTATCGAAGGCGATACCTTTT TAGATTTATGGGATCTCATTGGATGAAAAACACAACTTTGATAATGACGT AACACATGTTGAACTGGCATAAGCCAGTATATTCTATCCTTGTATATTCT GGACTCAAGTTTCTACAAGTTTCTCCGATATGTAATTGGTCCAGCTACCA TCGTTTTATTGACAATATCTTTGAAAATTGTGTAGATATNATATGTAATT AGTCCAGCTACCATCGTTTTATTGACAATATCTTTGAAAATTGTGTAGAT ATGTAAACATATGTTAACTAACGCGCGAGAAAGTAATATAAAAGCAGGTT GGATCTTTTGTACTCAGTATCAAACTCTTCTTCACTGAAAAGATAACGCA AATTTGATCTTGTTACGGTTAAAAATCTAACCGAAACGAACAGTGGGTAC ACGGTAGTAAGATTTTTCACGAAATATAAAGAAATCGACAATAGTAGCTT TGGGGAGCTAAACTTTTTGATCTCGAAATCATCAAGCAATTACTTTCAAA CTCCATCTCAACTCATATTTGCGTTTCGAGTTACCTTAATGTATAAT
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_001217XLOC_001217Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00002294-exon-sc0000019-1575043694:215637..215663TCONS_00002294-exon-sc0000019-1575043694:215637..215663Clytia hemisphaericaexon
TCONS_00002294-exon-sc0000019-1575043694:209975..210118TCONS_00002294-exon-sc0000019-1575043694:209975..210118Clytia hemisphaericaexon
TCONS_00002294-exon-sc0000019-1575043694:209504..209546TCONS_00002294-exon-sc0000019-1575043694:209504..209546Clytia hemisphaericaexon
TCONS_00002294-exon-sc0000019-1575043694:209103..209162TCONS_00002294-exon-sc0000019-1575043694:209103..209162Clytia hemisphaericaexon
TCONS_00002294-exon-sc0000019-1575043694:208804..208867TCONS_00002294-exon-sc0000019-1575043694:208804..208867Clytia hemisphaericaexon
TCONS_00002294-exon-sc0000019-1575043694:208584..208694TCONS_00002294-exon-sc0000019-1575043694:208584..208694Clytia hemisphaericaexon
TCONS_00002294-exon-sc0000019-1575043694:208292..208378TCONS_00002294-exon-sc0000019-1575043694:208292..208378Clytia hemisphaericaexon
TCONS_00002294-exon-sc0000019-1575043694:207966..207994TCONS_00002294-exon-sc0000019-1575043694:207966..207994Clytia hemisphaericaexon
TCONS_00002294-exon-sc0000019-1575043694:207554..207641TCONS_00002294-exon-sc0000019-1575043694:207554..207641Clytia hemisphaericaexon
TCONS_00002294-exon-sc0000019-1575043694:206865..206900TCONS_00002294-exon-sc0000019-1575043694:206865..206900Clytia hemisphaericaexon
TCONS_00002294-exon-sc0000019-1575043694:206595..206620TCONS_00002294-exon-sc0000019-1575043694:206595..206620Clytia hemisphaericaexon
TCONS_00002294-exon-sc0000019-1575043694:205793..205861TCONS_00002294-exon-sc0000019-1575043694:205793..205861Clytia hemisphaericaexon
TCONS_00002294-exon-sc0000019-1575043694:204551..204632TCONS_00002294-exon-sc0000019-1575043694:204551..204632Clytia hemisphaericaexon
TCONS_00002294-exon-sc0000019-1575043694:203840..203929TCONS_00002294-exon-sc0000019-1575043694:203840..203929Clytia hemisphaericaexon
TCONS_00002294-exon-sc0000019-1575043694:202725..202810TCONS_00002294-exon-sc0000019-1575043694:202725..202810Clytia hemisphaericaexon
TCONS_00002294-exon-sc0000019-1575043694:202184..202224TCONS_00002294-exon-sc0000019-1575043694:202184..202224Clytia hemisphaericaexon
TCONS_00002294-exon-sc0000019-1575043694:201020..201099TCONS_00002294-exon-sc0000019-1575043694:201020..201099Clytia hemisphaericaexon
TCONS_00002294-exon-sc0000019-1575043694:178965..179023TCONS_00002294-exon-sc0000019-1575043694:178965..179023Clytia hemisphaericaexon
TCONS_00002294-exon-sc0000019-1575043694:178141..178186TCONS_00002294-exon-sc0000019-1575043694:178141..178186Clytia hemisphaericaexon
TCONS_00002294-exon-sc0000019-1575043694:177381..177504TCONS_00002294-exon-sc0000019-1575043694:177381..177504Clytia hemisphaericaexon
TCONS_00002294-exon-sc0000019-1575043694:176337..176413TCONS_00002294-exon-sc0000019-1575043694:176337..176413Clytia hemisphaericaexon
TCONS_00002294-exon-sc0000019-1575043694:175734..175783TCONS_00002294-exon-sc0000019-1575043694:175734..175783Clytia hemisphaericaexon
TCONS_00002294-exon-sc0000019-1575043694:175338..175434TCONS_00002294-exon-sc0000019-1575043694:175338..175434Clytia hemisphaericaexon
TCONS_00002294-exon-sc0000019-1575043694:174768..174974TCONS_00002294-exon-sc0000019-1575043694:174768..174974Clytia hemisphaericaexon
TCONS_00002294-exon-sc0000019-1575043694:173065..173285TCONS_00002294-exon-sc0000019-1575043694:173065..173285Clytia hemisphaericaexon
TCONS_00002294-exon-sc0000019-1575043694:172031..172094TCONS_00002294-exon-sc0000019-1575043694:172031..172094Clytia hemisphaericaexon
TCONS_00002294-exon-sc0000019-1575043694:171766..171855TCONS_00002294-exon-sc0000019-1575043694:171766..171855Clytia hemisphaericaexon
TCONS_00002294-exon-sc0000019-1575043694:170612..170731TCONS_00002294-exon-sc0000019-1575043694:170612..170731Clytia hemisphaericaexon
TCONS_00002294-exon-sc0000019-1575043694:169778..169816TCONS_00002294-exon-sc0000019-1575043694:169778..169816Clytia hemisphaericaexon
TCONS_00002294-exon-sc0000019-1575043694:168891..169004TCONS_00002294-exon-sc0000019-1575043694:168891..169004Clytia hemisphaericaexon
TCONS_00002294-exon-sc0000019-1575043694:167884..167945TCONS_00002294-exon-sc0000019-1575043694:167884..167945Clytia hemisphaericaexon
TCONS_00002294-exon-sc0000019-1575043694:167132..167212TCONS_00002294-exon-sc0000019-1575043694:167132..167212Clytia hemisphaericaexon
TCONS_00002294-exon-sc0000019-1575043694:166245..166325TCONS_00002294-exon-sc0000019-1575043694:166245..166325Clytia hemisphaericaexon
TCONS_00002294-exon-sc0000019-1575043694:165464..165627TCONS_00002294-exon-sc0000019-1575043694:165464..165627Clytia hemisphaericaexon
TCONS_00002294-exon-sc0000019-1575043694:161925..162041TCONS_00002294-exon-sc0000019-1575043694:161925..162041Clytia hemisphaericaexon
TCONS_00002294-exon-sc0000019-1575043694:159917..160949TCONS_00002294-exon-sc0000019-1575043694:159917..160949Clytia hemisphaericaexon
TCONS_00002294-exon-sc0000019-1510915933:215637..215663TCONS_00002294-exon-sc0000019-1510915933:215637..215663Clytia hemisphaericaexon
TCONS_00002294-exon-sc0000019-1510915933:209975..210118TCONS_00002294-exon-sc0000019-1510915933:209975..210118Clytia hemisphaericaexon
TCONS_00002294-exon-sc0000019-1510915933:209504..209546TCONS_00002294-exon-sc0000019-1510915933:209504..209546Clytia hemisphaericaexon
TCONS_00002294-exon-sc0000019-1510915933:209103..209162TCONS_00002294-exon-sc0000019-1510915933:209103..209162Clytia hemisphaericaexon
TCONS_00002294-exon-sc0000019-1510915933:208804..208867TCONS_00002294-exon-sc0000019-1510915933:208804..208867Clytia hemisphaericaexon
TCONS_00002294-exon-sc0000019-1510915933:208584..208694TCONS_00002294-exon-sc0000019-1510915933:208584..208694Clytia hemisphaericaexon
TCONS_00002294-exon-sc0000019-1510915933:208292..208378TCONS_00002294-exon-sc0000019-1510915933:208292..208378Clytia hemisphaericaexon
TCONS_00002294-exon-sc0000019-1510915933:207966..207994TCONS_00002294-exon-sc0000019-1510915933:207966..207994Clytia hemisphaericaexon
TCONS_00002294-exon-sc0000019-1510915933:207554..207641TCONS_00002294-exon-sc0000019-1510915933:207554..207641Clytia hemisphaericaexon
TCONS_00002294-exon-sc0000019-1510915933:206865..206900TCONS_00002294-exon-sc0000019-1510915933:206865..206900Clytia hemisphaericaexon
TCONS_00002294-exon-sc0000019-1510915933:206595..206620TCONS_00002294-exon-sc0000019-1510915933:206595..206620Clytia hemisphaericaexon
TCONS_00002294-exon-sc0000019-1510915933:205793..205861TCONS_00002294-exon-sc0000019-1510915933:205793..205861Clytia hemisphaericaexon
TCONS_00002294-exon-sc0000019-1510915933:204551..204632TCONS_00002294-exon-sc0000019-1510915933:204551..204632Clytia hemisphaericaexon
TCONS_00002294-exon-sc0000019-1510915933:203840..203929TCONS_00002294-exon-sc0000019-1510915933:203840..203929Clytia hemisphaericaexon
TCONS_00002294-exon-sc0000019-1510915933:202725..202810TCONS_00002294-exon-sc0000019-1510915933:202725..202810Clytia hemisphaericaexon
TCONS_00002294-exon-sc0000019-1510915933:202184..202224TCONS_00002294-exon-sc0000019-1510915933:202184..202224Clytia hemisphaericaexon
TCONS_00002294-exon-sc0000019-1510915933:201020..201099TCONS_00002294-exon-sc0000019-1510915933:201020..201099Clytia hemisphaericaexon
TCONS_00002294-exon-sc0000019-1510915933:178965..179023TCONS_00002294-exon-sc0000019-1510915933:178965..179023Clytia hemisphaericaexon
TCONS_00002294-exon-sc0000019-1510915933:178141..178186TCONS_00002294-exon-sc0000019-1510915933:178141..178186Clytia hemisphaericaexon
TCONS_00002294-exon-sc0000019-1510915933:177381..177504TCONS_00002294-exon-sc0000019-1510915933:177381..177504Clytia hemisphaericaexon
TCONS_00002294-exon-sc0000019-1510915933:176337..176413TCONS_00002294-exon-sc0000019-1510915933:176337..176413Clytia hemisphaericaexon
TCONS_00002294-exon-sc0000019-1510915933:175734..175783TCONS_00002294-exon-sc0000019-1510915933:175734..175783Clytia hemisphaericaexon
TCONS_00002294-exon-sc0000019-1510915933:175338..175434TCONS_00002294-exon-sc0000019-1510915933:175338..175434Clytia hemisphaericaexon
TCONS_00002294-exon-sc0000019-1510915933:174768..174974TCONS_00002294-exon-sc0000019-1510915933:174768..174974Clytia hemisphaericaexon
TCONS_00002294-exon-sc0000019-1510915933:173065..173285TCONS_00002294-exon-sc0000019-1510915933:173065..173285Clytia hemisphaericaexon
TCONS_00002294-exon-sc0000019-1510915933:172031..172094TCONS_00002294-exon-sc0000019-1510915933:172031..172094Clytia hemisphaericaexon
TCONS_00002294-exon-sc0000019-1510915933:171766..171855TCONS_00002294-exon-sc0000019-1510915933:171766..171855Clytia hemisphaericaexon
TCONS_00002294-exon-sc0000019-1510915933:170612..170731TCONS_00002294-exon-sc0000019-1510915933:170612..170731Clytia hemisphaericaexon
TCONS_00002294-exon-sc0000019-1510915933:169778..169816TCONS_00002294-exon-sc0000019-1510915933:169778..169816Clytia hemisphaericaexon
TCONS_00002294-exon-sc0000019-1510915933:168891..169004TCONS_00002294-exon-sc0000019-1510915933:168891..169004Clytia hemisphaericaexon
TCONS_00002294-exon-sc0000019-1510915933:167884..167945TCONS_00002294-exon-sc0000019-1510915933:167884..167945Clytia hemisphaericaexon
TCONS_00002294-exon-sc0000019-1510915933:167132..167212TCONS_00002294-exon-sc0000019-1510915933:167132..167212Clytia hemisphaericaexon
TCONS_00002294-exon-sc0000019-1510915933:166245..166325TCONS_00002294-exon-sc0000019-1510915933:166245..166325Clytia hemisphaericaexon
TCONS_00002294-exon-sc0000019-1510915933:165464..165627TCONS_00002294-exon-sc0000019-1510915933:165464..165627Clytia hemisphaericaexon
TCONS_00002294-exon-sc0000019-1510915933:161925..162041TCONS_00002294-exon-sc0000019-1510915933:161925..162041Clytia hemisphaericaexon
TCONS_00002294-exon-sc0000019-1510915933:159917..160949TCONS_00002294-exon-sc0000019-1510915933:159917..160949Clytia hemisphaericaexon
TCONS_00002294-exon-sc0000019-1491911889:215637..215663TCONS_00002294-exon-sc0000019-1491911889:215637..215663Clytia hemisphaericaexon
TCONS_00002294-exon-sc0000019-1491911889:209975..210118TCONS_00002294-exon-sc0000019-1491911889:209975..210118Clytia hemisphaericaexon
TCONS_00002294-exon-sc0000019-1491911889:209504..209546TCONS_00002294-exon-sc0000019-1491911889:209504..209546Clytia hemisphaericaexon
TCONS_00002294-exon-sc0000019-1491911889:209103..209162TCONS_00002294-exon-sc0000019-1491911889:209103..209162Clytia hemisphaericaexon
TCONS_00002294-exon-sc0000019-1491911889:208804..208867TCONS_00002294-exon-sc0000019-1491911889:208804..208867Clytia hemisphaericaexon
TCONS_00002294-exon-sc0000019-1491911889:208584..208694TCONS_00002294-exon-sc0000019-1491911889:208584..208694Clytia hemisphaericaexon
TCONS_00002294-exon-sc0000019-1491911889:208292..208378TCONS_00002294-exon-sc0000019-1491911889:208292..208378Clytia hemisphaericaexon
TCONS_00002294-exon-sc0000019-1491911889:207966..207994TCONS_00002294-exon-sc0000019-1491911889:207966..207994Clytia hemisphaericaexon
TCONS_00002294-exon-sc0000019-1491911889:207554..207641TCONS_00002294-exon-sc0000019-1491911889:207554..207641Clytia hemisphaericaexon
TCONS_00002294-exon-sc0000019-1491911889:206865..206900TCONS_00002294-exon-sc0000019-1491911889:206865..206900Clytia hemisphaericaexon
TCONS_00002294-exon-sc0000019-1491911889:206595..206620TCONS_00002294-exon-sc0000019-1491911889:206595..206620Clytia hemisphaericaexon
TCONS_00002294-exon-sc0000019-1491911889:205793..205861TCONS_00002294-exon-sc0000019-1491911889:205793..205861Clytia hemisphaericaexon
TCONS_00002294-exon-sc0000019-1491911889:204551..204632TCONS_00002294-exon-sc0000019-1491911889:204551..204632Clytia hemisphaericaexon
TCONS_00002294-exon-sc0000019-1491911889:203840..203929TCONS_00002294-exon-sc0000019-1491911889:203840..203929Clytia hemisphaericaexon
TCONS_00002294-exon-sc0000019-1491911889:202725..202810TCONS_00002294-exon-sc0000019-1491911889:202725..202810Clytia hemisphaericaexon
TCONS_00002294-exon-sc0000019-1491911889:202184..202224TCONS_00002294-exon-sc0000019-1491911889:202184..202224Clytia hemisphaericaexon
TCONS_00002294-exon-sc0000019-1491911889:201020..201099TCONS_00002294-exon-sc0000019-1491911889:201020..201099Clytia hemisphaericaexon
TCONS_00002294-exon-sc0000019-1491911889:178965..179023TCONS_00002294-exon-sc0000019-1491911889:178965..179023Clytia hemisphaericaexon
TCONS_00002294-exon-sc0000019-1491911889:178141..178186TCONS_00002294-exon-sc0000019-1491911889:178141..178186Clytia hemisphaericaexon
TCONS_00002294-exon-sc0000019-1491911889:177381..177504TCONS_00002294-exon-sc0000019-1491911889:177381..177504Clytia hemisphaericaexon
TCONS_00002294-exon-sc0000019-1491911889:176337..176413TCONS_00002294-exon-sc0000019-1491911889:176337..176413Clytia hemisphaericaexon
TCONS_00002294-exon-sc0000019-1491911889:175734..175783TCONS_00002294-exon-sc0000019-1491911889:175734..175783Clytia hemisphaericaexon
TCONS_00002294-exon-sc0000019-1491911889:175338..175434TCONS_00002294-exon-sc0000019-1491911889:175338..175434Clytia hemisphaericaexon
TCONS_00002294-exon-sc0000019-1491911889:174768..174974TCONS_00002294-exon-sc0000019-1491911889:174768..174974Clytia hemisphaericaexon
TCONS_00002294-exon-sc0000019-1491911889:173065..173285TCONS_00002294-exon-sc0000019-1491911889:173065..173285Clytia hemisphaericaexon
TCONS_00002294-exon-sc0000019-1491911889:172031..172094TCONS_00002294-exon-sc0000019-1491911889:172031..172094Clytia hemisphaericaexon
TCONS_00002294-exon-sc0000019-1491911889:171766..171855TCONS_00002294-exon-sc0000019-1491911889:171766..171855Clytia hemisphaericaexon
TCONS_00002294-exon-sc0000019-1491911889:170612..170731TCONS_00002294-exon-sc0000019-1491911889:170612..170731Clytia hemisphaericaexon
TCONS_00002294-exon-sc0000019-1491911889:169778..169816TCONS_00002294-exon-sc0000019-1491911889:169778..169816Clytia hemisphaericaexon
TCONS_00002294-exon-sc0000019-1491911889:168891..169004TCONS_00002294-exon-sc0000019-1491911889:168891..169004Clytia hemisphaericaexon
TCONS_00002294-exon-sc0000019-1491911889:167884..167945TCONS_00002294-exon-sc0000019-1491911889:167884..167945Clytia hemisphaericaexon
TCONS_00002294-exon-sc0000019-1491911889:167132..167212TCONS_00002294-exon-sc0000019-1491911889:167132..167212Clytia hemisphaericaexon
TCONS_00002294-exon-sc0000019-1491911889:166245..166325TCONS_00002294-exon-sc0000019-1491911889:166245..166325Clytia hemisphaericaexon
TCONS_00002294-exon-sc0000019-1491911889:165464..165627TCONS_00002294-exon-sc0000019-1491911889:165464..165627Clytia hemisphaericaexon
TCONS_00002294-exon-sc0000019-1491911889:161925..162041TCONS_00002294-exon-sc0000019-1491911889:161925..162041Clytia hemisphaericaexon
TCONS_00002294-exon-sc0000019-1491911889:159917..160949TCONS_00002294-exon-sc0000019-1491911889:159917..160949Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000019supercontigsc0000019:159917..215663 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0.0164401 2.04704 0.00812335 1.05363 5.79926 2.14659 2.27184 1.92276 0.728402 0.0307692 0.763986 0.796585 0.408348 0.467378 0.248757 0.0121274 0.185948 0.00418622 0.23413 0 0.0151142 0.493383 0 0.324567 5.93429 6.01092 1.0264e-06 0.269951 0.753313 0.0072311
Blast
BLAST of TCONS_00002294 vs. Swiss-Prot (Human)
Match: ANK3 (Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3)

HSP 1 Score: 103.99 bits (258), Expect = 5.013e-22
Identity = 102/430 (23.72%), Postives = 177/430 (41.16%), Query Frame = 3
Query: 1677 TALHVACKYSTFNIVLYLLQQNAPLNVQNRAGYTPLFLAAECGRKEISQLLIEWGADITIKSKSGLNAIQAIRTKNFQDFIQSVCDYWEKHRSELLLGNMETFDEVINNHLDGTHTLSTLNTRCVNGSSLLHVACYFGNVELIKRLLSAKIDIDVRDTKQATVLH---RTRTPEVIDLLCQHDINVNAVDNEGNTALHARCYGEHGKPTDTECIKQLIARGCDLYKRNKKKLTAIHCAAIQGRSDGILVIMENDRQNTFKDILDKETGSIPPSLVYLAIANNFLLCAQWLIERGFRFKELEIERFLEKILMEQQTCDQPSNTVKFLLENHHNPKFILFSGMNTIVHLCASRRDFCDVIEYLTSQQFDINVLNENAFTPLHFAVNSNNMKAAAVLIEKGGDLMLKDNNGNTPFDLVKNFEHW-IAYPLFDE 2954
            T LHVA K    N+V  LL + A ++ + R G TPL   A  G +++ ++L++  A I  K+K+GL+ +      +  + +Q            LLL +    D+V N++L                 + LHVA + G+ ++ K LL  K + + +     T LH   +    +V++LL +H  ++ AV   G T +H   +  H        + QL+  G      N +  TA+H AA  G+++ +  ++++  Q   K   D+                                  L I   L K  + QQ           LL+   +P     SG  T +HL A R    DV  +L      +++  +  FTPLH A     ++ A +L++K         +G TP  +  ++++  +A  L D+
Sbjct:  270 TPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQ------------LLLQHNVPVDDVTNDYL-----------------TALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGH-----VNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQ--------------------------------TPLHISARLGKADIVQQ-----------LLQQGASPNAATTSGY-TPLHLSA-REGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQ 620          

HSP 2 Score: 91.6633 bits (226), Expect = 3.118e-18
Identity = 103/440 (23.41%), Postives = 171/440 (38.86%), Query Frame = 3
Query: 1677 TALHVACKYSTFNIVLYLLQQNAPLNVQNRAGYTPLFLAAECGRKEISQLLIEWGADITIKSKSGLNAIQAIRTKNFQDFIQSVCDYWEKHRSELLLGNMETFDEVINNHLDGTHTLSTLNTRCVNGSSLLHVACYFGNVELIKRLLSAKIDIDVRDTKQATVLH---RTRTPEVIDLLCQHDINVNAVDNEGNTALHARCYGEHGKPTDTECIKQLIARGCDLYKRNKKKLTAIHCAAIQGR------------------SDGIL---VIMENDRQNTFKDILDKETGSIPPSL-------VYLAIANNFLLCAQWLIERGFRFKELEIERFLEKILMEQQTCDQPSNTVKFLLENHHNPKFILFSGMNTIVHLCASRRDFCDVIEYLTSQQFDINVLNENAFTPLHFAVNSNNMKAAAVLIEKGGDLMLKDNNGNTPF 2903
            TALHVA     + +   LL + A  N +   G+TPL +A +  R ++ +LL++ GA I   ++SGL  I                           +G++    +++       H  ++ NT  V G + LH+A   G  E+++ L+     ++ +     T LH   R    +++  L Q   + NA    G T LH      H      +    L+  G  L    KK  T +H AA  G+                    G+    V    D Q     +LD+  G+ P +        +++A   N +  A  L+E G     +  +      L  Q+      + V  LL  + N      SG+ T +HL A + D  +V E L +Q   ++   +  +TPLH   +  N+K    L++    +  K  NG TP 
Sbjct:  369 TALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVA----------------------AFMGHVNIVSQLM-------HHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGH-----EDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQ--GASPHAAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAVTRQGIASVHLAAQEGH---VDMVSLLLGRNANVNLSNKSGL-TPLHLAA-QEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTPL 767          
The following BLAST results are available for this feature:
BLAST of TCONS_00002294 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
ANK35.013e-2223.72Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3[more]
back to top