Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00002239 (transcript) - C. hemisphaerica

Overview
NameTCONS_00002239
Unique NameTCONS_00002239
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length2720

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00002239 ID=TCONS_00002239|Name=TCONS_00002239|organism=Clytia hemisphaerica|type=transcript|length=2720bp
CCGCAATCGATTAGACTGGTTACGTAAGCAATACGGAAGTTAATAAATCT
GCGGGTGAGTGCCCCTTGCCTTGTTAAACATAGTAAACCATAATAGTTCT
CCGTCAGATAGTATCTTACCGGCGAAGAAGCCTAAACCAGACTGCCAGAT
CCACCCATCCACAAGCTCCACACTCTTGTTTTGGCTCTGCTTTGTGAAGA
TTATCCCCGAAGATCATAATTAATCTCATTGGTCTCTTaTAATTGTCCTC
AGACTTCAAACAAGATGTCAACTACCaacaaaaaatTCTTCTCACTTGAA
TGTGCAGTTCAGAATTACCATTGGGGAAAGTTTGGAGAGCAATCAACAGT
AGCATCATTGGGAAGAATGcaaaagaatttcaattttgacgctGAGAAGC
ATTATGCAGAGCTTTGGATGGGTGATCACCACAGAGGACCAAGCATCGTT
CAAAACATGTCAGAACCAACAACCCTCACTCAACTTCTTCAAAACAACCC
ATCTTTAGTCGGTGAAAACATTATCAAGAGATTTGGCAAAGCtaatctac
catttttgtttaaagTGTTATCAGTTGAAACGGCTCTGTCCATCCAAGCT
CATCCCAATAAAGAACACGCGGAGATCTTGAATCGCACGAGACCAGACGT
CTACCAGGATGATAACCATAAACCAGAGATTGCCATAGCTATCACGCCAT
TCGAAGCTTTATGTGGATTCCGACCAGCTTCGGAGATTTTGAGTTATTTT
CACGAAGTCGAAGAATTACTGTTTGTGGTTGGACAAAAAGCTGTCGATGA
ATTGATCAATGCTGAAATGGCTACTGATAAAAAGGCGAAGGATGAAGCTG
TACGCCGTGCTATTAAGGGCTGCCTCTCGCAACTCATGGCGTGTGATCCA
AACACCATCAAAGAGCAACTAGCAAAGCTGATCACGCGGTTGAACGAATG
TCATAAGAAACACGAGGATACTAGTCTATATCTTGGTAGGCTCTTACTGA
GAGTCCATTCACAATACCCAGGCGATGTTGGATGTTTTGTCATCtatttt
ttgaattatataCAATTGGAACCGTTTGAATCGATCTTCCTTGGACCTGA
TGTCCCACACGCTTATATCTACGGAGATATTATTGAGTGTATGGCGAACA
GTGACAATGTGGTGCGTGCTGGCTTCACACCTAAATTCAAAGATGTCGAT
ACTTTAATTGAGATGTTAGACTACAAACCACAGACGGTAGAAGAAACGAA
ATTNCAAATTCAAAGATGTCGACACTTTAATTGAGATGTTAGACTACAAA
CCACAGACGGTAGAAGAAACGAAATTCAAACCCACCTCTTGTTCAGATGA
TCCACATGTCTCGATTTATAATCCACCCATTGATGATTTCTCTGTTAAAA
AGATCCAGATTCCAGCTGGAAACGCGTCCGAATATGACGTCCAATCCGTT
AAGGGGCCAAGTATCCTACTCACATTATCCGGACATGCTGATGTTCAGTA
TGAAACCGAGGCTGGTTGCCTAGCAACATCACGTGGATCAGTATTTTTCG
TTGGCAATGGTGAGAAAGTGAAATTAACAAATATTTCTTCGAATgaagaa
ttattgatttttcaagcttATTGTGATTTGGTATGAGATGATTTTGACTT
GATCGTTTTATGATCGAAGATTGGACGGATTTTTATCGATCCTATGTTGT
ACAGGTAAAGACTGTATCAAGATTCGTCCTAAATTATTGTTGGTCTCATT
CCGCTCGGGGaatcttaaaattcaaaatcatttttggtgATGCTAAACAA
TTTATAAAGTGGACTCTCTGTGGAGAAGGCTATGTTTACACTTTGTTGTT
GACTTTAGGCTAAATATACATGTGTTTGTTTGAGGGAAGTCAACGAACCA
TAGATTTCTTATATAAATAGATAAAGAGCTTTTTTATCTATTCCAAGCCA
AGgtaaagcaaaataatgcgccatctttgctgatAGTAGACCACAGTATA
AACCTTGTTTTTCacttttgaagtattttgacactgcaatgacttcaaaa
tttcaaggaacTAAAGCTCAATTGTGACGTTACTTCATTATTTTGCTCCA
AATAGGGAAgaaaagctctatctagtgttttgtTTAAGATATCTGTGCAA
CGAACTCGTATTTGTAACATTCTTAGGCCAGGGGCTGTTCTTGGGTCGTC
TCTTTTACAGGCCAGGTATAGTATTCTTTGCTATTATGTGATATGCTCcc
tcaaccaataagatttcgTCATTTTGAGGGGAAGATTTCGTCATTTTGAG
GGGAAAACAAagacttttttgtttactgATTACACCAGAGATTACACACA
CCTGgattttagtgagttaaacctaGCAATGTTCTGCTTTCATCCAGAGT
TTCTGTCGTCGatggaaaattattttatagTGATAACTTTAAGAACCGGT
ATGTTCGGTTCTATCAATCCACAAAATATACATTGTTCATTTTAATCACT
ATATAATTGAaggaatatatatttttgtacgttattttcattttcaagat
ttgtatatattatttttatcGTTATTTGTAAGTTGGTAGCAACaagtaat
tatttaaaaaaactgcttaagaattttgttgaagaaaatattttttaaat
ggattttttttgtgtgtaaaaaaagattatttcgaatttattcgcgctgt
gatactcacggtaatgaAAG
Run BLAST on NCBI

transcript from alignment at sc0000019:286600..316441+

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00002239 ID=TCONS_00002239|Name=TCONS_00002239|organism=Clytia hemisphaerica|type=transcript|length=29842bp|location=Sequence derived from alignment at sc0000019:286600..316441+ (Clytia hemisphaerica)
CCGCAATCGATTAGACTGGTTACGTAAGCAATACGGAAGTTAATAAATCT GCGGGTGAGTGCCCCTTGCCTTGTTAAACATAGTAAACCATAATAGTTCT CCGTCAGATAGTATCTTACCGGCGAAGAAGCCTAAACCAGACTGCCAGAT CCACCCATCCACAAGCTCCACACTCTTGTTTTGGCTCTGCTTTGTGAAGA TTATCCCCGAAGATCATAATTAATCTCATTGGTCTCTTGTAAGTATAATT CCTCAGTTATAAATATAAACGGTGAAAAAATTGACTATTACAggggatac acgtttttttataagaacattttaaggcttcgtggactTTATTAAACCAC TGCGGACGGCCCCTGCTGGGGGTCCCAGCGGCCGGTACTGGGGGGTCcga tcggtgctcactggtcagggggatgtgagagtacacgcctgcaccgttga GGGTCCTTCAAATCTTCTCTTTAAGtgccgtcaaaagccggcaaaaattg ccaataaTGACCTACCTCCTCACAATTGAGGCtgctacacccctttctca ccaggAAAAATTGCCAGTGAGATCAATTAAGGCCTCTAAAGCCCTCCACA GCCCCCCATAGCCCTTCGGATACCCTCTGCATTGCTctccctcaaagcca gcaccctccatcaatCCTTTAAAAAGCTTGgaggaaaggcttgaaaattg gcaaaaaattggtcaaaattggaaaaaattaccTCCTTTATTTGGGTACC ACCATTGACAGCCCCTGGAGGTCCCGGCCGGGGTTTCCAGGGAGTTTGat cggtgcccactggtcagggtggatgtgagggtacacgcctgcaccggtgg gggtccttcaaagttcctcaaagcgtcgtcgtcaaaagccggcaaaaatt ggaaaattggagAAAATTAGGAAAAATGACCTCATCatttgggtaccacc gtggacggcccctgggggtcccggctgGGGTTCCGGGAGGTTTGattggt gcccactggtcagggggatgtgagggCACATGCCTTCACCAGTGGGTGAC gagggtgcttcaaagttcctcaaatacaccttatcggaaattccacaaaa acaatcgcgctaaaatggatccgttgaaattgggaggtaaacataaatgg GACCAATGGTGGCGTAAGTAGCGCTAAAAGTTCCCGCGTAAAACAAGAAC TCATTTGCTTATATCTGGCTTGTTTAtatgttcctaaaaatacactgaat ttgaaaaaaaacaaacaaaacaaagctttcaagatgctagcagaagctat aagaaagagaaaaacaacaactttgGTGGTTTTTCAGTTGATTTGGAGGC TCTTTTGGCATCAATATTCTGggtgttttgtaaggctttttaCCTGAAAA CCGCAATAGCAcgctttgtttacctcccaaaaagtgttgcgtagcaacaa cgcaaggaggtggaatttccgataaggtgtattgtctaccgtgaatagca caggtcaaaatcttATATTGACACTGTGCCGACGAATctagattctattc agcgcgcaatcaacgaagacaaaagtaaccatgacgaccatccaagatct tggatgaagttcaaagttgatatttttattcccgTCGTTGAAAACATAac ttaaaaaagtcatcaatgctttgtaaaaagagtcagtgatagagaatcat aacataaagtctgtctattatttcgattcaatttttaaaagtgacatttc cataattaaaagtttagtaattactgttatacattttggggatcatgtaa aagatttctttcaaaataaactcatttcaattacacttggaggtttctgg ggaattcgtaaatagtaaactgcatactgatgtacagtctgctagacatt aatatggtaatatttgctcttcatcctgcttcatctttgatttttttcta cagtgattaaattgacacatgcgcgataaaatttctattattggtcctca gaggttgatatattatttaaaaacttaatctgatactcagggtacaaaGT GTCGTCAAAGGCCGGCAAAAAGTGCAATCGAATTATGCCTAAGTGGAGCT GCCTTCAGTTCCTcgggttttctcaaaattttgttcgataaacttgacaa agtttgattaagtttgattagtttgattaagttcgaaTAATGTaattgaa ctaatcgaactgtcgaggtctctttaaaaaaagttcaattaagttcgatt tcagtaatcaaacttaatcgaactttgtattttgagaaatttgtgagtat tcgattaaagttcgacaaccGATTGAACTGCTCTTCTGTTTTATTTTGCA CTCTGGCGATTGTAATTTTCGTGACCACATAGCAGACTCAAGTAAATACA AAGCTAGCAATCCACAAGGGACAGTAAAATTATGAATATACAAAATAGAA ATGATTATTCTCTAGAGTGAAATAAACTCGTTATCTAGACAATAATGTCG TAAAATAAGTAGTTATAAATTATTATTGTCACAATGAAAAGTAtacaaaa ggaaaataaaattgaattgcAATGAATTAACAAAAGGACTTgagtttttc ataaaaaacagaATCTTAGCAAATGATAAATCGTCATTTATCAGGGTCCA AGCTATGATCTGGAATGTAGAGGGGCCAAAAATATACTGGAAGTTTTTTC TAATGGCGACATCCATCTTCTAATTCTGTCGAAATCCCTGACGCCAAGAC CACAAAAACCTTGGGCCTATTTGTTTCACTTACTATAAATGCTGTAGTTG CTATCTGCTAAAAGTGCTATGAAATtccatgaaaactttgaaaatgatat gATAGCAAATATTGCAAGTTTTGTTGTCTGCCATCTTGATAATCCCTGGT TGtactttgaattttaaaaagtaaCTTAGGATCCATTGTTTTATTATTAG CAGGGGAGCTGTGTGGCCACTATCCTGCCATTATGAAAGTAACTGCTATT TTGATTCAGATATAGACCCGTGCGTGGAGCAAGCTACAGTTTCAGCTCTT CACTTCTTTAGTTTAATTGGTTCAAAATCGGCAATCAGGCTAATAAAATA TCATCATGTCTGATTTAAGATGCAATTTTTACTGtgaagaaattgcgatt ttgcTTTGCTTGCAGAAGGTTGaagtttttactatttttgctaATAGGGA GTTTGCAAGTTTATTTGCAAGAAGTGCAACAGATTTGGACAGATAAAATT TAAATGAGAGCACTTACAGTAAATGTAgcaaaaatagtgatgaaacaaat aggcccCTTGTGTCATCGTTGTCCGACagactaaattttttttgattttc tatttctttgaCAAAGATATTTCAAGTGACAAAATAGTTGGATTTTTATC CAATTCCATTCTTTGCTTCAAACGTCATCTTTACTTCCATTATTTATAGC ATATTATGtacattttttatggaaatattcaaaatagaATGGAGATAATA TCCCACTCTTTCCTTTAGGTTTGTAGGAATGTGTTATCATCTCCCTAATC ATAAAAATGCTAGATTGATACCACCTTTGAAAAAAGAGGGGCAGCATTGA ATCtagaaaggaaaaaaatttacagtgggaaattcgaatttagcgctgtc gttgtattcaaaaaatattttattaaaaatctatTCCATACATCAAGGTG CTCTTCGAGTGTTTTAAACAATAGGAAAAGTAAACATAAAGAGAATTTCT CCtcttttttttgcagaaaaaattgcAGAAAGCTGCAACAAAATAGATCT GATCCATTTTGTTGCAGcctcttgcaattttttttgcaatatttttttgc gtttttattGTGTTGCAGAAAAGATTGCAGAGAATTTGACCTggctacac tcattttttttttcgagcgctTAAAGGCAATCTAGATTGCATTGCAAGTG CCTGAAAAAATTGctcagtgtagccttagcttaagggtcaaaatgagcaa aaatgagaaaaagcgAACTCCTAGAGGTGTAAGATTTATTAAGTCTCACC ATATTTTGCCTTGAAATGGTCAGAATTTTCAGAAAAACGCACCGTAAGGG TTtatttttcgcccaaatttactcGAATTTAGCTAagttttctctgcact gtaagggtctgatttCAGAGGCCTAATTTGGGCCTTCTATGAAGTGTTCA ccaacatttttgttttcaacaaatacaaaaattcaaattaaatcTCATGA CTTTCatcttcaaaatgttttttattcaatcttgtTTGCAAATTTTCAAT TCTGTCATTATATATATCCTGACtttatcaaatattttaaattgttttta tagaTAATTGTCCTCAGACTTCAAACAAGATGTCAACTACCaacaaaaaa tgtaagaaaactGCCTTTTAATACCTCCCTTTGAGACTATTTCAAATCTA GTCATTGAATTGCTTTTCAAAAGCCATATTCCTTACCCACCTTATTAAAA GATAGAACACCCAAGAAGAGACTTTCAGTGAGGTATTTATGTAAAAGTAC CAAAACTATACAGTCCCTCTATTAAAAAAGTCCATGTCCATTATTGCTTG ACATTTTATTTAGCTTTGAGGAAATCTTTAATCTCTTCAAACTAAACTTG CAAATTTGGAACTAATTTAGATTTCCTTTTGTATaaactaataaaataat aaattttctatTAGAAAAATCAATCTGATTATTTCTCTCTTTCAGTCTTC TCACTTGAATGTGCAGTTCAGAATTACCATTGGGGAAAGTTTGGAGAGCA ATCAACAGTAGCATCATTGGGAAGAATGcaaaagaatttcaattttgacg ctGAGAAGCATTATGCAGAGGTATAGAATGTTTATTTTGATGACAACAAT AAATCTGACAAATAAAGGTAATACAGTCGGTCCCAGGGAATACAGTCGGT CCAACATTTCATACAATAACAGAAAAACCGACTTAAACTTAGTGGAGACC AGcctttaataatatttttatgatatttcCAAGGGTATCTTGGCAAAATA ACCTTACACCCTTCAATGCTCcatagaaaattttccccagctttgctagc ttggcaaaaactggtttaaaatcccaagggaccatataataggaaaatat aaaataaaaacccataaatACAACTTGTAAAGGTCGAAGGAAAAAAGATT AGTTCGCCACTAGACTACTGTTTTATTTGACAATGAAATGTCGTCTCTAA AATTGCATAATACAGACCATAAAATTTCGAATGCTTCTGACGTTGATTNA CTGTTTTATTTGACAATGAAATATCGTCTCTAAAATTGCATAATACAGAC CATAAAATTTCGAACGCTTCTGACGTTGATTATGTATGAATAAGAATTAC AGCAAATGGTTACATTTTTATGATCCAAGTAAATAAtttgaattgctttt gcaaTATCAGCACGCAAAATTATTTACATGCGTAAAATTGTTATGTtaac ttaaatgttttttatgttttttttatcaGATAAAAAGATTTTGTCCTAAA TTACCTAACAgaacaaacattttttttctgtaGAAGATGGTCAGTGAGTT TTTTTTAATGCTCCACTTAGAACAATTATATCGAaggaaacaaaataaag aatcattttcagatttttcagtCTGCAATCATGAAATGAGATGGGAATAA GCTCTTTTGTAGAATTTTTAGTGTTTGATTTTCCCATTAAATTTCAATTT GTCTTCTAAACATTGAACATCCGTGTGAAACGGTGTGTTGGATTTCTTTT CCCATTCGTTTCACttgtttcacaaaaatgtaaatcacttttcaaaaaaa agcaaCATGTTTTTTAAAGGCTTCGATTTCgttgaaaaaggtttcaatgG TATGTATGGATGCTCTTGAAATTATAagcctttttgaaaaaagtattgTC AAATTTTATAACGATAAGATAACGATAGacgaaaaaaatgagaaaatggt ATCATCATATTATTTGCCTACAAAGCATTTTTCAAACCAAACAAAAGAAC TCCTCTTCCACACAGCAAGAGCACAAATTTTTTCTGATATGTCATCATAA GTTAGGGTAGGGTGTTaacagtcatttttggggcaaagtcaCAAAATTCA CTATGTAGTgtttttttgtataaatttatccttaaaaagcattttgctac ctaAAATTTGCTTAAAGTGGCTCATATAATTTAGTTAaactaatgaaaat attaagagtaataataataataataattttgacATGTTTAAAGTCCTGAA AAGGCCAAAAAATGCTaacttttctaatttttgcctgtagtgcaaATCGG GGGGAGGGGTCGGCCAATATTGGATatcgcagaatgcctcacaatattTG GCCACCTATttaggttaaattttcacaaaaaaacgcTATATCTTGAATTT TCTACATCATAAAAAGAATGTCTTTAACCTTTATAAGGGAAATTGATATA AAACAGACATTAAGCATTTCGAACGACTTCCTTTCAAAcgtgtttttatg tttttaattagGTTGAAATATCATCCgctaaaaaaggaaaataagatACC ATTTCTGccattaaaaatgaagaaaaaagattttcttgttTGCTGGCTGA TATGACACTTATTTAGAGTTCAATTTTTGCCATTGGGATATTATAGTTTG AATTTTGTTGAGTAGTTTTTTAACAGTTTAAAAAATAACTTTAGGCCtaa tttactacaaaaaataTTACGTAATAACGCAAGTAGTTAATTTTGCTACA CTCATGAAAAAGCTGTCTTCGATGCAAACATAAGCTCTATGAATTTTTCA GAAACTATATTACCTTAGTCACAAATAAACCCTGTAAAAACATTTTGTCA ATTAttacaaaagttaaaaatgattaaattttttttcctcatttttctga aacttgaatagatatttttttcgatttcattgAATTCCAGCTTTGGATGG GTGATCACCACAGAGGACCAAGCATCGTTCAAAACATGTCAGAACCAACA ACCCTCACTCAACTTCTTCAAAACAACCCATCTTTAGTCGGTGAAAACAT TATCAAGAGATTTGGCAAAGCtaatctaccatttttgtttaaagTGTTAT CAGTTGAAACGGCTCTGTCCATCCAAGCTCATCCCAATAAAGAACACGCG GAGATCTTGAATCGCACGAGACCAGACGTCTACCAGGATGATAACCATAA ACCAGAGATTGCCATAGGTATGCTTTTTTATTTGcgagtttatttttttt gctagTTCATTTTTTCAATACAGTACAGTACAATACAGctcaaatttgaa atgattttaCGTATTTTACGTAACAAATATCATGGAAAAGGTTTTTTGAC GtaaattttatacttttaaAAGGACAAGTTAAACCTTGTATGAAAGATTT CTTTGACATAAGTTTTAAGCAAATCCCTTTTAAAGTCAATCTCGCATGAT CAGTTGACTTTTTCATATTATTCATATAGACTGGAGTGGTTTATAATCCg tgtaatgggcttttccagaaaaaaattgaatatggagggtggaggatata acatttttaaaagatttaccccccagacattgtgacttttgatccCCCGG ACATttaaaattaccctcaaacagagcaagtttacccctgggacaaggaa aattttgtagatttttcactacccctggacactatatcctccacccccat gtacgaacattttctggaagagccaaaTATACTCCGGTTGTTTCCtctca tttttatatttacTCTTCGCCTGGAAAAAATAGAACATCTTAGAAAATCT TTTAGCCACCTCTGttcacgtttttataagaacaaactataagaacataa ggattcgatcgccaaaatattaagaacaagctaggaatattttaaggctt tgcagattCTAAAATACTCAATTTCTAAGGAAATCGcacaaaaataccca caaaaaaatggtgaaaattagaacattttaagaatattttcggGCTTAAA CTCAAGGGAAATGTCAGGTAGAATTTTCTAGAAcattattataattatta tatGACTTGTATATAAGTACAAAATGTAGTACAATGGTCTCCATTTTAat gcaaatttgttcgagttatggaaatttcgagttatagaaacgGGTTtata aaacattgaaaaaaggtataagaaaacttgttcgagttcaAGAGActttc gagttgtagaggttcgatCAGGTCTCTTCTGACTTGAAACAGTTGCCTTG AATGTTATGTGCCAATGGACAcgtagaacaatagaaaatatAAACATTAA TTTCGCCACATCATTTGGAAAGATTGTCGAAGGTCGATCAGAGCATGCTG CGTCTCATTGAAAAAcataataaaccagccgaggctggaaggtcagccaa tatagTTAGATTATTAGTTGGATCGTTTGTAAAGAAGTTAAATAGCTGCG ATGGAAGGAAGGACTATATGCATAAAGAATCAAGCAACATTGGAAAACTT AATAGAGCTAGAAAATCACATTTTGCCTAAATGTTTCTCCAGGTTACTCA AAACTCCTAGTAGTAAGATTGAATAGAAAATTGACATTCCGTATCTAAAG CATTTAAATTCAACATTTAACATTTTGaagataaagtaaaaatttaggga caaatcacaaaattttagatATGTCCTGTTATAAACTTATACAAAGATTC TATCAAAAATTCAATTGACAGGTCACATAGACTGACCATTTACTTTAACA AatagaaatagtttttttttcaaataatagtTCATTATATTTATCACAGC AGCATCTTTGCAAtaatcaagcaaaacaaaacaatgcaaTACGAAATGGT TAATGGACAAGTATAGATAACACTTATGATATCATTTTGATCACTTTCAT TCACTGAGCGAAGAAACGTTatgaatttcaaaatcagcAACAAATAACTC TATTATGAACAAAATTTAAATGGTCGTCAGTCGGTTTTTCTTTGACGACA ATTTGACAATTGAACAGCATACCGATTGATTGAAATGTTGTTGTTGATCG TATATAATCTGgtagagaaaacaaaaaataaaaataaaaggtgATGATAT AAACTTTATAAGTTATTTGGTGAATGGAGACATTCAGCAAATGTGACAGT TTCTTATGTAAGAAAATAGAAAGCCTTCaggtttttaaatgttttgtaaG GTTTAATTAAAATACCTGAATGTGCTTTGTAGCGACTTTGAGTTCGGAGT AACACAGTGACAATTGTTTACGAGTCATGACAGCCAAATGACAATTGATC GTTGATTGATATCTAAAATAACAGAGTAAAATNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTTTTCTT TGTAGCTTATGCAACTGAGGTAAAATTACAATTGCtgctatcttttttta aacactaATAAAAAGCCAGTACACTGTTAAAAAAGGCAGGAAAGAAGTCT CACCTTGATGATTGAAAAAGTGTACAAATTCTCATTTCATCGAAGCCAGC CAAATCtcgtttttaattttcacaactGTAGTGGCAACTTATTGGGAAGC TAATACATTTAGCAGAAAAATCATGCTATCATGAATACAGAGATAGCGCN AAGAAGCTGATGCAATAATCCCAATGGCTGATGCAATCGCGCGCGTTTTT TATCCCGGTGTTTACTCGAAAAGAAATCCGTGCAAATATNNgtggaaaat tttacctatttgaatgctcagcttaggctgaccaattataTAAAGTACGT TTCCCAGCTGTTGTCTAACGCATCTCCGAAACAATGTAAAATTATTTGCT CCCCGTTCTGTTTGCTAAGTTTTTTTCCTACCTCAGAATATAGTGCCCAA GCCCTGATTTTTTGGTAACTTTCATGGTTAGAAAGTGGACAAATCATAAT AACACATAAAGCTTTCAtggcaaaaatatcaataacaagttaagaatatt ttaagactttgttGACTCtgaaatatcaaatatcttCGCAAagtgcacaa aaatactcacaaatggttaaaataagaacattttaggcttaaaactcatt aagataagaacatccgaaaggaaaattttagattttcttataaaaaaacc gtgTACATACAATATTTTGAGCTAACCAGtcattgaaaaataaatctCCT ACACAAACTTTTAATTTTACTGTATATGCTTCttgaatttttcttgaaaa ttcgTCCTGATTCTGTGGGCTAAACTTAGTAAGTCTTAGCTTATAGCTTT ATCAAAACTTAATTCAATAAAAAGCTTGTTACACTATCAAAACATGTTTT AGTGTTTATAGAAAACTTTTGCTTAATTTATGTGAACgcgatttttataa gaacgtcgaaACTCTTTAAAGGCTTTTAAgggttttaagtctaaaaatgt ttttaaaatggaattattttgaaaatgttttttcctaagcaattcttata tattttgttcttataagtaCTATGTAAGTACAGTAAGTTCAAGATTAATT GCTCTGTCAAAACAAAGCTAAAGATCTCAGTTTTGATAGACGGTCTCTTG TCACTCTTAATCTAATTGGCTGATTGACAACcgttatgacgtaatctttt acaCAACAAACtttattaaacaaaaaatagAGAGAAGAGCGCTGTATAAA TCATATCTCCTCTATTGAGACTCGCATCAAACTAGCAGTTGGTTTTGATC TAGCAACATCACGAATACTGAGATCTTATACTTAGAATCTTGACTTAACA ACAAATCGACAACCAGTAATCATGTATACAAATTCTCCATTTGTAGCTAT CACGCCATTCGAAGCTTTATGTGGATTCCGACCAGCTTCGGAGATTTTGA GTTATTTTCACGAAGTCGAAGAATTACTGTTTGTGGTTGGACAAAAAGCT GTCGATGAATTGATCAATGCTGAAATGGCTACTGGTAAGTCTGAATAATT TGAAAGCTAGGGTTTGAAATAACGGTCAAACATCGGACACCCGTGCCAAA TAGCTCCTTGTTCGACCTAGAAATCATAACCATCAAGCGATCGGACATAT ACTGCCCAACCCATTTGAAATTGTTAATTCGAGCCATTAAAGCCATTTTA GCTTTAGAGGAAACGGCGTGTTGGTTTGCCCGTACGTTGGTATTAGCCCT TTTTTGTTTGACAGACTTTACAAATGACTCGCAATTTTAAAGCTGGTCCC AATGACAAATTTCTGCGCTAAATGTTAAAATCTTTTAGGACTGgcagttt gtttttgttggatTAGTAACCTTGATAAACGTAGCTaaacaaagttttca aatttgaatataaGAAAAATCTGACCTTAAAGTAATCATTTGTTCAGTAA AAAATGCAGAATAGcaagaaaaaataaagataaaatcttACTTTAGTTAg taaatcatttttatttaatGGCTTTTACGAAATGAAAACCGCAAAACAGT GCTTGAAAtaagtcaatttttgaaatacacGACATAGATCCAATTTTGTT GGATGGTCAGCATAATTCAACTCCAACGGAGAAAAAGAGTCCAATAATTC AACAGTTTTTTGAGTCGTGCTGATTATCACGCACTAGAAACGTGATCTTT ACTTTAATGTTTGCTAGAAAGTCAGAGTAGTTTTTTCAATTTGTCAATTT CAATTAAGCTAGAATCTGAGCAAACGTCTGTATATCTAGGTGGCTGTCCC CTTCAATACTCTTAGGATTTTCCAGAAATCTCCGCTTTGCTTTGCACtcc cttttttttctttaggaGTAATTTTGATATACcttattacttcgaataaa cgctccGGGTGTTTATTAAATTGTTTGGAAGAGTACAGTTATTGTTGTTT ATCTAAATTTTCCTTCTTAGTTACTTCCTTACAGCTACTTGTTTCTCCTA GCTCATTAAGCCTCCTTAATTATTAAGCTTCTTTAATTAAAGGTTTGGCA AGATTTGAGTACTACTTAGCTTCCTTAATTAAACCGCTAAATGGCATATA AATGCTCAGTGAATTAAACAAGAGAAGCCCTGTTCTTTAATGCGACAACA AAATGAAACAATTTCGGACATGCCGGATGGTCTTGATTTTTGATCAGCAG AGGTTTGGCAAGATTTGGGTACTATTTAGCACGGGTCCCGGCGTGACGTT TCAAGTCAGGTGgttataattttgaaaacaaatgtcACCTACTGGTGATA ATATCACTTTTTGTACCTTCTAAACACCATAAAACGCTCTTTAATTGGat aaaaacaggttttcgaCTTAAAGACTTAGTCGGCCGCATCATTCCATTTG ACGGAACCTATATTTAGAAATGCTCTGGCTTTGCTCCTTTGCCGTTGAAG GGAATCTCGTTGTAGATTCTCTCCAAGGGCCTTTATTTAATTAACTTGTa ccaaattttattattttgatttaaaggttttacttttacataagtgttcc tgtttcatatcagacacatatttcataccaggacagtgtttgcctattgt tatattgtgctgatataagcaaaaaaactgtttttcttttcccttttccg actaatatttctccACGTCTGTGCCAATTCAATGTGAGAAAGCTTCTGAA ttaaaaattgatgagtaagcaaacgatatcactcttattcaaaaacaaaa cctttaagcatACGCGATATTAGAGTTTGTAAATTGCTTCACTGTGGAGA CTTTGTTTAGAAGTTATTAAAGAACTTACGGATAAAAACAAACTCGTAAT AAGGTGGTTTGCAAGGAAATTACCCTGCCGCATATGCGTCGTCAATTATG AAAGTCCCTGTGACCAAAGATAAGTTTAAGTTTCCTTGAATATTGATGAG TTATGCTTACGGTTATGGTTAATCATAAGATTAACTTCCTATTCGGTTCG TctaattctaaaaaaattagGGAATTACACCAATGCTGAAGCTAGCAACT TTAACATCATGATTTTGTTCATTAATGAGTATTTCCTTTGACTCATATTA CCATTTATTAACCTATGTGCtttctaaagaaaataaaatctttgaaatga aTTTGTTAGACTTTGTAAAGTATTCATGAGTCAGTCTATATTTGAGGCAC tgtataagttttttttttgcattgttcAACGAATCAAATTAGAGTTTCAC TATCATTCATCAATATGCCTTGGAAAATATTTAGGGCTTTCAGACAGTCT TTCGGCTGTTTTTATTTCAGAATCCACGGTCTGTCGGCTCGGCTAATTaa gaactgaacggaacatcgAAAGGAGAGTGGATTCGaatagacgatcctat cgtctagacacaagatcactaaaagaGGGAATACAATTTTTAGGaagcgg gataaatttgaaaatggtggTTAGCCCGGAGCGGAGTAAGCAGTGATGTG AGagaggtgtttacagtgttaACGTTTGTTGCAAACTCTACCGTCGCTTT TTTCCCCCATAAACCGCCCTGACTCTGCGTATATATaatttcccgcgttt actgaccctctaaacggatgatagcatcgtctaggaCTCGAATCGATTCT TTTACTCACATATGCTAACataggaaaagaaaaaagagaaagaaattgGA TATGACATACAGAAGGATTATTTGAAAGGTTGCATAAGTTTAAAAGTAAC AACTTAATCCACAACTGTTTTATACGAGGGCTTTATGTATGTAGATTTAG AGATTACATAATTCGGATCTcggattttgtttattttagcaACAAATAAA TGTTGTGTCAATCTACAGTGTCATACGGTTAAAATTTCCTCATATTTTCC TGGCTTTCTAGTTTTGATGTCTTAGAACTGGAAAAACCTGTTTTACAAGG TCTGAGTGTTGTGTAAAGTTTAATTGGGCATAAATGAAGTGCCGATATTT GATTTAAGCAATGCGAAGTCTCACATTTCAAGCTAGAGGCATTTTGCACT CTACAGTATAAAGCTTATCAAATTTCATATTCCATCAGCTTGTTTATAAG ATATCCGAGATGGCGGTATGCAGAGCTGGGTGACCtcttcgaaaactttt tacgcCTCTTATACGCGATCTGTCAAAGTCATTAATTAAGTTGACTGATA GACCTGGTCTTAAATTGCAAGTTTACTTCAAGGgactaaatctttttttg aattacagaaagattcgaaatatAGAAGTTCCAGTTTTCTATAAGGTAAA CTGTTTTTTCGAATCCagattattatccatatagcggtcattaagtaagc cattaaagattcgaacggcgggcggtattgagatattctatgactcaaat agtcatacccgcgctgagaaaactaagacgtcgcgcttcagagggctgaa acataattaaccgccctggttatagggcgataacgtcatttgcggcccgc tcggaactttattgaagtcgttgcattgaagcgaaaagactaaactgacg tcagaaaaaaacactttttggtcatttgcggcccgctcggaactttattg aagtcgttgcattgaagcgaaaagactaaactgacgtcagaaaaaaacac tttttggtcatttgcggcccgctcgcaagggtactcaaaacttgttAAAG CCATTGCAAACCATTgcttcgcgtcgggcccaaatgacactctcgggcta ataatcaaactgcgcgggcagaaaataacaacaacgacctcaaactgaac gctattgttatattaaatTTTATAGAACGGATATTTTCGAATATTCAAAA CTCAAATTACCATTTTCAGTCGTGACCTTGCAAAAACTAATTGTTCTTGA TGACAGTATTGATTACTTGATTACTTGATATCGATTAGTATCTGCCTCGG TGATGAAAGTAAAGATGATTGATTGATGTACACGTGATGGCATTAATATA GTacttttttgatcaaattattGGAATCAGTTCTATTCCAGTGTGGTTTG CCTCACTGATGGAAGGCCAATCAGTGAAGATGATTGGTTTATATGCCTTT GGTATTAATATAGTGATTTTTGATCAAGTTAGAATCAATTCTTTTCATGT GTGGTCTACAACATGTTTACGTAATGACTATGTAATTGTAAGGCTGGCTG AACGATTATGTAACTGTATGATTGAAACTATTTTACAGGCAAAGCTATTA AAATAATCTGTATTAACCTCTTAAACCAAGCTTATAAATTCAGTAAGTTT TGCATCTAAAGTCAAGGATGAACTTTCTTTACATACCTTTTGATCCTTTG CTTTGATTTTTGAGCATTATTAAGCAGGCGCCTTATACCATTCCTCAGCT TCTTGGTTAGACCCGGCCTCTAAAGGTCGAATCTACTAACCACTGCACCA TAACCGTTGCGCTGATCTATGACCATTCAGTGATATCTATTAAAACAGTT TCGCTGCTCCTTTGAACTGACTTAGTTTTACTAGACTGAAACTATGATCT ATGTCAAGTATCATTCTCATGTTACATGAGCACACTGTAGGGTAGTTAGA AAGATTCCGGCTAATTTGATCATGTGTATAttgatatattttgattttga agattttttctttggCTGGATTCCAAATTGAGTCAAATGGTCTTATAGAA CTTATAACTTATTAACTAACTGATGCAtgattaccgagtttatgtatgtg tgttttccagcgacggagacggtaaggttctaatttgactagatcctgac cagctgaggacgacggtaaatcagcacttttaccgtcctcgattttgcNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNtttt accgtcctcgattttgcggggcagaattgcgggtttttccaaatcgcttc agtcactctaccgtcctcaaaagtgcaaatacataaactcggtattgtcG TCCATACGGGCGGCATGAAATTTAAAGTTCTAAACAATAAATcaaagtct ctttcttttaattcGAACAGGCTCTGATATCATCGAGCACTCTCGGCAGA TAGAAGAAAATAGACTTGTATAACTTATTAACTAATAAAAAGATTATGCA CTACTTACTCCAAATATCTTTTAACAGATAAAAAGGCGAAGGATGAAGCT GTACGCCGTGCTATTAAGGGCTGCCTCTCGCAACTCATGGCGTGTGATCC AAACACCATCAAAGAGCAACTAGCAAAGCTGATCACGCGGTTGAACGAAT GTCATAAGAAACACGAGGATACTAGTCTATATCTTGGTAGGCTCTTACTG AGAGTCCATTCACAATACCCAGGCGATGTTGGATGTTTTGTCATCtattt tttgaattatataCAATTGGAACCGTTTGAATCGATCTTCCTTGGACCTG ATGTCCCACACGCTTATATCTACGGAGGTATGTATGTTTACCAAGTAATG AAAACTTATGGGGTGTgatcctacacgttttttttataagaacatccaaa atttttgaagccttgggatgttcttaactttttgaattttaagcctaaag ttcttatttttactgttttttgagcattttacccattttcctaaaaaatc ggaTGTTTTCGAGTCCGAGAagccttacaatgttcttaacttgttcttaa cattttggccatcgaagccctatgtttttatatagtttgttcttataaaa aaaaacatgtactttaAAAGTTCCGGAAAAGGTTGTACTGTATCCAGAAA GTCTGATTAACGTTCAATGTTCTTCTGGCTCCAATAGATTGTTGTTTCAG CAATGCAATAAGATACAAACCagatattctggtctgtaaaattcaTAGTA GAGATGCGTGGTCGaaccaaaattttacaaatcatCTCCAACTATCCATT GATGTACCTTTGgtcgaaatttcaaatcatAGCACTTGTCATtcaatatt gatatttttaaaggttttgctttttaataacatggtttcagcccactttt caggtgcccccattgagcatggtgcccccagcaatttaggttcccttgag aaattgctttgagttaggtacccccattcagccaaaaaattttttttgga attgacactttttgttcttttgtcattcgtaaaatcttaatgatttttgg ggtggtttagtaaaaaaattcaataatttgaaatattttgaaatattcga NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNtcctccatcaagacagctag gtacccttaatgaataggtaaccccaaagaattgcaaggcattagccccc ctctactaacctggcctaNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNaaggttttgcttttaaataagagtggtaTTGC tttcttactcatcaattttaattcataagctttttcacattggattgaca cggatgtggagcaagattggtcagaaagaggaaaagaaaaacattttgtt gcttatatcagcataatataacaataggcaaactgtcctggtatgaaata tgtgtctgatatgtaACGGGAACACTTACAtagaaataaaacctttaagg ggACCTTGAATTTTTCGCCTCACAATTCAGCAACATCTTGTTTTCTCCTC CCCAGATATTATTGAGTGTATGGCGAACAGTGACAATGTGGTGCGTGCTG GCTTCACACCTAAATTCAAAGATGTCGATACTTTAATTGAGATGTTAGAC TACAAACCACAGACGGTAGAAGAAACGAAATTNCAAATTCAAAGATGTCG ACACTTTAATTGAGATGTTAGACTACAAACCACAGACGGTAGAAGAAACG AAATTCAAACCCACCTCTTGTTCAGATGATCCACATGTCTCGATTTATAA TCCACCCATTGATGATTTCTCTGTTAAAAAGATCCAGGTAAGTgagacaa aatttcttccactgacctttatttatccctggaccaagctatatccgcca tctttgatcggagtttttttgtaatggtacccgagaagaagccattgcaa tgttaaaaattaacatctaaCGGCGCtatatcatcaaaagtattcaagga aaagtagatctagcgctctcgatgcttTTTCACCGCCATTAGGGtacaga tttcaaaaaaaactccaatcaaagattatTGGTTGGCCGGGATTGATTAA CCACGCTTAATCGAATCTGTTTGAGATAAAATGCCCGTGTGCcaagattt tgtttttgagtatttttgtttttgttttactgACCTGAATTTGACTTTGT AATTTGATTTCTATATTTCATATCATTTAGATTCCAGCTGGAAACGCGTC CGAATATGACGTCCAATCCGTTAAGGGGCCAAGTATCCTACTCACATTAT CCGGACATGCTGATGTTCAGTATGAAACCGAGGCTGGTTGCCTAGCAACA TCACGTGGATCAGTATTTTTCGTTGGCAATGGTGAGAAAGTGAAATTAAC AAATATTTCTTCGAATgaagaattattgatttttcaagcttATTGTGATT TGGTATGAGATGATTTTGACTTGATCGTTTTATGATCGAAGATTGGACGG ATTTTTATCGATCCTATGTTGTACAGGTAAAGACTGTATCAAGATTCGTC CTAAATTATTGTTGGTCTCATTCCGCTCGGGGaatcttaaaattcaaaat catttttggtgATGCTAAACAATTTATAAAGTGGACTCTCTGTGGAGAAG GCTATGTTTACACTTTGTTGTTGACTTTAGGCTAAATATACATGTGTTTG TTTGAGGGAAGTCAACGAACCATAGATTTCTTATATAAATAGATAAAGAG CTTTTTTATCTATTCCAAGCCAAGgtaaagcaaaataatgcgccatcttt gctgatAGTAGACCACAGTATAAACCTTGTTTTTCacttttgaagtattt tgacactgcaatgacttcaaaatttcaaggaacTAAAGCTCAATTGTGAC GTTACTTCATTATTTTGCTCCAAATAGGGAAgaaaagctctatctagtgt tttgtTTAAGATATCTGTGCAACGAACTCGTATTTGTAACATTCTTAGGC CAGGGGCTGTTCTTGGGTCGTCTCTTTTACAGGCCAGGTATAGTATTCTT TGCTATTATGTGATATGCTCcctcaaccaataagatttcgTCATTTTGAG GGGAAGATTTCGTCATTTTGAGGGGAAAACAAagacttttttgtttactg ATTACACCAGAGATTACACACACCTGgattttagtgagttaaacctaGCA ATGTTCTGCTTTCATCCAGAGTTTCTGTCGTCGatggaaaattattttat agTGATAACTTTAAGAACCGGTATGTTCGGTTCTATCAATCCACAAAATA TACATTGTTCATTTTAATCACTATATAATTGAaggaatatatatttttgt acgttattttcattttcaagatttgtatatattatttttatcGTTATTTG TAAGTTGGTAGCAACaagtaattatttaaaaaaactgcttaagaattttg ttgaagaaaatattttttaaatggattttttttgtgtgtaaaaaaagatt atttcgaatttattcgcgctgtgatactcacggtaatgaAAG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_001185XLOC_001185Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00002239-exon-sc0000019-1491911889:286600..286837TCONS_00002239-exon-sc0000019-1491911889:286600..286837Clytia hemisphaericaexon
TCONS_00002239-exon-sc0000019-1510915933:286600..286837TCONS_00002239-exon-sc0000019-1510915933:286600..286837Clytia hemisphaericaexon
TCONS_00002239-exon-sc0000019-1575043694:286600..286837TCONS_00002239-exon-sc0000019-1575043694:286600..286837Clytia hemisphaericaexon
TCONS_00002239-exon-sc0000019-1491911889:290953..291000TCONS_00002239-exon-sc0000019-1491911889:290953..291000Clytia hemisphaericaexon
TCONS_00002239-exon-sc0000019-1510915933:290953..291000TCONS_00002239-exon-sc0000019-1510915933:290953..291000Clytia hemisphaericaexon
TCONS_00002239-exon-sc0000019-1575043694:290953..291000TCONS_00002239-exon-sc0000019-1575043694:290953..291000Clytia hemisphaericaexon
TCONS_00002239-exon-sc0000019-1491911889:291345..291469TCONS_00002239-exon-sc0000019-1491911889:291345..291469Clytia hemisphaericaexon
TCONS_00002239-exon-sc0000019-1510915933:291345..291469TCONS_00002239-exon-sc0000019-1510915933:291345..291469Clytia hemisphaericaexon
TCONS_00002239-exon-sc0000019-1575043694:291345..291469TCONS_00002239-exon-sc0000019-1575043694:291345..291469Clytia hemisphaericaexon
TCONS_00002239-exon-sc0000019-1491911889:293590..293866TCONS_00002239-exon-sc0000019-1491911889:293590..293866Clytia hemisphaericaexon
TCONS_00002239-exon-sc0000019-1510915933:293590..293866TCONS_00002239-exon-sc0000019-1510915933:293590..293866Clytia hemisphaericaexon
TCONS_00002239-exon-sc0000019-1575043694:293590..293866TCONS_00002239-exon-sc0000019-1575043694:293590..293866Clytia hemisphaericaexon
TCONS_00002239-exon-sc0000019-1491911889:307596..307733TCONS_00002239-exon-sc0000019-1491911889:307596..307733Clytia hemisphaericaexon
TCONS_00002239-exon-sc0000019-1510915933:307596..307733TCONS_00002239-exon-sc0000019-1510915933:307596..307733Clytia hemisphaericaexon
TCONS_00002239-exon-sc0000019-1575043694:307596..307733TCONS_00002239-exon-sc0000019-1575043694:307596..307733Clytia hemisphaericaexon
TCONS_00002239-exon-sc0000019-1491911889:312877..313176TCONS_00002239-exon-sc0000019-1491911889:312877..313176Clytia hemisphaericaexon
TCONS_00002239-exon-sc0000019-1510915933:312877..313176TCONS_00002239-exon-sc0000019-1510915933:312877..313176Clytia hemisphaericaexon
TCONS_00002239-exon-sc0000019-1575043694:312877..313176TCONS_00002239-exon-sc0000019-1575043694:312877..313176Clytia hemisphaericaexon
TCONS_00002239-exon-sc0000019-1491911889:314455..314736TCONS_00002239-exon-sc0000019-1491911889:314455..314736Clytia hemisphaericaexon
TCONS_00002239-exon-sc0000019-1510915933:314455..314736TCONS_00002239-exon-sc0000019-1510915933:314455..314736Clytia hemisphaericaexon
TCONS_00002239-exon-sc0000019-1575043694:314455..314736TCONS_00002239-exon-sc0000019-1575043694:314455..314736Clytia hemisphaericaexon
TCONS_00002239-exon-sc0000019-1491911889:315130..316441TCONS_00002239-exon-sc0000019-1491911889:315130..316441Clytia hemisphaericaexon
TCONS_00002239-exon-sc0000019-1510915933:315130..316441TCONS_00002239-exon-sc0000019-1510915933:315130..316441Clytia hemisphaericaexon
TCONS_00002239-exon-sc0000019-1575043694:315130..316441TCONS_00002239-exon-sc0000019-1575043694:315130..316441Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000019supercontigsc0000019:286600..316441 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
13.4616 12.0394 18.7295 18.3201 20.423 14.0129 40.3903 44.7379 14.6541 19.4413 26.2897 17.5102 16.4421 18.9804 12.4534 13.0091 17.5137 24.267 26.2141 19.2794 32.39 33.2906 20.0926 26.3176 27.2441 34.5063 16.1891 16.682 11.9446 9.7339
Blast
BLAST of TCONS_00002239 vs. Swiss-Prot (Human)
Match: MPI (Mannose-6-phosphate isomerase OS=Homo sapiens GN=MPI PE=1 SV=2)

HSP 1 Score: 298.516 bits (763), Expect = 3.974e-91
Identity = 157/323 (48.61%), Postives = 200/323 (61.92%), Query Frame = 1
Query:  283 KFFSLECAVQNYHWGKFGEQSTVASLGRMQKNFNFDAE-KHYAELWMGDHHRGPS-IVQNMSEPTTLTQLLQNNPSLVGENIIKRFGKANLPFLFKVLSVETALSIQAHPNKEHAEILNRTRPDVYQDDNHKPEIAIAITPFEALCGFRPASEILSYFHEVEELLFVVGQKAVDELINAEMATDKKAKDEAVRRAIKGCLSQLMACDPNTIKEQLAKLITRLNECHKKHEDTSLYLGRLLLRVHSQYPGDVGCFVIYFLNYIQLEPFESIFLGPDVPHAYIYGDIIECMANSDNVVRAGFTPKFKDVDTLIEMLDYKPQTVEE 1245
            + F L CAVQ Y WGK G  S VA L          AE K YAELWMG H RG + I+ N     TL+Q +  N   +G  +   F   NLPFLFKVLSVET LSIQAHPNKE AE L+   P  Y D NHKPE+AIA+TPF+ LCGFRP  EI+++  +V E  F++G +A   L    M+ D     +AV  +++ C S LM  +   + EQL  L+ R+++      +     G LLL++H QYPGD+GCF IYFLN + L+P E++FL  +VPHAY+ GD +ECMA SDN VRAG TPKF DV TL EML Y P + ++
Sbjct:    5 RVFPLSCAVQQYAWGKMGSNSEVARLLASSDPLAQIAEDKPYAELWMGTHPRGDAKILDNRISQKTLSQWIAENQDSLGSKVKDTFN-GNLPFLFKVLSVETPLSIQAHPNKELAEKLHLQAPQHYPDANHKPEMAIALTPFQGLCGFRPVEEIVTFLKKVPEFQFLIGDEAATHL-KQTMSHD----SQAVASSLQSCFSHLMKSEKKVVVEQLNLLVKRISQQAAAGNNMEDIFGELLLQLHQQYPGDIGCFAIYFLNLLTLKPGEAMFLEANVPHAYLKGDCVECMACSDNTVRAGLTPKFIDVPTLCEMLSYTPSSSKD 321          

HSP 2 Score: 92.4337 bits (228), Expect = 1.337e-19
Identity = 48/122 (39.34%), Postives = 72/122 (59.02%), Query Frame = 2
Query: 1259 FKDVDTLIEMLDYKPQTVEETKFKPTSCSDDPHVSIYNPPIDDFSVKKIQIPAGNASEYDVQSVKGPSILLTLSGHADVQYETEAGCLATSRGSVFFVGNGEKVKLTNISSNEELLIFQAYC 1624
            F DV TL EML Y P + ++  F PT   +DP++SIY+PP+ DF++ K ++P G+ +EY V ++   SILL + G       T    +   RG V F+G  E V L  ++  ++LLIF+A C
Sbjct:  302 FIDVPTLCEMLSYTPSSSKDRLFLPTRSQEDPYLSIYDPPVPDFTIMKTEVP-GSVTEYKVLALDSASILLMVQGTVIASTPTTQTPIPLQRGGVLFIGANESVSL-KLTEPKDLLIFRACC 421          
The following BLAST results are available for this feature:
BLAST of TCONS_00002239 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
MPI3.974e-9148.61Mannose-6-phosphate isomerase OS=Homo sapiens GN=M... [more]
back to top