Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00002259 (transcript) - C. hemisphaerica

Overview
NameTCONS_00002259
Unique NameTCONS_00002259
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1494

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00002259 ID=TCONS_00002259|Name=TCONS_00002259|organism=Clytia hemisphaerica|type=transcript|length=1494bp
gaatattttggtGCGCGCAGCACTTTCGATTTGACTTGGAAGAGGTTGGA
CGCATTTTGACCAAAACAAGTAATTTCAATACCACATCATGGCATTTCGA
TTGATATCACATCACAGGACTATGTTCAGCCCAATGATTACTGCTGCTCG
TAGAATGCTGACAATTGACATCACTTCACCGCaagaatttgatgaaaaag
tcTTGAAATCTGAAGTCCCTGTTATCATAGATTTTCACGCCACATGGTGT
GGTCCTTGCAAGCAGATGGATCCCACTCTGAAAAGTGTCATTCAGAATTA
CGAAGGGAAAATCAACTTGGTCAAAGTTGATGTTGATGAATTACAAGATT
TAGCAATGGAATATGATGTGATGTCTATTCCTTACCTGGTTGGCCTGAAT
AAAGGAAAAATCGTACAAACGGCTGTCGGTGCAAAACCACAAGATCAGAT
CATCCAATTTGTTGATGATGTATTGGCTGCTAGTCAATCTTAATGAGAAC
TAAAGTGATACctaaaagtttgaattttctaACTGGTCCTTTAGCTCTTT
ATTTAGTATGGTGTGGAGTGGAGTGGAGTGGAGTAATAATTACGCACGAC
TTGAAGATTAAAAGAATTTTCACTTGATGAATAAAATGTGAATGGAGGTG
ACACGCGATCGTCGTGAAAACTAAATTAGGACGATAATGGAATGAAGAAA
ATTGTTCGTAATTTCATCTTTGACAGACTGTTTTTTAATatctacatttt
tatgacaatAGTTCAGTCATTTAAGAGCTACTGATAGTATTTTGTATAGT
AAGGAAAGCTTTGAACTTATCCCTTACGGGAAAATCCTAGGAATAAAAAT
GGCTCAGAgttatataaaaaagacttgACATGACTAattaacttttcata
aaaagcGTTTCCTCCGATTTTTGACTACCTGGACCTGACccaattatttt
caaacttatttTACTGATTGATTTACAGTACTTCCTTATGTTTTGTTGTG
TGTTGTAAACATTAACTCGGGCTCCAGAAAGACACTGGAAAACTTGGAAA
TGAATGCTTTCAGGGAAATCTCATAGAAAACTAGGGAGACTCTGAGaatt
tcagttaaaaaaaacagaatagcTTCTATTTTAAGTTCCGGGGACATCAT
TTCTTGAATTTTCTCTTTTCATAGCAAACCATTGTGGCTCCTTGAAGTCC
caaatcattttgatttttctatgaTGTCTAATCATACTGTTTCAAGAATT
TTTCCCATGGTTCATCATCGATCAAGGGTTTCAGTTAGGGAAAAATTGCA
TGATTTCAGTCATTTTTTCTGGGAAATTaagctttttttttcaaagataa
gGAAAAGtctttactcttaggtgccaaataaacgggggggttggaaaatt
ttcgaaattttaataaacgggggggggacctaattgccggggggttggaa
attgtacttctgaaaaccccaaaataaggtaaatataggctaaa
Run BLAST on NCBI

transcript from alignment at sc0000019:586602..593240+

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00002259 ID=TCONS_00002259|Name=TCONS_00002259|organism=Clytia hemisphaerica|type=transcript|length=6639bp|location=Sequence derived from alignment at sc0000019:586602..593240+ (Clytia hemisphaerica)
gaatattttggtGCGCGCAGCACTTTCGATTTGACTTGGAAGAGGTTGGA CGCATTTTGACCAAAACAGTGAGTTCTTCACAATCCGTTTTTCTTATATC TTTTGAAGTACTTTATCATTTCTCAAAGGtaaccccaaattttttttctt atgcttAGGGCTATCAGATGAGCCTACTTTTGTTTCTTCTgattaagttt gaaaatttggtTGACTCCCCTACTTAAAAGCTAAAATCTGTTTTTTGGAG ATTACAAAAAAAcaccacatagaagatctttcaaattcagtatgtgaata gagcaataaaaaatacaacttttctatttttccttttttttgcaaaattt ctaggaatgaaaatagaGGGATAATACTATTGTCTATTGATGATCCGCCG ACTATCGTAATAGTGCTCTTCCCTTGAGACAATGATTGACAAATTTTTCA CCCGCGTGGGAGCTTGCAGTGATTCTGCAAGCGTTCTGTAAGCATTCTCG GCTCAATTCCTGTGCCaggctaaaatggtagacttagctgtgacagatca tttcaCGACCCTTGAACACGCCCGGATGCCGCCCGAAATATTCCGTGCTA AGAtctatttatcaaaaaaaggatAACCATCTGGGCAgcattttcgaaaa ctttatTTTCGATGTCTCAGTCCTCTAATTCACTTTAAAATTCATGTGAG ACATTTCTTATGGACCTCCTTATTTTACCTTGATTCTTAACCAGTCTCTA TTTATAAATCCTTGCAATCATTTGCATGGGGTTTTGGCGCCTGGGATTGT TAACGAAAGTGATGTAAGCTTGCATTTTGCAGCGCATGCAGTCCACCGCA aatacaggagaaaaaaattcgATTTCGATCTTGAAGCATGAGATTCAAGT GTATTTGTACAGGGTGTAAAAGTATTTAAAGATCACCATATCAATTATTT AcctaaaatacatttatttaaTTACAGTGAAATTACTAAAAACACGTTGA ATTTTATCTAAAATGCAGTTTTATTANATTTAAAGATTACCATATCAATT ATTTAcctaaaatacatttatttaaTTACAGTGAAATTACTAAAAACACG TTGAATTTTATCTAAAATGCAGTTTTATTATTAAAATATGTGAAAgtatc aaaatatttcaagtcttcaaattgcatattttaggcGCTCGGAGGCCGCC CGGACTGGCCCAGCAAGTCGTTTTTGAAAATCTATTAATTTTATCTGCCC AGACGCACCTGGAGAAATGCTctattctaccatttttagaaTCTCATATT TGCCGTGCAACTAATTTTTGCAAGAAATGAATGAAACAGCGTgctttgat aataaaaaatcatgctTGATCATAAATTTTAAGATGGCGGGAAAACGTTT CTCTAAGGCTGCTGGACGTTTAACCTCAAATTTAATAATGATATTATATA gacataattatgcatgacatcACTTTATGATTAGGAGATATACATTTTAC CACCCACAAATTTTGTAtaggtttgttttgttttaactttgtattttaat gaccttccaggtcattcatttgagggctacacgtttccctccactgatgc aagtttttGTCTGGATACCTACAacataaaatttgataaattataataag aattgaaaaattcaaaaattatgtggtaaaatcttaaaattaaaaaaagc tttgaaatgAGAGGTTATAATGTGACCAAGAAAATACTGAGATTATAGAT TTAGAAATTAAAATCAGAAGCAGGAGTGTgataaaacctacaaaaaagcA GATTAAAACTTTAGGACTACCTGCTCTGAACACAACAAAGTCGTtaaatt tggttgaaattttgcagtGTTTTATCACGTTCTATGACTTTGGTTGACAG CTTTTAGACAAGTTTTCACTATGAATTATTCTTAATAATTTTCAGAGTAA TTTCAATACCACATCATGGCATTTCGATTGATATCACATCACAGGACTAT GTTCAGCCCAATGATTACTGCTGCTCGTAGAATGCTGACAATTGACATCA CTTCACCGCaagaatttgatgaaaaagtcTTGAAATCTGAAGTCCCTGTT ATCATAGATTTTCACGCCACGTAAGAATTTATCTTGTTTGTATGCCTCCA TACCTGCACTTTCCTTGTATTTTTACTGTGTATTGATTAAATATACTTAT CAAGCCTCATCCTATATATGAACACAATAAAATTTAATCTCACCTTTGTC AGTCCAACTGATCCAGCCAGCCCACCTCCTATGAAAAGCCCCTAAATACC ATCTAACGAACTCCTACACCAAAACTCTATTCCCATATGACAGAAATCTC TATGGTGGAGTACAAATTCATAGTGCGGAAAGAGATGTGACCTTCTCAAA TGACCctcccttcttggcatccccaaccttaaaaaatgcctatcccccaa ggattttggacaaaaattgctaacaaatatatgtgaaatatctttagaga gagaaagcgaaataataaacttctttcatCTTTTTGACTCATACTAATCT AAtagaaaacttcctttcatgaagaccaaatttcataacagtgcttgaaa ataatctgcAATCAATATATATAAAGCCTCCCTTCTTAAACTATCCCTCT TCCTTGCTACCCcccttttttcatgaaaatttctgatcccccttcttcat tttttcggaggtttcacccccccccccccccccNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNccccccccccccccccttaagaaaggggggtccgaactatgaa ttaaattatttttaggcATTGGAATAAATTGCACTATGTATATACCAATG TAACAATGCAAGCGTATCTAAGGTTTTTCAAAAGATTGCTCCTGCGTTTG TGTTTTCGATACTGTCTTCGAAAAGAATTTGCATGTATTTTTGTGATCAT CCTCTTCAAAATCTGACTGTGCCACGAAGGGCTGATGAATGTATTGATTG AATTTTAATTTGAGATTTCCTCTTTAATTTCAAAGGTATCTGAAACAACA ATAATCACAAgtgaaacgaaaaaaaataaacctTTTACTCTAGCTTTCCT TCCACCCAGTAGTATCAATGTTTGTATTTAGAGAAAAGTAGAGCTCAATT TCTATGTATAGATATGCAAAGATATAAATAAGCCTTTTCAAAGTTTGGTC ATTTCAATGTCTATCTGacgttttttggccatttttatgGAAGTCAGCTT AAACTTTAAAGCTGTTTCAATGTTTAGTGTCAGCAATTGggaggtttttt tattttattttttaacttttattttatcctACTTTACTGGAATTGAATAA AATTGACTTCTGAGTGAGGATTTCAGGGAATTTAATAAATATCCTTAAGT CTCACATCAGAGTGATACCATCGTGAATTTCCAATGTGTAATGCTTTTTA TCTGAAGGCTTAAGAATTTTATGGGTCTGAACattattttaagaacattt aaattATAGAGAGAAATCTTTACATATCTACTACCTTTTTAGATGTGACA AAATAACTATTGGGCAAGTACGCTTTGATTAAGTTTATTTTTGCTTATAA TTTTAGACGGCGTGGTCCTTGTAAGCAGAAGAACATTTGAACTAGTGAGA AATCTTCAGATATCCACTATCTTTTAGATGTTATAAATTAATTATCAAGC AATTACGCTTTGATTAAGTTTATTTTCGTTTATAATTTTAGATGGTGTGG TCCTTGCAAGCAGATGGATCCCACTCTGAAAAGTGTCATTCAGAATTACG AAGGGAAAATCAACTTGGTCAAAGTTGATGTTGATGAATTACAAGATTTA GCAATGGAATATGATGTAAGCATCTTCATCTTGAATTAGCTCTGGTTTAG ATGGCCAACTTTTCGCCCGGTCTATTAAAATGGGCATaaagttggctgtc taaagtcgacgcattgccctcttttgatgtcaatgcaatgacttatTTCA ATCTATTTCGAGCAAAAATTAtaactgccaactttgtgcccacttttgac ctactctaacaattagaataggtagGGCATGAATTCGGCTGTCTTAAACT AGAGCNCACtgtaacaattagaataggtagGGCAGGAAGTCGGCTGTCTT AAACTAGAGCTAACCGTTCCGTCCCCAATGAATGATAGCCAGTGTTTTGA AGCTGTTCAATTCACTGACGCTGCAATTATTTTCAACATAATAATTTTGT TACATGATAAGATTTCCTTGGATCGGGTTAGGTTGACAGCATCCTTTACC ATTTACTCGGCTTTTGTAGCGCGTCCCTGTAGTATTTCTTTTATTATAAG GAATGCGAAGCAGATTTGAAAAATCTCTCCGCTTAACAAATTTCTGTAAT GTGACCCTTTTTATTTAACCTTTGTCACCCAATTTagataaaaaaggaaa tttatGAACTTCTTTACCATAATACCCTTCCTCACTGGATTGATTCCAAC GATTCCAAGAAAGttatcaatcaaaaaatttgtgGGCGGTAATTCGCATC CCTTATAACAAAATACATCAGAAGGAAGAAGGATGCTGCTAGCCTAGAGG TTTTGTAGGTCTATGATTCAGACTATCCAAAAGACTTGTCTTACTTTATA ATAAGTAACTGATATGattgagtttttttaactttttgattcAGATACAA CGGGATAGTTTCAATATGCATTGTGTCTAGAAATTCTGCTGTAGAAGAAC TAGCTTAACCGTTAATCGGGGTGACTCTCAACATTGGGGAtaaaaggccg gtctccacttgagTGCGCAGCAATCGCACCTTTAACCTTTCATAAAAATG TAGTGCgggcttgaaaaaaaagttgaatacatttcaacttttttcaaccg ttacgtcagattgcgccaatggaattgttcgaaaaagtgcgatcgcagcg cgcgcaagtggagaccagcTTAAGTTCGATTTCCTTGTGCTCAAAGTCAG AGACTTACAGTACAGCATAAAGCATACTTTACCTAGATCAGTGTGTTTCG ACCGCATTCAAAAACCATTCGTACTTTATCCTACTTAGTCTGCCTTTTTT GTGTTCCTCTACCTCCTAGGGCCTCATACTTTAATCGCATCTGATACGTG GGAATTAATCCCTCgcttaaaggttttcttttacATGAAAGTGtatgttc ccgtttcatatcagggtaggtctgcctattgttatgttGTGCTGGTATAA GCAAAAAAGGATTTTATTTTCCTCTCtatctgaccaatcttgctccacat ccatgtcaattcaatatcaaaaagcttgtaaatcaaaattaatgagtaag caaacgataccaCACACTTGccccttataaaaaaaaacaaaaaagcttta agtaCGAAAGAAACTGTAAACGAGGtaaatatttattatttaaaatttac attattttttaGGTGATGTCTATTCCTTACCTGGTTGGCCTGAATAAAGG AAAAATCGTACAAACGGCTGTCGGTGCAAAACCACAAGATCAGATCATCC AATTTGTTGATGATGTATTGGCTGCTAGTCAATCTTAATGAGAACTAAAG TGATACctaaaagtttgaattttctaACTGGTCCTTTAGCTCTTTATTTA GTATGGTGTGGAGTGGAGTGGAGTGGAGTAATAATTACGCACGACTTGAA GATTAAAAGAATTTTCACTTGATGAATAAAATGTGAATGGAGGTGACACG CGATCGTCGTGAAAACTAAATTAGGACGATAATGGAATGAAGAAAATTGT TCGTAATTTCATCTTTGACAGACTGTTTTTTAATatctacatttttatga caatAGTTCAGTCATTTAAGAGCTACTGATAGTATTTTGTATAGTAAGGA AAGCTTTGAACTTATCCCTTACGGGAAAATCCTAGGAATAAAAATGGCTC AGAgttatataaaaaagacttgACATGACTAattaacttttcataaaaag cGTTTCCTCCGATTTTTGACTACCTGGACCTGACccaattattttcaaac ttatttTACTGATTGATTTACAGTACTTCCTTATGTTTTGTTGTGTGTTG TAAACATTAACTCGGGCTCCAGAAAGACACTGGAAAACTTGGAAATGAAT GCTTTCAGGGAAATCTCATAGAAAACTAGGGAGACTCTGAGaatttcagt taaaaaaaacagaatagcTTCTATTTTAAGTTCCGGGGACATCATTTCTT GAATTTTCTCTTTTCATAGCAAACCATTGTGGCTCCTTGAAGTCCcaaat cattttgatttttctatgaTGTCTAATCATACTGTTTCAAGAATTTTTCC CATGGTTCATCATCGATCAAGGGTTTCAGTTAGGGAAAAATTGCATGATT TCAGTCATTTTTTCTGGGAAATTaagctttttttttcaaagataagGAAA AGtctttactcttaggtgccaaataaacgggggggttggaaaattttcga aattttaataaacgggggggggacctaattgccggggggttggaaattgt acttctgaaaaccccaaaataaggtaaatataggctaaa
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_001194XLOC_001194Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00002259-exon-sc0000019-1491911889:586602..586669TCONS_00002259-exon-sc0000019-1491911889:586602..586669Clytia hemisphaericaexon
TCONS_00002259-exon-sc0000019-1510915933:586602..586669TCONS_00002259-exon-sc0000019-1510915933:586602..586669Clytia hemisphaericaexon
TCONS_00002259-exon-sc0000019-1575043694:586602..586669TCONS_00002259-exon-sc0000019-1575043694:586602..586669Clytia hemisphaericaexon
TCONS_00002259-exon-sc0000019-1491911889:588547..588721TCONS_00002259-exon-sc0000019-1491911889:588547..588721Clytia hemisphaericaexon
TCONS_00002259-exon-sc0000019-1510915933:588547..588721TCONS_00002259-exon-sc0000019-1510915933:588547..588721Clytia hemisphaericaexon
TCONS_00002259-exon-sc0000019-1575043694:588547..588721TCONS_00002259-exon-sc0000019-1575043694:588547..588721Clytia hemisphaericaexon
TCONS_00002259-exon-sc0000019-1491911889:590393..590516TCONS_00002259-exon-sc0000019-1491911889:590393..590516Clytia hemisphaericaexon
TCONS_00002259-exon-sc0000019-1510915933:590393..590516TCONS_00002259-exon-sc0000019-1510915933:590393..590516Clytia hemisphaericaexon
TCONS_00002259-exon-sc0000019-1575043694:590393..590516TCONS_00002259-exon-sc0000019-1575043694:590393..590516Clytia hemisphaericaexon
TCONS_00002259-exon-sc0000019-1491911889:592114..593240TCONS_00002259-exon-sc0000019-1491911889:592114..593240Clytia hemisphaericaexon
TCONS_00002259-exon-sc0000019-1510915933:592114..593240TCONS_00002259-exon-sc0000019-1510915933:592114..593240Clytia hemisphaericaexon
TCONS_00002259-exon-sc0000019-1575043694:592114..593240TCONS_00002259-exon-sc0000019-1575043694:592114..593240Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000019supercontigsc0000019:586602..593240 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0 0.282069 0 0.234327 0 1.44336 1.65392 0 0.515719 0 0 0 0 0.183574 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0
Blast
BLAST of TCONS_00002259 vs. Swiss-Prot (Human)
Match: THIOM (Thioredoxin, mitochondrial OS=Homo sapiens GN=TXN2 PE=1 SV=2)

HSP 1 Score: 100.908 bits (250), Expect = 1.687e-24
Identity = 44/121 (36.36%), Postives = 77/121 (63.64%), Query Frame = 2
Query:  116 RTMFSPMITAARRMLTIDITSPQEFDEKVLKSEVPVIIDFHATWCGPCKQMDPTLKSVIQNYEGKINLVKVDVDELQDLAMEYDVMSIPYLVGLNKGKIVQTAVGAKPQDQIIQFVDDVLA 478
            RT+++  I+    + T +I    +F ++V+ SE PV++DFHA WCGPCK + P L+ ++    GK+ + KVD+D+  DLA+EY+V ++P ++ +  G +V   VG K +DQ+  F+  ++ 
Sbjct:   50 RTIYTTRIS----LTTFNIQDGPDFQDRVVNSETPVVVDFHAQWCGPCKILGPRLEKMVAKQHGKVVMAKVDIDDHTDLAIEYEVSAVPTVLAMKNGDVVDKFVGIKDEDQLEAFLKKLIG 166          
The following BLAST results are available for this feature:
BLAST of TCONS_00002259 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
THIOM1.687e-2436.36Thioredoxin, mitochondrial OS=Homo sapiens GN=TXN2... [more]
back to top