Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00002231 (transcript) - C. hemisphaerica

Overview
NameTCONS_00002231
Unique NameTCONS_00002231
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length2478

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00002231 ID=TCONS_00002231|Name=TCONS_00002231|organism=Clytia hemisphaerica|type=transcript|length=2478bp
AAAAAACCTCAACAACTATATGTGTTCTTATGAATGATTTCAAACGCTAT
CATCATTTTTAGCAGCACAGATTAAACCCACAACAAATATTGCCTCGATT
ATCTTATTATCATATTAAAAGAAAAGATGTCATACAAATTGGGTTATCAA
GGATACCGTAAGATctgattaaaaaagtttttccttcATGAATAAGAAAg
caatcattaaaaaaattcctcTTATTATCGAAACTTATTGCTGCATTGCC
AGTAATGAATGTATTAATCAACAACATCAATCAAATTGGGATGACAGGCT
AGAGATGAGCATTAAGTTTTGATGATACTGAGAGTTGATTGAATATGTTG
TAATTGATAACAAATCTTAAGGATACAAAACACATAACTTGATCGTGGTA
AAGTAATAATATTATGGTTTAAAACAATATTGAGAAGAAGGAAATTTTAT
AAACTTTGTTGGAttggatcaaaattttaaacaagacACGAGGGTTAAGA
TCCCGTATATATAACAGTGGAGCTTGGCGCGTTTATTCGGTCTACTTTAC
AAAAGCGAAAAGCCCTACAAGTTATACTGAACTATGATTTAAAGTGAAAA
CGTAGAGGCTAGTGGAAGTGTGGAACTTCTTTCAATTTGAAAGATGGCTT
TTAGTGATATCCTTTATCCACCTGGAGCCACCAGGCTAAACCATAAAGTG
GCTGCtgcactttttctcatcttGttTTCAACACAGATGACATTAACTTC
ACCATTCTCATACCTACCAGCTATGGTTTCAagttttggtTATTCCGACA
GGCAAAGAGGTACTTATGCTGGCATGATTGCATCCTCCTTGTTTGTGGGA
AGATTCTTTGGAGGCTACTTTTGGGGCTGGCTGACAGACAAGATAGGGCG
TCGACCTGTTCTACTCATCTCTGCATCTTTGACATACTTCGCCACTATTG
CTTTTggattttcaacaaatttttattttgccgTTATTACAAGATTTCTT
CAAGGCCTTTTTAACGGTGTTATCGTATGTGGCCGAGCGGCTTTCGCTGA
AATATGCGATGATACGAATCAAGCTATTGGAGTATCACTGGTCTTTGCGG
CATGGAATTCAGCCATTGTCATTGGACCTGCCTTAGGAGGTTTCCTGGCT
CAACCAGTGATGAAATATCCTAACAGTTTCAAAGgTTCAGCAGCGACATT
TTTCACGAAATTTCAGTTTCTTTTACCAAGTATATTGGTTGCTGGTGTGT
TACTTATCTCCATCATATTCATTTTCATCGTCGTCGAAGAAACCAAACCA
ACAAGTCTCTTGGAAACATCAGACAATGTTCACCTCTTATTGTCTGAAGA
TAATGAAAAcgaaactgatgacgtcatttttatgaaagaAATGTCATCAT
CTGATGAAGAAAAtgcaaaacaaaagaatgaaaGAGAAACAATAAATGAT
ACAGAAGATGAGCAACAACAAAGAAAGAACACTAATAACAAAGAAACGAA
ATGCAACCCATGTACTTCCATCAAATCATGGTCCATTTATGAACTTATGA
CCGATAAAATAGTGATGCTGGTCATCATAATGTTCGGAATATCGGGATTC
TGCATCATCGGGTTTTCGGAACTCTCCTCGTTATGGCTGGCTACAAAAGT
AATATATGGTGGGCTTGGATTTACCACGGATAAGATTGGCATCACACTTC
TGGTACCTGCTATTGTAGCCGCTGTTCTTCAACCCATTTTGTTTAGTAGG
TGTGAAAGACGATTTGGAGGAATTATCaCTGCTCGCATATCACTGGTCAT
ATTGTTTATGATGACAGCTATGTATCCAAACATTCACAATGCCTATAAAC
ATACTGCGTTGCTATGGACGCTTCTAATCGTCATGGGATTGATTCGGATG
ATTGCTGACATCAGCAGTCGATCAGCACTTGCCTTGTTCATCAATAATTC
GGTATATCAAGACCAGGCAGGTCGTGTCAATGGTTTGGCTTTCTCCATCC
AAGAAATTATGAGagtGGCATCTCCAACATTGTTCGGATCTATGTTTTCA
TGGTCCATCAATGCAGAAGAACATAAAGTATTTTTCCCGATAGACTATAG
ACTACCATTCATGGTTTTGTCGGCTTTTATTTTGGTGATCTTTACCATGT
CATTCTTCTTACCAAGACGAATAAACTCTGCTAAATTATCATATACAAAC
AACAAATTGGAAATGAGTGATACCGATAGTTGACTAGAGAAGAATTTATG
ATTATGGACTCGACGGGTATTggtcaggcccggcggaagcagtcttcact
tttgagaaaaataaactttttttctccaattcaTGGTGAATTCTATCCCA
ATTAGATCCTTTAGCCTCACCACTTTtatggttgttccgccgggGTCTGT
TTGTTTCTCTCTAATTCTAACCACTGTGATTCAAAtccttctgtaattcg
aactaaaacccATCAACCTGAAAATCgt
Run BLAST on NCBI

protein sequence of TCONS_00002231-protein

>TCONS_00002231-protein ID=TCONS_00002231-protein|Name=TCONS_00002231-protein|organism=Clytia hemisphaerica|type=polypeptide|length=529bp
MAFSDILYPPGATRLNHKVAAALFLILFSTQMTLTSPFSYLPAMVSSFGY
SDRQRGTYAGMIASSLFVGRFFGGYFWGWLTDKIGRRPVLLISASLTYFA
TIAFGFSTNFYFAVITRFLQGLFNGVIVCGRAAFAEICDDTNQAIGVSLV
FAAWNSAIVIGPALGGFLAQPVMKYPNSFKGSAATFFTKFQFLLPSILVA
GVLLISIIFIFIVVEETKPTSLLETSDNVHLLLSEDNENETDDVIFMKEM
SSSDEENAKQKNERETINDTEDEQQQRKNTNNKETKCNPCTSIKSWSIYE
LMTDKIVMLVIIMFGISGFCIIGFSELSSLWLATKVIYGGLGFTTDKIGI
TLLVPAIVAAVLQPILFSRCERRFGGIITARISLVILFMMTAMYPNIHNA
YKHTALLWTLLIVMGLIRMIADISSRSALALFINNSVYQDQAGRVNGLAF
SIQEIMRVASPTLFGSMFSWSINAEEHKVFFPIDYRLPFMVLSAFILVIF
TMSFFLPRRINSAKLSYTNNKLEMSDTDS
Run BLAST on NCBI

transcript from alignment at sc0000019:115775..127482+

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00002231 ID=TCONS_00002231|Name=TCONS_00002231|organism=Clytia hemisphaerica|type=transcript|length=11708bp|location=Sequence derived from alignment at sc0000019:115775..127482+ (Clytia hemisphaerica)
AAAAAACCTCAACAACTATATGTGTTCTTATGAATGATTTCAAACGCTAT CATCATTTTTAGCAGCACAGATTAAACCCACAACAAATATTGCCTCGATT ATCTTATTATCATATTAAAAGAAAAGATGTCATACAAATTGGGTTATCAA GGATACCGTAAGATctgattaaaaaagtttttccttcATGAATAAGAAAg caatcattaaaaaaattcctcTTATTATCGAAACTTATTGCTGCATTGCC AGTAATGAATGTATTAATCAACAACATCAATCAAATTGGGATGACAGGCT AGAGATGAGCATTAAGTTTTGATGATACTGAGAGTTGATTGAATATGTTG TAATTGATAACAAATCTTAAGGATACAAAACACATAACTTGATCGTGGTA AAGTAATAATATTATGGTTTAAAACAATATTGAGAAGAAGGAAATTTTAT AAACTTTGTTGGAttggatcaaaattttaaacaagacACGAGGGTTAAGA TCCCGTATATATAACAGTGGAGCTTGGCGCGTTTATTCGGTCTACTTTAC AAAAGCGAAAAGCCCTACAAGTTATACTGAACTATGATTTAAAGTGAAAA CGTAGAGGCTAGTGGAAGTGTGGAACTTCTTTCAATTTGAAAGATGGCTT TTAGTGATATCCTTTATCCACCTGGAGCCACCAGGCTAAACCATAAAGTG GCTGCtgcactttttctcatcttGGTAAGTAACTTTGGTAACTGATTTTT CCGGGTATAACAAcagccctgtctcacagcccctgtggaaatttttccca cagtggggatgatCTTGGAGTGCAATTCTTTCAAACAGGGGATGAAaata aagtcaattttccagtgggggtCGAAATCGTAGtgtattttttcccaccg gggacgcaATATTAgcgggtcccaccgggtctgtgatacaggggtgttta atAAACTAGAGAGCAACCGGCAGCTAGAACGAGGCGTTATATGTACGTTA CAAGGACGTTAGATAAACATCGTGTGCCAGCTTGGAGACTTATCTTTATA AAAACCCCTGTATCAGTGGCCCGGTCAGATCCACCCCAGTGAATAACCTG GTGCTAAAAATGACGTTTTTTAAGTCCCAGTAGGGGTAATGAGTAAACCC AGTTTTACTTTATTATAGTCAACCAGGTGGATTTCAAAGCACCAACCTTG GCGACCTTGGTTTATAAAGCACCAGTTTGATATGGAGATACAGAAGCTAA TataaggaaaaaagaaaaagccttTTTTCCTCCTTGACATTTGCTGTGAA CttaagtttttctttctttagttTTCAACACAGATGACATTAACTTCACC ATTCTCATACCTACCAGCTATGGTTTCAGTAAGTAAtctaaaatatcttt ccaattgTTTAAATCTCAAAACCTTTTTATCTAGTCTAACTTCTTGTCTA TCTATATTCTAAAAACACACGAGGTTGACCAGTGATACTTAGTTCCCTGT CGTAAAAACGCTTACCACACCCATTGGTTTATCTTTGGAAACAACACAAC ACCAAAAAACTAACAAAAGTTATTAATTTCTTACTTTTAGTAAGAAGtca ataaaattttaatgtaaaatccctgtaaaaacccatttttaaagatttta aacccCTCTCAACTTCGAAACGagtagaaattgaaaaaaatatttagccG TTTTACTCAGGACCACATAGGGTCTCAGTCTGGGAGGGGGATCAGGCAAG TGAAGGGTGCAGGTATGTCTATCCAACTAACTTTTTTGTAGGCGAAATCA GGGTTGAAAAGCAGTATTgttactatatatacttttacttgagccCCGAA ACCAACGTTTTTAAAAGCGAAATCGGGGTTGAAATACCAGTATTGTCCTA CTTTCACTTGAGCCCCGAAACCAACCTTTTTGTAAGCCAAATCGGggctc aagtaaaagtatatatagagAGTTTAAGAGAATTTCCTTTCAAAATGAGA TCATAATCCATCGGGGTTACCCCCAATCAGGGCTCAAATAAAACTAAGCC TAAAAACATGAGAATATCAATCTCCATTAAGTTTTggtccattattttta ccccccccccccctggctgaaaAAGTACTACCGGGtccgtgagaaggggg tgttatgtcaaacgtgtttttacgttttttttattttttagagttttggt TATTCCGACAGGCAAAGAGGTATGTAATACAATGAAAcgatttttttgta agaatatcaAGAAACTCTTAAGCCTTCGGTTGTTACTAcctttttttcag ttttaaagcGTTCTTGTCTTAGTATTATAGGATAAAGCACAGAAGCGCTG TTAAATGCATCTTGAACTTTCACTTTTAATTCACAATACAGGTACTTATG CTGGCATGATTGCATCCTCCTTGTTTGTGGGAAGATTCTTTGGAGGGTAT GGATGATATATTATTTTAAACGTATGATCTCCCTAATCCAATTGTTCATA ATGAGCTCTTCCAAAAAGAATTGTACATGGGgtgtggaggatatattgga tattttgtccgggagtagtgaaaaatctgcaaaacttGCTTTATTTTAGG GACAAACTTGCTAATAAGGGGTGATTTTaaatgtccgggggtaaacCGAT GCTTGTTGGGAGGGAGGGGGTGGTGGGAGTGAGATatgttgtccgggggg taaatttccaaaaaaagttcgaTCCTCCAATCTAGCAATAATATTAGGGG AGGGGAGAAAAGGGGACTCCAAGTGCTTTAACTTAGGATTGGAAAATCCT CAATTGAACATCAgacgaccttaggatctcaggaacTATAAGTTCAACAA ATGGTCcaaaaaggctttaaaaatgtAGTCTAGAAGCCAAATCACCAAAA CCCATGAAATAAAGTAGAAAAACTGAAATCGCCATAATCGACCGAACTTT AAATTTCGTAAAACGAAAGAATACCCAGAATTCCTAATATATTTTGACTA TCATTAATTTAATATACTTTGTCTATTTTTCAGCTACTTTTGGGGCTGGC TGACAGACAAGATAGGGCGTCGACCTGTTCTACTCATCTCTGCATCTTTG ACATACTTCGCCACTATTGCTTTTggattttcaacaaatttttattttgc cgTTATTACAAGATTTCTTCAAGGCCTTTTTAACGGTAAGTCTCTCATGT TATttcctttttgtttattttagccTTTAAAAAAGTTATCAGTGCTCATC TTGAATAGTagtagtaagtctgcgaccacagtcgaaggctcctctttcga tagatattaatttatttaaaagaGTTGTTTTGATCAACGAGAATATGTAT TATATGGGAGAAAAATctctaaatctaaaaaattgaactttctCCTGGAG TGGCCACTGGACACCTGGAGGTAGTTTTTCAATCCCGGctaagcaaaata ttttgaccggagtatttttgaaagttgtatccgctagatctactttttcT TCCACACTAGTGATGTagtagtcaaatttttgacactacaATGGCTTTTT TGCGGGTACCACtataaaaaaaactccgatcaaagatggcggatatagct ttgtccggggggttaTAAAGGTCACTGGAGCAAGCTTCCTGATGACCTTA AAACTATATGTATTCAATTGAAAAACATATTTAATGTGTGGTTTGTTTTG CCTTTCTACTAAAAAGTTTCATTTGGTTAACTTCCATACCAACGTATAAT TGAATATCAAGGGAGACCTATTAGTTAAACCCTGGTACCATTGCGCATTG GTTGGCCACCATTacatttgaattttcaattgatTTCTATTTTGCCGTTA TTACAAGATTTCTTCAAGACATTTTTAACGGTGAGTCTTTCGTTGTGCGg tggactctcgctaattcgaatacacgttgttttttttaagaacctagTTT TACCAaacagcctcaatgtttcttaagaaatcggccttttgagccttaaa tgtttcttacatgtttctaaactttttgacataatcacccttatgaaagg ctggattggaaggttcttaaaaaaaccaaattaaaaaatgttattttctc attctcagcctcagcatgtttcttagatgttgcTTAGTGTAATTCTAAAA TTCAGTCCTTTCTAATCTTCAGGTCCAGGAAAGGGAAATCTCCAGTAAAT tagtctctttaattcgaatctctataattcgaacaaatcagacttcccgt tcgagttcgaattagcaagaGAGCCCAATGACCTTAGAACTATGTGCAAT TAAAGATATTGATACGCCGCTTTACTTTTtgaccaaaaacttttacttaa TTTGACTCCATAACAACACTTAATCACTGAACGAGGAAGAGCTATTTAAT TAAATCGTGGTAGAATTAAGTCACTTATTTCCACGAGGAAGCGATCAGTA ATTCTACTATATGCAAGATATCTTTCGAGTGACGCAATCGCAATCAACAG CACTAATAATACCATGCTTGTTTCTCTCAATTAAGCATCAAAATTAGACA TTAAtaagcacttttttataagcatgcaAAGATtgattaaaaattaataa aagtaaaCGAGGCAAAATTATTGACAACAATAAAATGCCCCGTAATTAGA ATCTTTAGTAAAATCTATTTTCCTGTGTACGGGAACAGCCAAAACCGGAT GTTTGTATCAAACAAAGTATTTTTACAAATATTACCGTAATGAGGTTATG CTATTTTCAAGCCAAAGAAATATGCTCTTGAAAACTTATcataaaacttt ttcaaccatGCCCAATTCAAACACAAAACCTTTAATCCTACAATCCGACT TTTTTTTGCCAGAAACGTACtgttaggttccaaataaacgggggttggaa aattttctagattttaataaacgggggggacctaattgccgggggggttg gaaattgtacttctgaaacccaaaaataaggtaaaaatagNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNgg gggggggcgtttatttagaACCTAAGAGTATATGCAATTAAAATACAAAA GCTAGCGCGATTCGAATGCGAAAGACTCTCTCCAGGCAGCGTGGCTCAGC CTaagatgttcataatttttgaCATTCTTAGCTTAATGCTCTCAACTGTA TGATTTATTTAAATGGCCTTAAAATCAGCTAGGTTTCACGTGAACAGAAC CAGCGGTGTCTGGACAGCGCTATGCATTTCTACTTCAAAAAGAAGGAATT CCTACTTCGTAAGAAGTGGAACCCATTCCACGTGGGCTAATATCAAAACC AGTTAAGATGTCGGTCGTCAAGGTGATTCTATTCAGATTTGACGGATTGA TTTTTGctaacttttaaaaaaattgtatttttatccTTCAGGTGTTATCG TATGTGGCCGAGCGGCTTTCGCTGAAATATGCGATGATACGAATCAAGCT ATTGGAGTATCACTGGTCTTTGCGGCATGGAATTCAGCCATTGTCATTGG ACCTGCCTTAGGAGGTTAGTATGGTATGAGTGTGACACAGTAGTGTAGTG TTCAGCAATTTTGACTGCCATTCAGGAGGTCGGGGCTCGATTCCAACTCG ATGttgtgattcacttggcaagtgaatgtaccttagTGTAACCCGGGCAA ACACGCGCAAGAAGCCCGTTTGTTACTGTGCCAACCTATTGAACACACCT TAAATCTAGGATGAGGTTACAATGCGCTGGCTTGTTCCCCTAATGATTCA GGCTGGATTAACGCACTCGGTCGCTTTTCTGAAGGTTTAATGACATTACT AAATTTCACACGCCAAATAGAAATCACATGAATCAGCCTTATGAGGTTTT CTTCGACAACTCTTTGCATAACTAGAGGGAGCCTTCTTTTTTTAGTTTAC TTCTAACACACTTTTCGTTTCTGTTTTAGGTTTCCTGGCTCAACCAGTGA TGAAATATCCTAACAGTTTCAAAGGTAAAAAGTCTATGATAAAGTAAATT ATTAAAGCACCCTTTTACATTTTGATCAGAATTCATCAAATACAAAACCA CAAGACAGATATACAAGTAGGAACTTGACATTAGCTGACAAACACCTGCA GGAAATATACTTTAGCTCCAACAACGCGCACGGCAAACGCGGACTTACTC GAGTTGTGGAGAACTTTTTTAAGGCATTGTTGACTAAAATGACAAGAAAA CTTGTTCTAGCTATAGAGGCTCGAATCATTGCGACTCCATTGTTCAACAA CCTCAactaataattttcttctttttataggTTCAGCAGCGACATTTTTC ACGAAATTTCAGTTTCTTTTACCAAGTATATTGGTTGCTGGTGTGTTACT TATCTCCATCATATTCATTTTCATCGTCGTCGAAGAAACCAAACCAACAA GGTAAATATACtgctttgataaaaaataatacGATCTAATGTTAGGAAAA TCTGACAATAGTTTTGGAGGGCCGAATCTATAACATTTCCAAACTTTAGT ACGCCAATTACATGTATATTCACAAATTTCTCTTTTCCAGTCTCTTGGAA ACATCAGACAATGTTCACCTCTTATTGTCTGAAGATAATGAAAAcgaaac tgatgacgtcatttttatgaaagaAATGTCATCATCTGATGAAGAAAAtg caaaacaaaagaatgaaaGAGAAACAATAAATGATACAGAAGATGAGCAA CAACAAAGAAAGAACACTAATAACAAAGAAACGAAATGCAACCCATGTAC TTCCATCAAATCATGGTCCATTTATGAACTTATGACGTAAGTGTAATTgc gtttttaaaggttttgtttttaaatatgagTGATATCGTTTCCTGACTCA TCACTTTTAATtcgcaagctttttcacattggattgacacagatgtggag caagattggtcaaaaggagaaaaagaaaaacagttttttgcataatataa caataggatatgaaacatgtgtctgatatgaagcGGGAGcgcttatgtaa aaataaaacctttaaaggtccattacacgtttttataagaacgcactata agaaaataaggcttcgatggtcaaattATTAAGAATAattagttaagaac attttaaaaggcTTTGCGGATACGTAAACACCTTATgccttagaaaaatg gacaaaaatgctcataaTATGGcaaaaatataagaacatgatGATGGCTA AGAACATATTAgcttaaaacaaaaagatttgagaactttcgaaggcttca aaattgtgggtgttctcataaaaaatgtaAAGTTTTCAGTTGAATGTTCA GTTACAAgaatatgaaatattttttgttataCTTCAGAAGTACAAAATAA GACTAATCTTACCTGTACAAGACATTATCTTCTTCTTTCACACACAGCGA TAAAATAGTGATGCTGGTCATCATAATGTTCGGAATATCGGGATTCTGCA TCATCGGGTTTTCGGAACTCTCCTCGTTATGGCTGGCTACAAAAGTAATA TATGGTATGAGTTATAAGATCTTCATTCTTTGTGAataatttgaatgaaa ataccTTTTAAAATTTCTTGCCGGTAAAATACCCAATAGATAATTACAGC TATTTTATTTGAATAACAGAGTCATGacaaatgtctttgaaaatcatttc aaaGATCTCATAATAGAACGTCAAGTAACCGATTTGACAGACTTTGACTC TTCAGACCTAAACATTGTTCCCTCTACATAGCTTCTGCAGAAAAGATATT GTGttaacccctgtctcacagcccggtGGAAATTTTTCCTACACAGCGGG GATGAAAACTTCGATCGAAATGTTAATGGGGATAACAATTCTATTgctcc aaagttaaaaaatccgGTGGGGATGGTTTCcgagtgcaatttctaaacaa tgaattttgaatggggatgaaatgaatgtcaatttctcagtggggcttAA AATTCTATGGGACgagatttttgccaaattttccagtggggctggggccc cagcgggtctgtgacacaggggtgtatgtgTTAAAGTTACAAACCAAATG AGAAATTGATAATCTGCTTTTTCTAGGTGGGCTTGGATTTACCACGGATA AGATTGGCATCACACTTCTGGTACCTGCTATTGTAGCCGCTGTTCTTCAA CCCATTTTGTTTAGTAGGGTAAGTTGGCTGTTTTTATCGACCATTGATTT CTGTAAGAGTAATCAAAAATATGTATTGTATTATCCGAGCGAAGAAATCG CAGTTTTAACCATAATAAAAATGCATTATAGTCAATTTAACCTCGGTAAC TCGAATGTCGTCTCCTTaacccaaaaagtcttttggtccccttagttaac aatgccttataaacctaaTTCCATATCtagaaatttccttaactcaaaca aatttgtgtccCCCGTGcgagttcgagttatggagattccgCTGTATGAC AAAAAACGCTGAGAATATAAAAAGAGAGGTTTCGGGAGCAAGAATAGGTC AATCCACTCAATGATTTGAATTACACAAAAAATTTTGACGAGACATCTTA CAAAAATCGCTAGCATTTTGTGGTCACGatacttttttgaatttagCCAA TACAAATAAATAACCTAAATCTAGATctgattttctttttacattttagT GTGAAAGACGATTTGGAGGAATTATCGTAAGTTAGTCACATCATCTATGA ATATTGCTATCTAGAGGTGACCAGAAACACAATCTNTGGAGGAATAATCG TAAGTTAATCACATCATCTATGAATATTGCTATCTAGAGGTGACCAGAAA CACAATCTACTCTCTAAGATTCGAAAATCGGAAATGTCTTTTTCTCAAAA GGCATTGGACCTAATTGAAGAAAAACATTGTGttccagaaaatgtccaaa tatcTAAGGGtcgtttttcgttttttttaacaCCGACATTTTGTTCTTAT CACCTGTCTTGCAAACCAAATTTAGCCCCCCCCCGGATTGGATAGCCTAG TTCAAtcaatatttcttttgttttctagaCTGCTCGCATATCACTGGTCA TATTGTTTATGATGACAGCTATGTATCCAAACATTCACAATGCCTATAAA CAGTAAGAAGATTTGACCCTGTATACGACTAACAATCCAACGggccaaaa tcacaaaaattcgGATAGTGCTTCGGTACCAAGCTGGCGCATAATCTGCG AAAGGCTTTTAATGAGTTTGTTTTATAGTAGGAGGAAATTTATAAAAtag ctcgatttttttagtcaaagcacttgttatacatttttggaaagctgagg ggcaggggaatcaaaataacttgggtgccctttttttccggacactttgg tgtgatttttggacaaatatgacggtctcaggcaaaaattatagagtcaa aaatcaatgaaaattttagcttgataaaatagagacctgttgtatatttt tggaaagccctCAGAAactaagattagagatatattgcgagtataggtga tttcaaataattaaaaaaaaataaaattgaaattaaaaaaatcgagcgac ctcaaaaaacgGACAAATTCCCCCCTACTATTAGGCGACCAGCTTCTAGG TTCCTCTCTCGAATTATtcggaaattttcattttcaatagaaatgttttt atttgattgttGAGCGCGCGAACTTGGGTTGTTAGCCgtaatacaccttt ttccgGTTAGCTGTTTCGTATAAAAcgtcaccaaaatttcgagtaaacca ACCATCCCATTGGCTAAAAGCaataacataaacaaaaacatgtGCAGAGT ATGAGAAAAATGTGCTTTCTGTGCTCTTACTCTGGACATATTTTTGCTTC TAGCCAATGAGATGGTTTGTTTActcaaaattttggtgactttttatacg aagcACCTAACCGTAAAAAGGTATATTACGGTATTATTCACTAGCAgaca aatctaaaaaaaatcttctatttgaaaaacaaaaactgcATTAGAGTTta agttatattttttggaattcatTATTTTAGGACTGTAGATTTCAAGTGAC CAAAACCACataaataatttcaaagttttagtCAATTTTAACTTTTCTTA CCTAAATAGTACTGCGTTGCTATGGACGCTTCTAATCGTCATGGGATTGA TTCGGATGATTGCTGACATCAGCAGTCGATCAGCACTTGCCTTGTTCATC AATAATTCGGTATATCAAGACCAGGCAGGTCGTGTCAATGGTTTGGCTTT CTCCATCCAAGAAATTATGAGGTAAGCGATTAAATTTGTTACTTTATCGC AGTTTCTTCTCTAAAAATTAAATAGAAAGACCATTACACAATTAAAAGAG AAGTTTGTTACGTGAAAGAAATTAAAGGGCTGTCTGGTTGTTACAAGGAC TGAGAAATACTCTTTAACCTAAAACCTCCCTCGGGATAAATGGCTcgctt ttcgatttttttcttatccctTCCCCGGACCTTATAATGATCCCCTACCC CCGTTTAAatcaataatgaaaaaaatttcatctgtCAAAAGAAGATTCCT CTATTTTTCTACAATGTTTTAGCCTATAAataccttctttttttttgcgg gGGGGGCGGGGCGGGGGAAGCTTTTAGAGTTACAATTTCGTACCCCGGCA ACTTAACTGTTTATCACACCCCTAAGAGTAATGATAaattaaaaacacaa aaacagttttgttttatatcataatttcttttctcctttttagagtGGCA TCTCCAACATTGTTCGGATCTATGTTTTCATGGTCCATCAATGCAGAAGA ACATAAAGTATTTTTCCCGATAGACTATAGACTACCATTCATGGTTTTGT CGGCTTTTATTTTGGTGATCTTTACCATGTCATTCTTCTTACCAAGACGA ATAAACTCTGCTAAATTATCATATACAAACAACAAATTGGAAATGAGTGA TACCGATAGTTGACTAGAGAAGAATTTATGATTATGGACTCGACGGGTAT Tggtcaggcccggcggaagcagtcttcacttttgagaaaaataaactttt tttctccaattcaTGGTGAATTCTATCCCAATTAGATCCTTTAGCCTCAC CACTTTtatggttgttccgccgggGTCTGTTTGTTTCTCTCTAATTCTAA CCACTGTGATTCAAAtccttctgtaattcgaactaaaacccATCAACCTG AAAATCgt

Coding sequence (CDS) from alignment at sc0000019:115775..127482+

>TCONS_00002231 ID=TCONS_00002231|Name=TCONS_00002231|organism=Clytia hemisphaerica|type=CDS|length=23850bp|location=Sequence derived from alignment at sc0000019:115775..127482+ (Clytia hemisphaerica)
ATGGCTTTTAGTGATATCCTTTATCCACCTGGAGCCACCAGGCTAAACCA
TAAAGTGGCTGCtgcactttttctcatcttGttTTCAACACAGATGACAT
TAACTTCACCATTCTCATACCTACCAGCTATGGTTTCAagttttggtTAT
TCCGACAGGCAAAGAGGTACTTATGCTGGCATGATTGCATCCTCCTTGTT
TGTGGGAAGATTCTTTGGAGGCTACTTTTGGGGCTGGCTGACAGACAAGA
TAGGGCGTCGACCTGTTCTACTCATCTCTGCATCTTTGACATACTTCGCC
ACTATTGCTTTTggattttcaacaaatttttattttgccgTTATTACAAG
ATTTCTTCAAGGCCTTTTTAACGGTGTTATCGTATGTGGCCGAGCGGCTT
TCGCTGAAATATGCGATGATACGAATCAAGCTATTGGAGTATCACTGGTC
TTTGCGGCATGGAATTCAGCCATTGTCATTGGACCTGCCTTAGGAGGTTT
CCTGGCTCAACCAGTGATGAAATATCCTAACAGTTTCAAAGgTTCAGCAG
CGACATTTTTCACGAAATTTCAGTTTCTTTTACCAAGTATATTGGTTGCT
GGTGTGTTACTTATCTCCATCATATTCATTTTCATCGTCGTCGAAGAAAC
CAAACCAACAAGTCTCTTGGAAACATCAGACAATGTTCACCTCTTATTGT
CTGAAGATAATGAAAAcgaaactgatgacgtcatttttatgaaagaAATG
TCATCATCTGATGAAGAAAAtgcaaaacaaaagaatgaaaGAGAAACAAT
AAATGATACAGAAGATGAGCAACAACAAAGAAAGAACACTAATAACAAAG
AAACGAAATGCAACCCATGTACTTCCATCAAATCATGGTCCATTTATGAA
CTTATGACCGATAAAATAGTGATGCTGGTCATCATAATGTTCGGAATATC
GGGATTCTGCATCATCGGGTTTTCGGAACTCTCCTCGTTATGGCTGGCTA
CAAAAGTAATATATGGTGGGCTTGGATTTACCACGGATAAGATTGGCATC
ACACTTCTGGTACCTGCTATTGTAGCCGCTGTTCTTCAACCCATTTTGTT
TAGTAGGTGTGAAAGACGATTTGGAGGAATTATCaCTGCTCGCATATCAC
TGGTCATATTGTTTATGATGACAGCTATGTATCCAAACATTCACAATGCC
TATAAACATACTGCGTTGCTATGGACGCTTCTAATCGTCATGGGATTGAT
TCGGATGATTGCTGACATCAGCAGTCGATCAGCACTTGCCTTGTTCATCA
ATAATTCGGTATATCAAGACCAGGCAGGTCGTGTCAATGGTTTGGCTTTC
TCCATCCAAGAAATTATGAGagtGGCATCTCCAACATTGTTCGGATCTAT
GTTTTCATGGTCCATCAATGCAGAAGAACATAAAGTATTTTTCCCGATAG
ACTATAGACTACCATTCATGGTTTTGTCGGCTTTTATTTTGGTGATCTTT
ACCATGTCATTCTTCTTACCAAGACGAATAAACTCTGCTAAATTATCATA
TACAAACAACAAATTGGAAATGAGTGATACCGATAGTTGAATGGCTTTTA
GTGATATCCTTTATCCACCTGGAGCCACCAGGCTAAACCATAAAGTGGCT
GCtgcactttttctcatcttGttTTCAACACAGATGACATTAACTTCACC
ATTCTCATACCTACCAGCTATGGTTTCAagttttggtTATTCCGACAGGC
AAAGAGGTACTTATGCTGGCATGATTGCATCCTCCTTGTTTGTGGGAAGA
TTCTTTGGAGGCTACTTTTGGGGCTGGCTGACAGACAAGATAGGGCGTCG
ACCTGTTCTACTCATCTCTGCATCTTTGACATACTTCGCCACTATTGCTT
TTggattttcaacaaatttttattttgccgTTATTACAAGATTTCTTCAA
GGCCTTTTTAACGGTGTTATCGTATGTGGCCGAGCGGCTTTCGCTGAAAT
ATGCGATGATACGAATCAAGCTATTGGAGTATCACTGGTCTTTGCGGCAT
GGAATTCAGCCATTGTCATTGGACCTGCCTTAGGAGGTTTCCTGGCTCAA
CCAGTGATGAAATATCCTAACAGTTTCAAAGgTTCAGCAGCGACATTTTT
CACGAAATTTCAGTTTCTTTTACCAAGTATATTGGTTGCTGGTGTGTTAC
TTATCTCCATCATATTCATTTTCATCGTCGTCGAAGAAACCAAACCAACA
AGTCTCTTGGAAACATCAGACAATGTTCACCTCTTATTGTCTGAAGATAA
TGAAAAcgaaactgatgacgtcatttttatgaaagaAATGTCATCATCTG
ATGAAGAAAAtgcaaaacaaaagaatgaaaGAGAAACAATAAATGATACA
GAAGATGAGCAACAACAAAGAAAGAACACTAATAACAAAGAAACGAAATG
CAACCCATGTACTTCCATCAAATCATGGTCCATTTATGAACTTATGACCG
ATAAAATAGTGATGCTGGTCATCATAATGTTCGGAATATCGGGATTCTGC
ATCATCGGGTTTTCGGAACTCTCCTCGTTATGGCTGGCTACAAAAGTAAT
ATATGGTGGGCTTGGATTTACCACGGATAAGATTGGCATCACACTTCTGG
TACCTGCTATTGTAGCCGCTGTTCTTCAACCCATTTTGTTTAGTAGGTGT
GAAAGACGATTTGGAGGAATTATCaCTGCTCGCATATCACTGGTCATATT
GTTTATGATGACAGCTATGTATCCAAACATTCACAATGCCTATAAACATA
CTGCGTTGCTATGGACGCTTCTAATCGTCATGGGATTGATTCGGATGATT
GCTGACATCAGCAGTCGATCAGCACTTGCCTTGTTCATCAATAATTCGGT
ATATCAAGACCAGGCAGGTCGTGTCAATGGTTTGGCTTTCTCCATCCAAG
AAATTATGAGagtGGCATCTCCAACATTGTTCGGATCTATGTTTTCATGG
TCCATCAATGCAGAAGAACATAAAGTATTTTTCCCGATAGACTATAGACT
ACCATTCATGGTTTTGTCGGCTTTTATTTTGGTGATCTTTACCATGTCAT
TCTTCTTACCAAGACGAATAAACTCTGCTAAATTATCATATACAAACAAC
AAATTGGAAATGAGTGATACCGATAGTTGAATGGCTTTTAGTGATATCCT
TTATCCACCTGGAGCCACCAGGCTAAACCATAAAGTGGCTGCtgcacttt
ttctcatcttGttTTCAACACAGATGACATTAACTTCACCATTCTCATAC
CTACCAGCTATGGTTTCAagttttggtTATTCCGACAGGCAAAGAGGTAC
TTATGCTGGCATGATTGCATCCTCCTTGTTTGTGGGAAGATTCTTTGGAG
GCTACTTTTGGGGCTGGCTGACAGACAAGATAGGGCGTCGACCTGTTCTA
CTCATCTCTGCATCTTTGACATACTTCGCCACTATTGCTTTTggattttc
aacaaatttttattttgccgTTATTACAAGATTTCTTCAAGGCCTTTTTA
ACGGTGTTATCGTATGTGGCCGAGCGGCTTTCGCTGAAATATGCGATGAT
ACGAATCAAGCTATTGGAGTATCACTGGTCTTTGCGGCATGGAATTCAGC
CATTGTCATTGGACCTGCCTTAGGAGGTTTCCTGGCTCAACCAGTGATGA
AATATCCTAACAGTTTCAAAGgTTCAGCAGCGACATTTTTCACGAAATTT
CAGTTTCTTTTACCAAGTATATTGGTTGCTGGTGTGTTACTTATCTCCAT
CATATTCATTTTCATCGTCGTCGAAGAAACCAAACCAACAAGTCTCTTGG
AAACATCAGACAATGTTCACCTCTTATTGTCTGAAGATAATGAAAAcgaa
actgatgacgtcatttttatgaaagaAATGTCATCATCTGATGAAGAAAA
tgcaaaacaaaagaatgaaaGAGAAACAATAAATGATACAGAAGATGAGC
AACAACAAAGAAAGAACACTAATAACAAAGAAACGAAATGCAACCCATGT
ACTTCCATCAAATCATGGTCCATTTATGAACTTATGACCGATAAAATAGT
GATGCTGGTCATCATAATGTTCGGAATATCGGGATTCTGCATCATCGGGT
TTTCGGAACTCTCCTCGTTATGGCTGGCTACAAAAGTAATATATGGTGGG
CTTGGATTTACCACGGATAAGATTGGCATCACACTTCTGGTACCTGCTAT
TGTAGCCGCTGTTCTTCAACCCATTTTGTTTAGTAGGTGTGAAAGACGAT
TTGGAGGAATTATCaCTGCTCGCATATCACTGGTCATATTGTTTATGATG
ACAGCTATGTATCCAAACATTCACAATGCCTATAAACATACTGCGTTGCT
ATGGACGCTTCTAATCGTCATGGGATTGATTCGGATGATTGCTGACATCA
GCAGTCGATCAGCACTTGCCTTGTTCATCAATAATTCGGTATATCAAGAC
CAGGCAGGTCGTGTCAATGGTTTGGCTTTCTCCATCCAAGAAATTATGAG
agtGGCATCTCCAACATTGTTCGGATCTATGTTTTCATGGTCCATCAATG
CAGAAGAACATAAAGTATTTTTCCCGATAGACTATAGACTACCATTCATG
GTTTTGTCGGCTTTTATTTTGGTGATCTTTACCATGTCATTCTTCTTACC
AAGACGAATAAACTCTGCTAAATTATCATATACAAACAACAAATTGGAAA
TGAGTGATACCGATAGTTGAATGGCTTTTAGTGATATCCTTTATCCACCT
GGAGCCACCAGGCTAAACCATAAAGTGGCTGCtgcactttttctcatctt
GttTTCAACACAGATGACATTAACTTCACCATTCTCATACCTACCAGCTA
TGGTTTCAagttttggtTATTCCGACAGGCAAAGAGGTACTTATGCTGGC
ATGATTGCATCCTCCTTGTTTGTGGGAAGATTCTTTGGAGGCTACTTTTG
GGGCTGGCTGACAGACAAGATAGGGCGTCGACCTGTTCTACTCATCTCTG
CATCTTTGACATACTTCGCCACTATTGCTTTTggattttcaacaaatttt
tattttgccgTTATTACAAGATTTCTTCAAGGCCTTTTTAACGGTGTTAT
CGTATGTGGCCGAGCGGCTTTCGCTGAAATATGCGATGATACGAATCAAG
CTATTGGAGTATCACTGGTCTTTGCGGCATGGAATTCAGCCATTGTCATT
GGACCTGCCTTAGGAGGTTTCCTGGCTCAACCAGTGATGAAATATCCTAA
CAGTTTCAAAGgTTCAGCAGCGACATTTTTCACGAAATTTCAGTTTCTTT
TACCAAGTATATTGGTTGCTGGTGTGTTACTTATCTCCATCATATTCATT
TTCATCGTCGTCGAAGAAACCAAACCAACAAGTCTCTTGGAAACATCAGA
CAATGTTCACCTCTTATTGTCTGAAGATAATGAAAAcgaaactgatgacg
tcatttttatgaaagaAATGTCATCATCTGATGAAGAAAAtgcaaaacaa
aagaatgaaaGAGAAACAATAAATGATACAGAAGATGAGCAACAACAAAG
AAAGAACACTAATAACAAAGAAACGAAATGCAACCCATGTACTTCCATCA
AATCATGGTCCATTTATGAACTTATGACCGATAAAATAGTGATGCTGGTC
ATCATAATGTTCGGAATATCGGGATTCTGCATCATCGGGTTTTCGGAACT
CTCCTCGTTATGGCTGGCTACAAAAGTAATATATGGTGGGCTTGGATTTA
CCACGGATAAGATTGGCATCACACTTCTGGTACCTGCTATTGTAGCCGCT
GTTCTTCAACCCATTTTGTTTAGTAGGTGTGAAAGACGATTTGGAGGAAT
TATCaCTGCTCGCATATCACTGGTCATATTGTTTATGATGACAGCTATGT
ATCCAAACATTCACAATGCCTATAAACATACTGCGTTGCTATGGACGCTT
CTAATCGTCATGGGATTGATTCGGATGATTGCTGACATCAGCAGTCGATC
AGCACTTGCCTTGTTCATCAATAATTCGGTATATCAAGACCAGGCAGGTC
GTGTCAATGGTTTGGCTTTCTCCATCCAAGAAATTATGAGagtGGCATCT
CCAACATTGTTCGGATCTATGTTTTCATGGTCCATCAATGCAGAAGAACA
TAAAGTATTTTTCCCGATAGACTATAGACTACCATTCATGGTTTTGTCGG
CTTTTATTTTGGTGATCTTTACCATGTCATTCTTCTTACCAAGACGAATA
AACTCTGCTAAATTATCATATACAAACAACAAATTGGAAATGAGTGATAC
CGATAGTTGAATGGCTTTTAGTGATATCCTTTATCCACCTGGAGCCACCA
GGCTAAACCATAAAGTGGCTGCtgcactttttctcatcttGttTTCAACA
CAGATGACATTAACTTCACCATTCTCATACCTACCAGCTATGGTTTCAag
ttttggtTATTCCGACAGGCAAAGAGGTACTTATGCTGGCATGATTGCAT
CCTCCTTGTTTGTGGGAAGATTCTTTGGAGGCTACTTTTGGGGCTGGCTG
ACAGACAAGATAGGGCGTCGACCTGTTCTACTCATCTCTGCATCTTTGAC
ATACTTCGCCACTATTGCTTTTggattttcaacaaatttttattttgccg
TTATTACAAGATTTCTTCAAGGCCTTTTTAACGGTGTTATCGTATGTGGC
CGAGCGGCTTTCGCTGAAATATGCGATGATACGAATCAAGCTATTGGAGT
ATCACTGGTCTTTGCGGCATGGAATTCAGCCATTGTCATTGGACCTGCCT
TAGGAGGTTTCCTGGCTCAACCAGTGATGAAATATCCTAACAGTTTCAAA
GgTTCAGCAGCGACATTTTTCACGAAATTTCAGTTTCTTTTACCAAGTAT
ATTGGTTGCTGGTGTGTTACTTATCTCCATCATATTCATTTTCATCGTCG
TCGAAGAAACCAAACCAACAAGTCTCTTGGAAACATCAGACAATGTTCAC
CTCTTATTGTCTGAAGATAATGAAAAcgaaactgatgacgtcatttttat
gaaagaAATGTCATCATCTGATGAAGAAAAtgcaaaacaaaagaatgaaa
GAGAAACAATAAATGATACAGAAGATGAGCAACAACAAAGAAAGAACACT
AATAACAAAGAAACGAAATGCAACCCATGTACTTCCATCAAATCATGGTC
CATTTATGAACTTATGACCGATAAAATAGTGATGCTGGTCATCATAATGT
TCGGAATATCGGGATTCTGCATCATCGGGTTTTCGGAACTCTCCTCGTTA
TGGCTGGCTACAAAAGTAATATATGGTGGGCTTGGATTTACCACGGATAA
GATTGGCATCACACTTCTGGTACCTGCTATTGTAGCCGCTGTTCTTCAAC
CCATTTTGTTTAGTAGGTGTGAAAGACGATTTGGAGGAATTATCaCTGCT
CGCATATCACTGGTCATATTGTTTATGATGACAGCTATGTATCCAAACAT
TCACAATGCCTATAAACATACTGCGTTGCTATGGACGCTTCTAATCGTCA
TGGGATTGATTCGGATGATTGCTGACATCAGCAGTCGATCAGCACTTGCC
TTGTTCATCAATAATTCGGTATATCAAGACCAGGCAGGTCGTGTCAATGG
TTTGGCTTTCTCCATCCAAGAAATTATGAGagtGGCATCTCCAACATTGT
TCGGATCTATGTTTTCATGGTCCATCAATGCAGAAGAACATAAAGTATTT
TTCCCGATAGACTATAGACTACCATTCATGGTTTTGTCGGCTTTTATTTT
GGTGATCTTTACCATGTCATTCTTCTTACCAAGACGAATAAACTCTGCTA
AATTATCATATACAAACAACAAATTGGAAATGAGTGATACCGATAGTTGA
ATGGCTTTTAGTGATATCCTTTATCCACCTGGAGCCACCAGGCTAAACCA
TAAAGTGGCTGCtgcactttttctcatcttGttTTCAACACAGATGACAT
TAACTTCACCATTCTCATACCTACCAGCTATGGTTTCAagttttggtTAT
TCCGACAGGCAAAGAGGTACTTATGCTGGCATGATTGCATCCTCCTTGTT
TGTGGGAAGATTCTTTGGAGGCTACTTTTGGGGCTGGCTGACAGACAAGA
TAGGGCGTCGACCTGTTCTACTCATCTCTGCATCTTTGACATACTTCGCC
ACTATTGCTTTTggattttcaacaaatttttattttgccgTTATTACAAG
ATTTCTTCAAGGCCTTTTTAACGGTGTTATCGTATGTGGCCGAGCGGCTT
TCGCTGAAATATGCGATGATACGAATCAAGCTATTGGAGTATCACTGGTC
TTTGCGGCATGGAATTCAGCCATTGTCATTGGACCTGCCTTAGGAGGTTT
CCTGGCTCAACCAGTGATGAAATATCCTAACAGTTTCAAAGgTTCAGCAG
CGACATTTTTCACGAAATTTCAGTTTCTTTTACCAAGTATATTGGTTGCT
GGTGTGTTACTTATCTCCATCATATTCATTTTCATCGTCGTCGAAGAAAC
CAAACCAACAAGTCTCTTGGAAACATCAGACAATGTTCACCTCTTATTGT
CTGAAGATAATGAAAAcgaaactgatgacgtcatttttatgaaagaAATG
TCATCATCTGATGAAGAAAAtgcaaaacaaaagaatgaaaGAGAAACAAT
AAATGATACAGAAGATGAGCAACAACAAAGAAAGAACACTAATAACAAAG
AAACGAAATGCAACCCATGTACTTCCATCAAATCATGGTCCATTTATGAA
CTTATGACCGATAAAATAGTGATGCTGGTCATCATAATGTTCGGAATATC
GGGATTCTGCATCATCGGGTTTTCGGAACTCTCCTCGTTATGGCTGGCTA
CAAAAGTAATATATGGTGGGCTTGGATTTACCACGGATAAGATTGGCATC
ACACTTCTGGTACCTGCTATTGTAGCCGCTGTTCTTCAACCCATTTTGTT
TAGTAGGTGTGAAAGACGATTTGGAGGAATTATCaCTGCTCGCATATCAC
TGGTCATATTGTTTATGATGACAGCTATGTATCCAAACATTCACAATGCC
TATAAACATACTGCGTTGCTATGGACGCTTCTAATCGTCATGGGATTGAT
TCGGATGATTGCTGACATCAGCAGTCGATCAGCACTTGCCTTGTTCATCA
ATAATTCGGTATATCAAGACCAGGCAGGTCGTGTCAATGGTTTGGCTTTC
TCCATCCAAGAAATTATGAGagtGGCATCTCCAACATTGTTCGGATCTAT
GTTTTCATGGTCCATCAATGCAGAAGAACATAAAGTATTTTTCCCGATAG
ACTATAGACTACCATTCATGGTTTTGTCGGCTTTTATTTTGGTGATCTTT
ACCATGTCATTCTTCTTACCAAGACGAATAAACTCTGCTAAATTATCATA
TACAAACAACAAATTGGAAATGAGTGATACCGATAGTTGAATGGCTTTTA
GTGATATCCTTTATCCACCTGGAGCCACCAGGCTAAACCATAAAGTGGCT
GCtgcactttttctcatcttGttTTCAACACAGATGACATTAACTTCACC
ATTCTCATACCTACCAGCTATGGTTTCAagttttggtTATTCCGACAGGC
AAAGAGGTACTTATGCTGGCATGATTGCATCCTCCTTGTTTGTGGGAAGA
TTCTTTGGAGGCTACTTTTGGGGCTGGCTGACAGACAAGATAGGGCGTCG
ACCTGTTCTACTCATCTCTGCATCTTTGACATACTTCGCCACTATTGCTT
TTggattttcaacaaatttttattttgccgTTATTACAAGATTTCTTCAA
GGCCTTTTTAACGGTGTTATCGTATGTGGCCGAGCGGCTTTCGCTGAAAT
ATGCGATGATACGAATCAAGCTATTGGAGTATCACTGGTCTTTGCGGCAT
GGAATTCAGCCATTGTCATTGGACCTGCCTTAGGAGGTTTCCTGGCTCAA
CCAGTGATGAAATATCCTAACAGTTTCAAAGgTTCAGCAGCGACATTTTT
CACGAAATTTCAGTTTCTTTTACCAAGTATATTGGTTGCTGGTGTGTTAC
TTATCTCCATCATATTCATTTTCATCGTCGTCGAAGAAACCAAACCAACA
AGTCTCTTGGAAACATCAGACAATGTTCACCTCTTATTGTCTGAAGATAA
TGAAAAcgaaactgatgacgtcatttttatgaaagaAATGTCATCATCTG
ATGAAGAAAAtgcaaaacaaaagaatgaaaGAGAAACAATAAATGATACA
GAAGATGAGCAACAACAAAGAAAGAACACTAATAACAAAGAAACGAAATG
CAACCCATGTACTTCCATCAAATCATGGTCCATTTATGAACTTATGACCG
ATAAAATAGTGATGCTGGTCATCATAATGTTCGGAATATCGGGATTCTGC
ATCATCGGGTTTTCGGAACTCTCCTCGTTATGGCTGGCTACAAAAGTAAT
ATATGGTGGGCTTGGATTTACCACGGATAAGATTGGCATCACACTTCTGG
TACCTGCTATTGTAGCCGCTGTTCTTCAACCCATTTTGTTTAGTAGGTGT
GAAAGACGATTTGGAGGAATTATCaCTGCTCGCATATCACTGGTCATATT
GTTTATGATGACAGCTATGTATCCAAACATTCACAATGCCTATAAACATA
CTGCGTTGCTATGGACGCTTCTAATCGTCATGGGATTGATTCGGATGATT
GCTGACATCAGCAGTCGATCAGCACTTGCCTTGTTCATCAATAATTCGGT
ATATCAAGACCAGGCAGGTCGTGTCAATGGTTTGGCTTTCTCCATCCAAG
AAATTATGAGagtGGCATCTCCAACATTGTTCGGATCTATGTTTTCATGG
TCCATCAATGCAGAAGAACATAAAGTATTTTTCCCGATAGACTATAGACT
ACCATTCATGGTTTTGTCGGCTTTTATTTTGGTGATCTTTACCATGTCAT
TCTTCTTACCAAGACGAATAAACTCTGCTAAATTATCATATACAAACAAC
AAATTGGAAATGAGTGATACCGATAGTTGAATGGCTTTTAGTGATATCCT
TTATCCACCTGGAGCCACCAGGCTAAACCATAAAGTGGCTGCtgcacttt
ttctcatcttGttTTCAACACAGATGACATTAACTTCACCATTCTCATAC
CTACCAGCTATGGTTTCAagttttggtTATTCCGACAGGCAAAGAGGTAC
TTATGCTGGCATGATTGCATCCTCCTTGTTTGTGGGAAGATTCTTTGGAG
GCTACTTTTGGGGCTGGCTGACAGACAAGATAGGGCGTCGACCTGTTCTA
CTCATCTCTGCATCTTTGACATACTTCGCCACTATTGCTTTTggattttc
aacaaatttttattttgccgTTATTACAAGATTTCTTCAAGGCCTTTTTA
ACGGTGTTATCGTATGTGGCCGAGCGGCTTTCGCTGAAATATGCGATGAT
ACGAATCAAGCTATTGGAGTATCACTGGTCTTTGCGGCATGGAATTCAGC
CATTGTCATTGGACCTGCCTTAGGAGGTTTCCTGGCTCAACCAGTGATGA
AATATCCTAACAGTTTCAAAGgTTCAGCAGCGACATTTTTCACGAAATTT
CAGTTTCTTTTACCAAGTATATTGGTTGCTGGTGTGTTACTTATCTCCAT
CATATTCATTTTCATCGTCGTCGAAGAAACCAAACCAACAAGTCTCTTGG
AAACATCAGACAATGTTCACCTCTTATTGTCTGAAGATAATGAAAAcgaa
actgatgacgtcatttttatgaaagaAATGTCATCATCTGATGAAGAAAA
tgcaaaacaaaagaatgaaaGAGAAACAATAAATGATACAGAAGATGAGC
AACAACAAAGAAAGAACACTAATAACAAAGAAACGAAATGCAACCCATGT
ACTTCCATCAAATCATGGTCCATTTATGAACTTATGACCGATAAAATAGT
GATGCTGGTCATCATAATGTTCGGAATATCGGGATTCTGCATCATCGGGT
TTTCGGAACTCTCCTCGTTATGGCTGGCTACAAAAGTAATATATGGTGGG
CTTGGATTTACCACGGATAAGATTGGCATCACACTTCTGGTACCTGCTAT
TGTAGCCGCTGTTCTTCAACCCATTTTGTTTAGTAGGTGTGAAAGACGAT
TTGGAGGAATTATCaCTGCTCGCATATCACTGGTCATATTGTTTATGATG
ACAGCTATGTATCCAAACATTCACAATGCCTATAAACATACTGCGTTGCT
ATGGACGCTTCTAATCGTCATGGGATTGATTCGGATGATTGCTGACATCA
GCAGTCGATCAGCACTTGCCTTGTTCATCAATAATTCGGTATATCAAGAC
CAGGCAGGTCGTGTCAATGGTTTGGCTTTCTCCATCCAAGAAATTATGAG
agtGGCATCTCCAACATTGTTCGGATCTATGTTTTCATGGTCCATCAATG
CAGAAGAACATAAAGTATTTTTCCCGATAGACTATAGACTACCATTCATG
GTTTTGTCGGCTTTTATTTTGGTGATCTTTACCATGTCATTCTTCTTACC
AAGACGAATAAACTCTGCTAAATTATCATATACAAACAACAAATTGGAAA
TGAGTGATACCGATAGTTGAATGGCTTTTAGTGATATCCTTTATCCACCT
GGAGCCACCAGGCTAAACCATAAAGTGGCTGCtgcactttttctcatctt
GttTTCAACACAGATGACATTAACTTCACCATTCTCATACCTACCAGCTA
TGGTTTCAagttttggtTATTCCGACAGGCAAAGAGGTACTTATGCTGGC
ATGATTGCATCCTCCTTGTTTGTGGGAAGATTCTTTGGAGGCTACTTTTG
GGGCTGGCTGACAGACAAGATAGGGCGTCGACCTGTTCTACTCATCTCTG
CATCTTTGACATACTTCGCCACTATTGCTTTTggattttcaacaaatttt
tattttgccgTTATTACAAGATTTCTTCAAGGCCTTTTTAACGGTGTTAT
CGTATGTGGCCGAGCGGCTTTCGCTGAAATATGCGATGATACGAATCAAG
CTATTGGAGTATCACTGGTCTTTGCGGCATGGAATTCAGCCATTGTCATT
GGACCTGCCTTAGGAGGTTTCCTGGCTCAACCAGTGATGAAATATCCTAA
CAGTTTCAAAGgTTCAGCAGCGACATTTTTCACGAAATTTCAGTTTCTTT
TACCAAGTATATTGGTTGCTGGTGTGTTACTTATCTCCATCATATTCATT
TTCATCGTCGTCGAAGAAACCAAACCAACAAGTCTCTTGGAAACATCAGA
CAATGTTCACCTCTTATTGTCTGAAGATAATGAAAAcgaaactgatgacg
tcatttttatgaaagaAATGTCATCATCTGATGAAGAAAAtgcaaaacaa
aagaatgaaaGAGAAACAATAAATGATACAGAAGATGAGCAACAACAAAG
AAAGAACACTAATAACAAAGAAACGAAATGCAACCCATGTACTTCCATCA
AATCATGGTCCATTTATGAACTTATGACCGATAAAATAGTGATGCTGGTC
ATCATAATGTTCGGAATATCGGGATTCTGCATCATCGGGTTTTCGGAACT
CTCCTCGTTATGGCTGGCTACAAAAGTAATATATGGTGGGCTTGGATTTA
CCACGGATAAGATTGGCATCACACTTCTGGTACCTGCTATTGTAGCCGCT
GTTCTTCAACCCATTTTGTTTAGTAGGTGTGAAAGACGATTTGGAGGAAT
TATCaCTGCTCGCATATCACTGGTCATATTGTTTATGATGACAGCTATGT
ATCCAAACATTCACAATGCCTATAAACATACTGCGTTGCTATGGACGCTT
CTAATCGTCATGGGATTGATTCGGATGATTGCTGACATCAGCAGTCGATC
AGCACTTGCCTTGTTCATCAATAATTCGGTATATCAAGACCAGGCAGGTC
GTGTCAATGGTTTGGCTTTCTCCATCCAAGAAATTATGAGagtGGCATCT
CCAACATTGTTCGGATCTATGTTTTCATGGTCCATCAATGCAGAAGAACA
TAAAGTATTTTTCCCGATAGACTATAGACTACCATTCATGGTTTTGTCGG
CTTTTATTTTGGTGATCTTTACCATGTCATTCTTCTTACCAAGACGAATA
AACTCTGCTAAATTATCATATACAAACAACAAATTGGAAATGAGTGATAC
CGATAGTTGAATGGCTTTTAGTGATATCCTTTATCCACCTGGAGCCACCA
GGCTAAACCATAAAGTGGCTGCtgcactttttctcatcttGttTTCAACA
CAGATGACATTAACTTCACCATTCTCATACCTACCAGCTATGGTTTCAag
ttttggtTATTCCGACAGGCAAAGAGGTACTTATGCTGGCATGATTGCAT
CCTCCTTGTTTGTGGGAAGATTCTTTGGAGGCTACTTTTGGGGCTGGCTG
ACAGACAAGATAGGGCGTCGACCTGTTCTACTCATCTCTGCATCTTTGAC
ATACTTCGCCACTATTGCTTTTggattttcaacaaatttttattttgccg
TTATTACAAGATTTCTTCAAGGCCTTTTTAACGGTGTTATCGTATGTGGC
CGAGCGGCTTTCGCTGAAATATGCGATGATACGAATCAAGCTATTGGAGT
ATCACTGGTCTTTGCGGCATGGAATTCAGCCATTGTCATTGGACCTGCCT
TAGGAGGTTTCCTGGCTCAACCAGTGATGAAATATCCTAACAGTTTCAAA
GgTTCAGCAGCGACATTTTTCACGAAATTTCAGTTTCTTTTACCAAGTAT
ATTGGTTGCTGGTGTGTTACTTATCTCCATCATATTCATTTTCATCGTCG
TCGAAGAAACCAAACCAACAAGTCTCTTGGAAACATCAGACAATGTTCAC
CTCTTATTGTCTGAAGATAATGAAAAcgaaactgatgacgtcatttttat
gaaagaAATGTCATCATCTGATGAAGAAAAtgcaaaacaaaagaatgaaa
GAGAAACAATAAATGATACAGAAGATGAGCAACAACAAAGAAAGAACACT
AATAACAAAGAAACGAAATGCAACCCATGTACTTCCATCAAATCATGGTC
CATTTATGAACTTATGACCGATAAAATAGTGATGCTGGTCATCATAATGT
TCGGAATATCGGGATTCTGCATCATCGGGTTTTCGGAACTCTCCTCGTTA
TGGCTGGCTACAAAAGTAATATATGGTGGGCTTGGATTTACCACGGATAA
GATTGGCATCACACTTCTGGTACCTGCTATTGTAGCCGCTGTTCTTCAAC
CCATTTTGTTTAGTAGGTGTGAAAGACGATTTGGAGGAATTATCaCTGCT
CGCATATCACTGGTCATATTGTTTATGATGACAGCTATGTATCCAAACAT
TCACAATGCCTATAAACATACTGCGTTGCTATGGACGCTTCTAATCGTCA
TGGGATTGATTCGGATGATTGCTGACATCAGCAGTCGATCAGCACTTGCC
TTGTTCATCAATAATTCGGTATATCAAGACCAGGCAGGTCGTGTCAATGG
TTTGGCTTTCTCCATCCAAGAAATTATGAGagtGGCATCTCCAACATTGT
TCGGATCTATGTTTTCATGGTCCATCAATGCAGAAGAACATAAAGTATTT
TTCCCGATAGACTATAGACTACCATTCATGGTTTTGTCGGCTTTTATTTT
GGTGATCTTTACCATGTCATTCTTCTTACCAAGACGAATAAACTCTGCTA
AATTATCATATACAAACAACAAATTGGAAATGAGTGATACCGATAGTTGA
ATGGCTTTTAGTGATATCCTTTATCCACCTGGAGCCACCAGGCTAAACCA
TAAAGTGGCTGCtgcactttttctcatcttGttTTCAACACAGATGACAT
TAACTTCACCATTCTCATACCTACCAGCTATGGTTTCAagttttggtTAT
TCCGACAGGCAAAGAGGTACTTATGCTGGCATGATTGCATCCTCCTTGTT
TGTGGGAAGATTCTTTGGAGGCTACTTTTGGGGCTGGCTGACAGACAAGA
TAGGGCGTCGACCTGTTCTACTCATCTCTGCATCTTTGACATACTTCGCC
ACTATTGCTTTTggattttcaacaaatttttattttgccgTTATTACAAG
ATTTCTTCAAGGCCTTTTTAACGGTGTTATCGTATGTGGCCGAGCGGCTT
TCGCTGAAATATGCGATGATACGAATCAAGCTATTGGAGTATCACTGGTC
TTTGCGGCATGGAATTCAGCCATTGTCATTGGACCTGCCTTAGGAGGTTT
CCTGGCTCAACCAGTGATGAAATATCCTAACAGTTTCAAAGgTTCAGCAG
CGACATTTTTCACGAAATTTCAGTTTCTTTTACCAAGTATATTGGTTGCT
GGTGTGTTACTTATCTCCATCATATTCATTTTCATCGTCGTCGAAGAAAC
CAAACCAACAAGTCTCTTGGAAACATCAGACAATGTTCACCTCTTATTGT
CTGAAGATAATGAAAAcgaaactgatgacgtcatttttatgaaagaAATG
TCATCATCTGATGAAGAAAAtgcaaaacaaaagaatgaaaGAGAAACAAT
AAATGATACAGAAGATGAGCAACAACAAAGAAAGAACACTAATAACAAAG
AAACGAAATGCAACCCATGTACTTCCATCAAATCATGGTCCATTTATGAA
CTTATGACCGATAAAATAGTGATGCTGGTCATCATAATGTTCGGAATATC
GGGATTCTGCATCATCGGGTTTTCGGAACTCTCCTCGTTATGGCTGGCTA
CAAAAGTAATATATGGTGGGCTTGGATTTACCACGGATAAGATTGGCATC
ACACTTCTGGTACCTGCTATTGTAGCCGCTGTTCTTCAACCCATTTTGTT
TAGTAGGTGTGAAAGACGATTTGGAGGAATTATCaCTGCTCGCATATCAC
TGGTCATATTGTTTATGATGACAGCTATGTATCCAAACATTCACAATGCC
TATAAACATACTGCGTTGCTATGGACGCTTCTAATCGTCATGGGATTGAT
TCGGATGATTGCTGACATCAGCAGTCGATCAGCACTTGCCTTGTTCATCA
ATAATTCGGTATATCAAGACCAGGCAGGTCGTGTCAATGGTTTGGCTTTC
TCCATCCAAGAAATTATGAGagtGGCATCTCCAACATTGTTCGGATCTAT
GTTTTCATGGTCCATCAATGCAGAAGAACATAAAGTATTTTTCCCGATAG
ACTATAGACTACCATTCATGGTTTTGTCGGCTTTTATTTTGGTGATCTTT
ACCATGTCATTCTTCTTACCAAGACGAATAAACTCTGCTAAATTATCATA
TACAAACAACAAATTGGAAATGAGTGATACCGATAGTTGAATGGCTTTTA
GTGATATCCTTTATCCACCTGGAGCCACCAGGCTAAACCATAAAGTGGCT
GCtgcactttttctcatcttGttTTCAACACAGATGACATTAACTTCACC
ATTCTCATACCTACCAGCTATGGTTTCAagttttggtTATTCCGACAGGC
AAAGAGGTACTTATGCTGGCATGATTGCATCCTCCTTGTTTGTGGGAAGA
TTCTTTGGAGGCTACTTTTGGGGCTGGCTGACAGACAAGATAGGGCGTCG
ACCTGTTCTACTCATCTCTGCATCTTTGACATACTTCGCCACTATTGCTT
TTggattttcaacaaatttttattttgccgTTATTACAAGATTTCTTCAA
GGCCTTTTTAACGGTGTTATCGTATGTGGCCGAGCGGCTTTCGCTGAAAT
ATGCGATGATACGAATCAAGCTATTGGAGTATCACTGGTCTTTGCGGCAT
GGAATTCAGCCATTGTCATTGGACCTGCCTTAGGAGGTTTCCTGGCTCAA
CCAGTGATGAAATATCCTAACAGTTTCAAAGgTTCAGCAGCGACATTTTT
CACGAAATTTCAGTTTCTTTTACCAAGTATATTGGTTGCTGGTGTGTTAC
TTATCTCCATCATATTCATTTTCATCGTCGTCGAAGAAACCAAACCAACA
AGTCTCTTGGAAACATCAGACAATGTTCACCTCTTATTGTCTGAAGATAA
TGAAAAcgaaactgatgacgtcatttttatgaaagaAATGTCATCATCTG
ATGAAGAAAAtgcaaaacaaaagaatgaaaGAGAAACAATAAATGATACA
GAAGATGAGCAACAACAAAGAAAGAACACTAATAACAAAGAAACGAAATG
CAACCCATGTACTTCCATCAAATCATGGTCCATTTATGAACTTATGACCG
ATAAAATAGTGATGCTGGTCATCATAATGTTCGGAATATCGGGATTCTGC
ATCATCGGGTTTTCGGAACTCTCCTCGTTATGGCTGGCTACAAAAGTAAT
ATATGGTGGGCTTGGATTTACCACGGATAAGATTGGCATCACACTTCTGG
TACCTGCTATTGTAGCCGCTGTTCTTCAACCCATTTTGTTTAGTAGGTGT
GAAAGACGATTTGGAGGAATTATCaCTGCTCGCATATCACTGGTCATATT
GTTTATGATGACAGCTATGTATCCAAACATTCACAATGCCTATAAACATA
CTGCGTTGCTATGGACGCTTCTAATCGTCATGGGATTGATTCGGATGATT
GCTGACATCAGCAGTCGATCAGCACTTGCCTTGTTCATCAATAATTCGGT
ATATCAAGACCAGGCAGGTCGTGTCAATGGTTTGGCTTTCTCCATCCAAG
AAATTATGAGagtGGCATCTCCAACATTGTTCGGATCTATGTTTTCATGG
TCCATCAATGCAGAAGAACATAAAGTATTTTTCCCGATAGACTATAGACT
ACCATTCATGGTTTTGTCGGCTTTTATTTTGGTGATCTTTACCATGTCAT
TCTTCTTACCAAGACGAATAAACTCTGCTAAATTATCATATACAAACAAC
AAATTGGAAATGAGTGATACCGATAGTTGAATGGCTTTTAGTGATATCCT
TTATCCACCTGGAGCCACCAGGCTAAACCATAAAGTGGCTGCtgcacttt
ttctcatcttGttTTCAACACAGATGACATTAACTTCACCATTCTCATAC
CTACCAGCTATGGTTTCAagttttggtTATTCCGACAGGCAAAGAGGTAC
TTATGCTGGCATGATTGCATCCTCCTTGTTTGTGGGAAGATTCTTTGGAG
GCTACTTTTGGGGCTGGCTGACAGACAAGATAGGGCGTCGACCTGTTCTA
CTCATCTCTGCATCTTTGACATACTTCGCCACTATTGCTTTTggattttc
aacaaatttttattttgccgTTATTACAAGATTTCTTCAAGGCCTTTTTA
ACGGTGTTATCGTATGTGGCCGAGCGGCTTTCGCTGAAATATGCGATGAT
ACGAATCAAGCTATTGGAGTATCACTGGTCTTTGCGGCATGGAATTCAGC
CATTGTCATTGGACCTGCCTTAGGAGGTTTCCTGGCTCAACCAGTGATGA
AATATCCTAACAGTTTCAAAGgTTCAGCAGCGACATTTTTCACGAAATTT
CAGTTTCTTTTACCAAGTATATTGGTTGCTGGTGTGTTACTTATCTCCAT
CATATTCATTTTCATCGTCGTCGAAGAAACCAAACCAACAAGTCTCTTGG
AAACATCAGACAATGTTCACCTCTTATTGTCTGAAGATAATGAAAAcgaa
actgatgacgtcatttttatgaaagaAATGTCATCATCTGATGAAGAAAA
tgcaaaacaaaagaatgaaaGAGAAACAATAAATGATACAGAAGATGAGC
AACAACAAAGAAAGAACACTAATAACAAAGAAACGAAATGCAACCCATGT
ACTTCCATCAAATCATGGTCCATTTATGAACTTATGACCGATAAAATAGT
GATGCTGGTCATCATAATGTTCGGAATATCGGGATTCTGCATCATCGGGT
TTTCGGAACTCTCCTCGTTATGGCTGGCTACAAAAGTAATATATGGTGGG
CTTGGATTTACCACGGATAAGATTGGCATCACACTTCTGGTACCTGCTAT
TGTAGCCGCTGTTCTTCAACCCATTTTGTTTAGTAGGTGTGAAAGACGAT
TTGGAGGAATTATCaCTGCTCGCATATCACTGGTCATATTGTTTATGATG
ACAGCTATGTATCCAAACATTCACAATGCCTATAAACATACTGCGTTGCT
ATGGACGCTTCTAATCGTCATGGGATTGATTCGGATGATTGCTGACATCA
GCAGTCGATCAGCACTTGCCTTGTTCATCAATAATTCGGTATATCAAGAC
CAGGCAGGTCGTGTCAATGGTTTGGCTTTCTCCATCCAAGAAATTATGAG
agtGGCATCTCCAACATTGTTCGGATCTATGTTTTCATGGTCCATCAATG
CAGAAGAACATAAAGTATTTTTCCCGATAGACTATAGACTACCATTCATG
GTTTTGTCGGCTTTTATTTTGGTGATCTTTACCATGTCATTCTTCTTACC
AAGACGAATAAACTCTGCTAAATTATCATATACAAACAACAAATTGGAAA
TGAGTGATACCGATAGTTGAATGGCTTTTAGTGATATCCTTTATCCACCT
GGAGCCACCAGGCTAAACCATAAAGTGGCTGCtgcactttttctcatctt
GttTTCAACACAGATGACATTAACTTCACCATTCTCATACCTACCAGCTA
TGGTTTCAagttttggtTATTCCGACAGGCAAAGAGGTACTTATGCTGGC
ATGATTGCATCCTCCTTGTTTGTGGGAAGATTCTTTGGAGGCTACTTTTG
GGGCTGGCTGACAGACAAGATAGGGCGTCGACCTGTTCTACTCATCTCTG
CATCTTTGACATACTTCGCCACTATTGCTTTTggattttcaacaaatttt
tattttgccgTTATTACAAGATTTCTTCAAGGCCTTTTTAACGGTGTTAT
CGTATGTGGCCGAGCGGCTTTCGCTGAAATATGCGATGATACGAATCAAG
CTATTGGAGTATCACTGGTCTTTGCGGCATGGAATTCAGCCATTGTCATT
GGACCTGCCTTAGGAGGTTTCCTGGCTCAACCAGTGATGAAATATCCTAA
CAGTTTCAAAGgTTCAGCAGCGACATTTTTCACGAAATTTCAGTTTCTTT
TACCAAGTATATTGGTTGCTGGTGTGTTACTTATCTCCATCATATTCATT
TTCATCGTCGTCGAAGAAACCAAACCAACAAGTCTCTTGGAAACATCAGA
CAATGTTCACCTCTTATTGTCTGAAGATAATGAAAAcgaaactgatgacg
tcatttttatgaaagaAATGTCATCATCTGATGAAGAAAAtgcaaaacaa
aagaatgaaaGAGAAACAATAAATGATACAGAAGATGAGCAACAACAAAG
AAAGAACACTAATAACAAAGAAACGAAATGCAACCCATGTACTTCCATCA
AATCATGGTCCATTTATGAACTTATGACCGATAAAATAGTGATGCTGGTC
ATCATAATGTTCGGAATATCGGGATTCTGCATCATCGGGTTTTCGGAACT
CTCCTCGTTATGGCTGGCTACAAAAGTAATATATGGTGGGCTTGGATTTA
CCACGGATAAGATTGGCATCACACTTCTGGTACCTGCTATTGTAGCCGCT
GTTCTTCAACCCATTTTGTTTAGTAGGTGTGAAAGACGATTTGGAGGAAT
TATCaCTGCTCGCATATCACTGGTCATATTGTTTATGATGACAGCTATGT
ATCCAAACATTCACAATGCCTATAAACATACTGCGTTGCTATGGACGCTT
CTAATCGTCATGGGATTGATTCGGATGATTGCTGACATCAGCAGTCGATC
AGCACTTGCCTTGTTCATCAATAATTCGGTATATCAAGACCAGGCAGGTC
GTGTCAATGGTTTGGCTTTCTCCATCCAAGAAATTATGAGagtGGCATCT
CCAACATTGTTCGGATCTATGTTTTCATGGTCCATCAATGCAGAAGAACA
TAAAGTATTTTTCCCGATAGACTATAGACTACCATTCATGGTTTTGTCGG
CTTTTATTTTGGTGATCTTTACCATGTCATTCTTCTTACCAAGACGAATA
AACTCTGCTAAATTATCATATACAAACAACAAATTGGAAATGAGTGATAC
CGATAGTTGAATGGCTTTTAGTGATATCCTTTATCCACCTGGAGCCACCA
GGCTAAACCATAAAGTGGCTGCtgcactttttctcatcttGttTTCAACA
CAGATGACATTAACTTCACCATTCTCATACCTACCAGCTATGGTTTCAag
ttttggtTATTCCGACAGGCAAAGAGGTACTTATGCTGGCATGATTGCAT
CCTCCTTGTTTGTGGGAAGATTCTTTGGAGGCTACTTTTGGGGCTGGCTG
ACAGACAAGATAGGGCGTCGACCTGTTCTACTCATCTCTGCATCTTTGAC
ATACTTCGCCACTATTGCTTTTggattttcaacaaatttttattttgccg
TTATTACAAGATTTCTTCAAGGCCTTTTTAACGGTGTTATCGTATGTGGC
CGAGCGGCTTTCGCTGAAATATGCGATGATACGAATCAAGCTATTGGAGT
ATCACTGGTCTTTGCGGCATGGAATTCAGCCATTGTCATTGGACCTGCCT
TAGGAGGTTTCCTGGCTCAACCAGTGATGAAATATCCTAACAGTTTCAAA
GgTTCAGCAGCGACATTTTTCACGAAATTTCAGTTTCTTTTACCAAGTAT
ATTGGTTGCTGGTGTGTTACTTATCTCCATCATATTCATTTTCATCGTCG
TCGAAGAAACCAAACCAACAAGTCTCTTGGAAACATCAGACAATGTTCAC
CTCTTATTGTCTGAAGATAATGAAAAcgaaactgatgacgtcatttttat
gaaagaAATGTCATCATCTGATGAAGAAAAtgcaaaacaaaagaatgaaa
GAGAAACAATAAATGATACAGAAGATGAGCAACAACAAAGAAAGAACACT
AATAACAAAGAAACGAAATGCAACCCATGTACTTCCATCAAATCATGGTC
CATTTATGAACTTATGACCGATAAAATAGTGATGCTGGTCATCATAATGT
TCGGAATATCGGGATTCTGCATCATCGGGTTTTCGGAACTCTCCTCGTTA
TGGCTGGCTACAAAAGTAATATATGGTGGGCTTGGATTTACCACGGATAA
GATTGGCATCACACTTCTGGTACCTGCTATTGTAGCCGCTGTTCTTCAAC
CCATTTTGTTTAGTAGGTGTGAAAGACGATTTGGAGGAATTATCaCTGCT
CGCATATCACTGGTCATATTGTTTATGATGACAGCTATGTATCCAAACAT
TCACAATGCCTATAAACATACTGCGTTGCTATGGACGCTTCTAATCGTCA
TGGGATTGATTCGGATGATTGCTGACATCAGCAGTCGATCAGCACTTGCC
TTGTTCATCAATAATTCGGTATATCAAGACCAGGCAGGTCGTGTCAATGG
TTTGGCTTTCTCCATCCAAGAAATTATGAGagtGGCATCTCCAACATTGT
TCGGATCTATGTTTTCATGGTCCATCAATGCAGAAGAACATAAAGTATTT
TTCCCGATAGACTATAGACTACCATTCATGGTTTTGTCGGCTTTTATTTT
GGTGATCTTTACCATGTCATTCTTCTTACCAAGACGAATAAACTCTGCTA
AATTATCATATACAAACAACAAATTGGAAATGAGTGATACCGATAGTTGA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_001181XLOC_001181Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00002231-proteinTCONS_00002231-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00002231-exon-sc0000019-1491911889:115775..116498TCONS_00002231-exon-sc0000019-1491911889:115775..116498Clytia hemisphaericaexon
TCONS_00002231-exon-sc0000019-1510915933:115775..116498TCONS_00002231-exon-sc0000019-1510915933:115775..116498Clytia hemisphaericaexon
TCONS_00002231-exon-sc0000019-1575043694:115775..116498TCONS_00002231-exon-sc0000019-1575043694:115775..116498Clytia hemisphaericaexon
TCONS_00002231-exon-sc0000019-1491911889:117096..117152TCONS_00002231-exon-sc0000019-1491911889:117096..117152Clytia hemisphaericaexon
TCONS_00002231-exon-sc0000019-1510915933:117096..117152TCONS_00002231-exon-sc0000019-1510915933:117096..117152Clytia hemisphaericaexon
TCONS_00002231-exon-sc0000019-1575043694:117096..117152TCONS_00002231-exon-sc0000019-1575043694:117096..117152Clytia hemisphaericaexon
TCONS_00002231-exon-sc0000019-1491911889:117966..117993TCONS_00002231-exon-sc0000019-1491911889:117966..117993Clytia hemisphaericaexon
TCONS_00002231-exon-sc0000019-1510915933:117966..117993TCONS_00002231-exon-sc0000019-1510915933:117966..117993Clytia hemisphaericaexon
TCONS_00002231-exon-sc0000019-1575043694:117966..117993TCONS_00002231-exon-sc0000019-1575043694:117966..117993Clytia hemisphaericaexon
TCONS_00002231-exon-sc0000019-1491911889:118166..118220TCONS_00002231-exon-sc0000019-1491911889:118166..118220Clytia hemisphaericaexon
TCONS_00002231-exon-sc0000019-1510915933:118166..118220TCONS_00002231-exon-sc0000019-1510915933:118166..118220Clytia hemisphaericaexon
TCONS_00002231-exon-sc0000019-1575043694:118166..118220TCONS_00002231-exon-sc0000019-1575043694:118166..118220Clytia hemisphaericaexon
TCONS_00002231-exon-sc0000019-1491911889:118808..118959TCONS_00002231-exon-sc0000019-1491911889:118808..118959Clytia hemisphaericaexon
TCONS_00002231-exon-sc0000019-1510915933:118808..118959TCONS_00002231-exon-sc0000019-1510915933:118808..118959Clytia hemisphaericaexon
TCONS_00002231-exon-sc0000019-1575043694:118808..118959TCONS_00002231-exon-sc0000019-1575043694:118808..118959Clytia hemisphaericaexon
TCONS_00002231-exon-sc0000019-1491911889:121666..121788TCONS_00002231-exon-sc0000019-1491911889:121666..121788Clytia hemisphaericaexon
TCONS_00002231-exon-sc0000019-1510915933:121666..121788TCONS_00002231-exon-sc0000019-1510915933:121666..121788Clytia hemisphaericaexon
TCONS_00002231-exon-sc0000019-1575043694:121666..121788TCONS_00002231-exon-sc0000019-1575043694:121666..121788Clytia hemisphaericaexon
TCONS_00002231-exon-sc0000019-1491911889:122204..122248TCONS_00002231-exon-sc0000019-1491911889:122204..122248Clytia hemisphaericaexon
TCONS_00002231-exon-sc0000019-1510915933:122204..122248TCONS_00002231-exon-sc0000019-1510915933:122204..122248Clytia hemisphaericaexon
TCONS_00002231-exon-sc0000019-1575043694:122204..122248TCONS_00002231-exon-sc0000019-1575043694:122204..122248Clytia hemisphaericaexon
TCONS_00002231-exon-sc0000019-1491911889:122555..122675TCONS_00002231-exon-sc0000019-1491911889:122555..122675Clytia hemisphaericaexon
TCONS_00002231-exon-sc0000019-1510915933:122555..122675TCONS_00002231-exon-sc0000019-1510915933:122555..122675Clytia hemisphaericaexon
TCONS_00002231-exon-sc0000019-1575043694:122555..122675TCONS_00002231-exon-sc0000019-1575043694:122555..122675Clytia hemisphaericaexon
TCONS_00002231-exon-sc0000019-1491911889:122815..123060TCONS_00002231-exon-sc0000019-1491911889:122815..123060Clytia hemisphaericaexon
TCONS_00002231-exon-sc0000019-1510915933:122815..123060TCONS_00002231-exon-sc0000019-1510915933:122815..123060Clytia hemisphaericaexon
TCONS_00002231-exon-sc0000019-1575043694:122815..123060TCONS_00002231-exon-sc0000019-1575043694:122815..123060Clytia hemisphaericaexon
TCONS_00002231-exon-sc0000019-1491911889:123672..123778TCONS_00002231-exon-sc0000019-1491911889:123672..123778Clytia hemisphaericaexon
TCONS_00002231-exon-sc0000019-1510915933:123672..123778TCONS_00002231-exon-sc0000019-1510915933:123672..123778Clytia hemisphaericaexon
TCONS_00002231-exon-sc0000019-1575043694:123672..123778TCONS_00002231-exon-sc0000019-1575043694:123672..123778Clytia hemisphaericaexon
TCONS_00002231-exon-sc0000019-1491911889:124351..124442TCONS_00002231-exon-sc0000019-1491911889:124351..124442Clytia hemisphaericaexon
TCONS_00002231-exon-sc0000019-1510915933:124351..124442TCONS_00002231-exon-sc0000019-1510915933:124351..124442Clytia hemisphaericaexon
TCONS_00002231-exon-sc0000019-1575043694:124351..124442TCONS_00002231-exon-sc0000019-1575043694:124351..124442Clytia hemisphaericaexon
TCONS_00002231-exon-sc0000019-1491911889:124924..124950TCONS_00002231-exon-sc0000019-1491911889:124924..124950Clytia hemisphaericaexon
TCONS_00002231-exon-sc0000019-1510915933:124924..124950TCONS_00002231-exon-sc0000019-1510915933:124924..124950Clytia hemisphaericaexon
TCONS_00002231-exon-sc0000019-1575043694:124924..124950TCONS_00002231-exon-sc0000019-1575043694:124924..124950Clytia hemisphaericaexon
TCONS_00002231-exon-sc0000019-1491911889:125303..125376TCONS_00002231-exon-sc0000019-1491911889:125303..125376Clytia hemisphaericaexon
TCONS_00002231-exon-sc0000019-1510915933:125303..125376TCONS_00002231-exon-sc0000019-1510915933:125303..125376Clytia hemisphaericaexon
TCONS_00002231-exon-sc0000019-1575043694:125303..125376TCONS_00002231-exon-sc0000019-1575043694:125303..125376Clytia hemisphaericaexon
TCONS_00002231-exon-sc0000019-1491911889:126384..126545TCONS_00002231-exon-sc0000019-1491911889:126384..126545Clytia hemisphaericaexon
TCONS_00002231-exon-sc0000019-1510915933:126384..126545TCONS_00002231-exon-sc0000019-1510915933:126384..126545Clytia hemisphaericaexon
TCONS_00002231-exon-sc0000019-1575043694:126384..126545TCONS_00002231-exon-sc0000019-1575043694:126384..126545Clytia hemisphaericaexon
TCONS_00002231-exon-sc0000019-1491911889:127018..127482TCONS_00002231-exon-sc0000019-1491911889:127018..127482Clytia hemisphaericaexon
TCONS_00002231-exon-sc0000019-1510915933:127018..127482TCONS_00002231-exon-sc0000019-1510915933:127018..127482Clytia hemisphaericaexon
TCONS_00002231-exon-sc0000019-1575043694:127018..127482TCONS_00002231-exon-sc0000019-1575043694:127018..127482Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000019supercontigsc0000019:115775..127482 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0.156358 0.228711 0.123926 0.0866016 0.0210858 0.0833115 1.04532 1.20445 2.00276 1.35461 2.40786 2.73872 18.2085 17.5814 16.1767 15.0638 4.34298 5.32966 22.7545 34.0728 5.65399 5.66312 4.93013 4.74299 3.77719 3.94039 3.73053 3.0432 7.0286 6.89581
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR011701MFS
IPR020846MFS_dom
Vocabulary: Biological Process
TermDefinition
GO:0055085transmembrane transport
Vocabulary: Cellular Component
TermDefinition
GO:0016021integral component of membrane
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0055085 transmembrane transport
cellular_component GO:0016021 integral component of membrane
Blast
The following BLAST results are available for this feature:
BLAST of TCONS_00002231 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 0
Match NameE-valueIdentityDescription
back to top