Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00002138 (transcript) - C. hemisphaerica

Overview
NameTCONS_00002138
Unique NameTCONS_00002138
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length2049

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00002138 ID=TCONS_00002138|Name=TCONS_00002138|organism=Clytia hemisphaerica|type=transcript|length=2049bp
aaaacaaaccgaaaaattaaaatgtaaaaagatGTTTGGATACTTTTGGT
AAAATCTCGATGGTTCCATAATGAGTTGCTACCATCGTAATAATATTGTC
TTGGATTCGGCTATTGAAACTTAATAACAgtgaagaaaaattgaaagtga
agATGGGAACTTGAACGGAATTTCTCGAATAATACTCAAATACCAAAGAT
TTCTGACTAGAAGAACATCTGGAACACGAGAGAATATTTTATACGGCAAT
CATAAATTGAGTAGTATACAAATGCCGAAAATTTGATCAACAAAACTCAT
TGAAACTAAGTTCATCAGACATTAAGAACCTCAACTGTATTCAATACTAT
TTACAAGATGGTTGGAGCATCATTCCGCAGAGAGTTCCATATGGCGTTTC
TTCTTGGTTTATCCTTCGGCTTCTTTATTGCTGTCATATTTCGTGAATTG
CAATCTTCGTTTTCTGAAACCAAAGATTTGGTCAACAAAGGACCACCATC
TGGCAGAGCAATGGAAGAAGATTATGCCATGCTATTAAGTGAAGAATATG
AAGGAAAACATTTGCCACCTCCTTCCAAACCTCAACCTGTTGATAAACCA
ATCATATTCAATGATCTAGATTCTATACATCATAAAGGTGGTGACCGAGT
TGCTAAATTACTTTCGAAGAAGGTTCGAATTCTATGTTGGATCATGACGC
AACCGAAAACATTGAAAACCAAAGCACAAGCTGTCAAGAACACGTGGGGA
AAACGTTGTAATACACTGCTGTTCATGAGTTCAAAGGGTGATAAAGATTT
CCCAGTAGTTGGGCTGAACGTACCAGAAGGTCGAAAAAACTTGTGGTTGA
AAACACGCGCAGCTTGGAAATATATTTACGAGCACCATTTCTACGACGCT
GATTGGTTCTTAAAAGCCGATGATGACTCATTTGTCGTTCTCGAAAATCT
ACGTTATTTCTTATCAAAGCATAATTCAAGTCAGACTCATTATTTTGGGC
GACATTTCCGCCCTTTTGGCGGCTACAACTCTGGTGGGGCGGGCTATGTT
TTCAGTAAAGCCACCCTGATAGTATTCAACCAAGTACTACGTGATCCAAG
TGTTTGCAAACTAAAAGCAGGCGCCGAGGATGCAGAAGTAGGCGTTTGTT
TACGAATGATGGGCGTTGTGCCCGGTGATACTAGAGACGAATTTGGGCGT
GAAAGTTTCCACCCGTTTGCGCCTGATTATCATTTAGTACCGAATGGTAT
ACCCACTACGAACTGGTTACATAAATATAATAAACATCCGGTCAAATCGG
GACCTGGATGTTGTTCAGACCATAGTATAGCTTTTCATTATATTCCGCCA
AACCGGATGTATGTGATGGAatattttatttatcatttGAGGCCGTTCGG
TGTGCACCACGTACACAACTGACATCATTCAGCCTAGTTTGCTACAAGTA
GTGCTCTGAATGGTGACATTGGGTTATTCTAGAAATACTCTGTATTTTGT
TATCGTCTCCCTTTTTACTTTACAAATAGTAGCTCTTATTAGAGCGTGAT
CAGTTCTGTTTACCAATAATCCATTTCAACCGTGAAATTGTTCATCGGTA
TAGGGGGTTGTTATATTGTTCTTGGAAGTAATAACATTCGAGAGATTCAT
CCCTGACGGaatatttataattttaaaatcgaaattgaTGGGAAATTGGT
TCTGTTTTCATcaccatttgaaattcaatggaaaaatattgcattccaaa
accatccccacttgGGTTTTTGACCTTGATCCCCCTTTGGACTTCGATAG
AAATGTTATCTCCACTGTTgtgggaagaagttccaccggggctgtgagac
atgTGTCATAAAGCTTTTAACCAATGAGAGATTTTGGCACTGCCACTTGT
GGCTTTTTATGAATATCGATCAAGTTTATATTGTAGATATTTTTTGAATC
AATTTATATAAAAGTAAAGTGACTctatattttttagtatttttaataaa
ttatatgaaaatataaaggaataacaaaaatttaaaaattcatacTCTA
Run BLAST on NCBI

transcript from alignment at sc0000018:363997..375731-

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00002138 ID=TCONS_00002138|Name=TCONS_00002138|organism=Clytia hemisphaerica|type=transcript|length=11735bp|location=Sequence derived from alignment at sc0000018:363997..375731- (Clytia hemisphaerica)
AAAACAAACCGAAAAATTAAAATGTAAAAAGATGTTTGGATACTTTTGGT AAAATCTCGATGGTTCCATAATGAGTTGCTACCATCGTAATAATATTGTC TTGGATTCGGCTATTGAAACTTAATAACAGTGAGTGATTCATTCTTTTTA TTTTTACCATTTGATTTTTTATTACTTGGCTGGTTTCATGCTTCCTGAAC GGGGTGGGAAAAAAGTTACTCTTAGGTTCCAAATAAACGGCAAATTCTCT ACTCCCCCCCCCCCGGCCCTTTTTAGGACCCCTCATTTATTATTCTTTAA GAATATTTTCAGCTGTCAAAGAGATGACCCCTTATTTTGCTCTAAATAGC CTGATTTTAGGCTTGAAACTCAAAAAGTTAAGAACATCCCAAGGCTTTTT TTTGGATTTTGGATGTTTTATAACAAAAAACGTGTAGCTTGGAGTTGTTT TAGGAATAGACTACTTCCATTTTTTGTTCTTGTTTATATTGGTAAAAAGA AATGTTTTAAGCTCATGGGCCACTGTATTTCTTATTTAGACTTTCCTGGC TGGTCTTTAGTATATATCCATATCTCACTGGTAACAATTCCGAGAAACAG CGCTTGTCAATCTTGAGATTTTAAGCCCACGTCACTAAAAAACAGGATGG TCGAAGGGTTAAGACTCGTTATGCTCGTGTTATAAGGTATGCACAATACT AGTGCTATATTCCAAACCCTGTCAATCCCCCGGGGGGGGGGGCACTCGAT TTCTAAACAACGGCATGTGCCGTCAAAATATTGGCTTTCAAAATCAAACC TTTACAGTGCAACCCTTGAGCAGTGAAAAGGTACCCTTACAGTGCATTTT ACCGAACGTTTCTGACCCTTACAGTGTAGCTTGATTTCATATCTTATTTT GCTGAATCCATCTGAAAATGAGCCTAAGATGTCGATACAATGTGCAAAAC AAATTAAAATGGGTGCGAGTCAAAACTATAAAGATACATCCGATTTTTAC TGTCAGACTTGTTATTCAGCAGTCCCCAAATATACCCTTACAGTGTATCC AGCTAAACGAACACCTTTGTAGTGTACTCTATCAAAATACACCTTTACAG TGCATTTCAAGGGTCTCGAAAAACCTAGCCTTGAGGGTATGTGCTACCGT GGGTCGGACCATATGAGTGATCCCCCAGAGCTGTCGATACAGTAGTAAGA ATTTTAAAATCATAAGATTTAGACATCGATACTGTATAGCATTGAATATG CATTTGTTTTTTTATAAAAACATCCAAAAATTTTGAAGCCTATGGATGTT CTTAACTTCTTGACTTTTGAGCCTAAAAATGTTCTTAACATATTCTTATT TTCACTATTATGAGAGTATTTTTTGTCCATTTTCCAAAGAAAATAGATGT TTTAGGGTCTACAAAGCCTTAAAATGTTCATAACTTGTCCTTAACATTTT GGCCATCGAAGCCTTATGTTCTTATATAGTTTGTTCTTATAAAAAAATCA TGTTGTGTATAGCACTGAATAAGTGTCAATGTTTATCATTGAAATTAACG TTTTTAAAGGAATACACAGGAAAGTATCTATCCTTTTCTTTTTTTCTCTT TCTTTACTCGTTAAATCTAATCCTACTTTGTCTTAACACAATGTTAAGAT GACAGCTTTGTTAATTTTTTTCATTTATGTATAGGTTACCCGCTGTATTA AAGTAATCTATTTTTTAGGAGTTATTAAGTTTTTAAAATGGCTTCCAGTT CAGTCTAGTTTGGTTCTGCTTCGGTTTGGGCCTTTTACAGTTGTCCTGAT GCTAAAACAGCGACAATATATTCTATTCTTTTCTAATGAATGGTGTTATT ATGATCAAAGAAAAACAAGTTTTGAAAAGAATAAAATGTAACAAGACACT TTCATATATGCGTCACTTGATGGTCGGAAAATGACTTGACTGACTTCTAG GGACTCTTGTGTATAATAACACATTCATGTCAACGTGGTGTAATGTCTGA TATGTGGAAAAGATTGTTTTATGAAATCTAAACTTGAATACGTTGTAGTT GTTTTCAGAAGGATGGCGTTTACGAATTATAGACTTATCAGGACTAATTC AGTAGCGTAGCCAAGGGGGGGGGCGCAAAATTTGTGTAGGAGAGTAGATT TTTATGACACAGTAATTATATTTTGTAATTATATATCTGATAATTATAAT TATAGTGTCAAAAAAATCTGCTCTCCTACACAAATTTTGCGCCCCTCCTG TCTACGCTACTGCAATTAAGTAAGTAAGTCATCGACCACAGTCAAAGGTG ACTTTGAAGGCTCCTCTTTTGATAGCTATGGTAAGAGAGGGTGACACTCT TTCTGACACTCTTTCTCCCTGGATTGCTCCACTAACCCTTAATCTTTATC TTAATTTTGGAGCATTAATCAGAAAGCATCAAGTTTTATTTTGTACTAAG TACGAAGTTTTTGGTATAATCCTGTCTGGGACACACGACCTTGCGTCGGT GTTGAATTCTCTACGTTTGCACTACGGCCAGGCCTACACCAAAGCCTGTC TGAAATGAAACTAGTTTTGAGTTTAATTGGGTCAAATGACCTCAAATCCC AGAAGTCATTGGATTGATGTAATACACGTTTTTTTTATGAGAACATCCAA AATGTTTGAAGCCTTCGGATGTTCTTAACTTTTTCAGTTTTAAGCCTAAA AATGTTCTTAACATGTTCTTATTTTGACCGTTTTGTGGGTATTTTTGACT CTTAAAATGTTCTTAACTTGTTCTTAACATTTTGGCTATCGAAGCCTTAT TTTCTTATATAGTTTGTTCTGATAAAAAAAAACGTTTAACAACTAAAAAG AAATTTGACGTCATTTGGCCCAAACCATGTGTTTAAAGCTTGAGAATTTT TGAGTACTATAAACCTTTTTCCATGAAAGCTTTTTAGTACATAATTTTCC AACTTTGAACGTAATTTGAATGGTAGTACTGTATTTGAGAGTGGTAAGCA GTCAAAGTGAACAATCAAAGAAAAAGTTCTTTCCTATGTGATCCTAGCCC TTTCTACACTATTCTTATTCATTGAGTGTATCATATCAGTTAAATAGTTT TAAAGATTTTAGCGTTGTCAAAAGTGAGCCAAATCAAATTTCTAAAGCGG CTTTGCAGAAAGCTAAGCTCTATTTTAATTTGCTTGGCTACGAAAAGCTC TTTAACACTTATATAAAATGTAGCCACAATATATTTGCTATGATGATTTT CTTTATCACCCTTACACAACTTGTACCTATATACAAGCTGTTATTGTAAG CAGTTACTTTTATAATCATTCTCTCGAAATAACCATACCAGCCTTCTCCA AGGAAACGGCAAAAAGATTTCAAGTAGTAATGTCCCCGCAATGGACACGT CAAATCGCTCGGCTGAAATGGGCGTTTTTTTCTGTAAGAACATACGGTTT TGAGGCCAGAAATTTAAGAACATTCTATGAGCATTTTAAGGCTTTTTGCG CTCTTTTACACAAAAATACCCACAAAAATGCAGAAAATAATGACATTTCA AGAGTACATTTTTAGGCTTTAAACACACAAAGTTAAGAGCACCAAAACAG ACCCAAAGGGATCAAAAATCACCCTTACAAAACTTGAAGCTGTATACAAA CTGTTATAGTAAATAACTTTCCCCGAAATAGCCCTAACAGTCTTCTCCAA GGGGCCGACGGAATGATTTTGAGTAGTAAGGGCCTATTAGAAACGTCAAA TCCCAAATATATACTGGTATACATTCTTTATTAGAATACACGGTTTCGAG GCCAAAAATATAAGAACATTCTAAGAAAAGTAAAGGTTTTGTGCGCTCTT GAAAATTAGGTATAATAGTCACAAGAATGCTAAAAATTATAGCATTTTGA AGCCTTTTAAAAATACATATCTGTACTAGTTTTAAGGCCGATAATGTAAA TGTTGAATTTGAATACAATATTACATTGTTGTGTGAATAGGGGTTTATGA ATCATATTGAAATATTTATCACGGTACACAATAAGCCTCTAAGCACATTT TCTTTCGATTGTTTGATTTCTTAATTCACAGTTAGGTACTAAATTCGTTA TTGAAAAACAGTAAATTTTTGTACGGTCTGTAAATTATTAACTTTTATGA ATTAGATACATTGGCAGTGAATATTCACATGTTTGTTAAGAATTATTAAA TTTTTATTGATTTTCGTATTCTGCTTTTCTTTAGGTATCATGTAATATTT TCCATACTAGCTGTGTCCTAAATGTTTTTTGGATTTTCGTTGAAAATTAG AGTAAAATTATGGATTGAATTACCCTGGCGCAACGATAGGCTGTGGTTTT GGTAGATTTTTTTTTGCTTTTATAAAGAAAAATATGGGAATATCACGCTC CCATAGGTTTGGTTGTCCTTTTTCTTATGTTCGTTTTTCATACTAATTGA AAAGGTATTTGGGAAAGAACCTCTTGCACTCCTGAACCCATGAGATTGGC CAGTTGATACATACTGTGTTTTCTGAAGAGTTCTTATTGTCTAAATCCTG ACTGACTGAGGGCAACGGTAAATCACCACTTTTACAGTCCTCGACACTAT TGGCAGGATTTACGGGGATATGGCGGTACTGTTCAAGAAATGACATGTTT CCTGTCATTTAATGATTAATCTTACNAGATTTACGAGGATATGGCGGTAC TGTTAAAGAAATGACGTGTATCTACATGTTTCCTGTCATTTAATGATTAA TCTTACCGGATTCTCTTTTCCATAAAGTTTGTTTTTGTTAAAAATATAAA AACGTTTAGCTAACTATAGGCGTTTATAGGCACAAATAAAGTAGCAAATT ATTTCAAAATTCAGTTATCGACCAAGTACGGCTTGAGTTAAAGATGATAC TTTAAGATTTTCTCTAATTTTAATGCTCTCAGAAATATCTTTTTAAAGGC ATCTATTGTTTTTTTAGGTTTTGCATTAAACTGTCAAATAAAGTGCATAT TATAAGGTTTTGAGAGACTGTTCTTAAAATTAAAGGGGTTTAGACTTGAA TGTTTTCTAAACAAAGTCGTATTATAAGAGTTTTGACCCTATCATAATTT CCTTCATGTTAAACGTTGTAACAAAATAAAGGTCGATATCTCGTGGTGAT TTTTATTACCTTAAAGAATCTAAAATGTTGTTAGAGTATTTTCGTACAGT TTGACAAATTGTATGACTGGCCTGGTTGTTGGTCTTTGTTAACCTTTAAG TCGTATAACTTTGATCAGGTTAGAATGTTGAACTAAATTTTGTAGTTTTT TATTTTCAATCAGTTGTTTTGCACGTGGTAATGATATTATTGGACCTTTT TAAATGTAACATTTTCTTGATAATCAGTACATGCAACGAGATTCATTTTA CATGGTATTTATCTAACTATTTTGGTGCTGCAAAAGTTTAGGGTTCATTC CCACTGGGTCTTTGTGACGCGGGGATGTTTTTATTTATCGAATAAAATGT CACTTTAAATCTCCTTCGTTATATCATACCATACCATTTTCAAAAGTTCT TTAAATCTTTTCTAACATTTTTATCAGTCACTCATATCAATTAAACTCTT GTAAGATAACCGGTAAATCCTACAAACATTTCCATTCAAGTCTTGTCATC TTGTAATCCAACTTTTACAAGTCCTCTTGACTCATCTTTAACAATATATT GATTTTCTACCATGTACATCAAGGCGTAAGTAAATGTAGATGAAACTATA TGCAAAAGTTAAACTTTTTCTAATGCTTGGATTTCTTGCTTTTTCAAGCA CGCAGTCATCAGTTGGTTTCATTAGTTAAGGTTAAGTTATTTGAGTATGT AAAAGTTGAAATTTCATATGGAAAAAAGGACTGCATAGGCGGTTTTAGAC CATGTCGAACTCAGAGGAAGAGATTTGTAATTGTGATTTCATTGTATTTT AACGAGCGTTGCACTCCTTCGCATGTTTCCAACGTACTTGCTCTATTGTC TTAACTCCGCCATTGAAAGTAATTGCGTTTTCTCAATTCTTCTAAACAGT GACTTTTAGAATGAGCATATTTTACCAGCTTTTATTTAAATTAGTGGAAT GGTTTTTAAGCTTTTTGGAACAGGCTTTCTGTATCAGTGAAGCTTACATG TAAAACGGATAGTGCCCATCCAATTTTTAAACGGCGGCATGTGCCACCAT ATAATTGGTATTCGAAATCGGACCTTTACAGTGCAGCTTTTGAGCAGTGA AAAGGTATCATAAAGTGTATTTTACTGAATGTTTCTGATCCTTAAAGTGT GGTTTGATTTCATGTCTTATTTTGCTGAAGTCACCTGGAAATGTGCATGA AGTGTCGACAAGGTGTAAAAACAAATAAAAAATGCGAAATGGGTGCGAGT CAAAACTATAAAGATAAAGATTTCTACTGTCAGACTTGCAATTCTGTAAG AATTATCATTCAAAATCTTTGTTATATCCTTAAATTTTTTTTTCATTGTC CATCCAGCTAAAAAATAGACCCTTATAGCGCACTATCAAAAGTATACCCT GCAGTACATTTTAGGGGTCTTGAAATACCTACCCTTAAGGCGGCTAACTC GATTTGAGTCCCCCCCCCGGATGTAAAAATATGTTTTTATAAGACGAGAC CAATTTAATTTGTTGTTCTACGGGCGCGGCCGACCCAGTATTTGCTGCAA ACGAAAAAATAATAATATTGAATTTCCTGTGCCAGAAATTTCCAATAATA AGTAGTCATTGAAAAAATTTACACTTAAAAAAGAATTTGAAAAAAGACTC TAGAATCATGAAATCTCNGATTTATGTCTGCAGTTTAGTCTAAAATCTTC CAATCAAATTATAAGAGGCCAAACAGTGTACGCGTCACCGAGTTCAATTT CGTATTCTGTTGAAGTTTTTCATATGAATATGCTAAAATACTTCAAACTT TTCAGAAGCTTTTACGATGAAGAATTTATATTTCAATGAATTTAACAAAC ATTTATTCAAACAATATTTTTCTATCAACCCCCTTGAACAATTTTTCCCT ATATTTTTGTTTCAAAATTATTATCCTTTTTGATATGATTTTTGGTAAAT TTCATTAGCTATTAGAAACTCTACAGTGATAAAAATTTATTGAATGTCTC TAGATCTGGCCCAATATAAAGTGTGACAGTTTGGAAATAATTACCAGGTT AGCGAGTATCTGTAACTCGAACACGCGCAGGAAACATAAATTGTTCGAGT TAAGGAAACATTCGAGTTGTAGAGGTTCAACTTATGGAAACTACACTGTA CTAATGTCAGTAGAATACTTCTCGAAGTACCTAAATCCTTAAAGGGCCCT TAAAGTAAATGGTAACGGGAGTATTTAAAAAACATATTTATTGTTATTGC GATTTTCAGGCTTGACACTTAGAAATTTACTAGCATTTCTATATTATCTT ATATTTAGGTGAAGAAAAATTGAAAGTGAAGATGGGAACTTGAACGGAAT TTCTCGAATAATACTCAAATACCAAAGATTTCTGACTAGAAGAACATCTG GAACACGAGAGAATATTTTATACGGCAATCATAAATTGAGTAGTATACAA ATGCCGAAAATTTGATCAACAAAACTCATTGAAACTAAGTTCATCAGACA TTAAGAACCTCAACTGTATTCAATACTATTTACAAGATGGTTGGAGCATC ATTCCGCAGAGAGTTCCATATGGCGTTTCTTCTTGGTTTATCCTTCGGCT TCTTTATTGCTGTCATATTTCGTGAATTGCAATCTTCGTTTTCTGAAACC AAAGATTTGGTCAACAAAGGACCACCATCTGGCAGGTAAGCGTTTATTCC GATTTTACCATTATATCCCAATTAGCACAGCCTTGATTAATCCTTGAGTG AAGCAGTACACCTCAGTACATTCAAGATTTGTAGTGCTATATTAGACTTA AGAAAAGAAAACGGAGGTCTATTGCAAAAGTTTATATACAATCTCCCTGG TAGACGCTGAAGTATAGAATTTACCACCTAGCTCTTATCTTAAAGATGGT TTCCACTATCGAAGTTGTTTGACAATATTCAACAAAGCGTCAAGAGAAAG TACCACTCCTGAGTTGGATAAATCACGATAGCCTGGATAAAAGTACCGTT GCACAATAGAAACTATAAGCGTCAATAGTCGCAAACTATCTGCCGAACCT TAAATATCTTACCTACCTCTACAAGCTCATTCATTACGTATTATCGCATT TTCCATTCTTCCTTATCACAGGAAAAATTAAATAAATCACCTTGTCGGGG AATGTACATGTCACACCTGAGAACATGAATGATTTTCCCACCCTGGTGGA ATTCCTGCACATTCCAAGGCGTGAAATGCTCTTTTCCCACCCTGGTGATC AGCTCAATTTTTCTTGTTGATAGCTCCAGATGATAAGCATGCGTCCATCA GTAACGTAAATAAAACCTGGGATAGAAGAGGAGGTTGCTACCTTCATGGT TGCACGATCTAATGTAATTCTTTCTTGTAATTCTTCTGATCCAATAGAGC AATGGAAGAAGATTATGCCATGCTATTAAGTGAAGAATATGAAGGAAAAC ATTTGCCACCTCCTTCCAAACCTCAACCTGTTGATAAACCAATCATATTC AATGATCTAGATTCTATACATCATAAAGGTATATTACAGTCCCTATAACT CGAACCTTTATTACTTGGAATGTCTCCTTAACTCAAACATTATTTTGAAA GATCTTATCTTTCCTTGATTTGAAGTAAAAACTGATACAAACATCCCATC TTACAGCTTTGGTTGGACTTCTTCCCACAAGTAGGAAGAAAATTTCCATC GAAATCCCGATTGGGATAGAAATCTTATGGTTTAAAGGACAAAGTCAAAA TTAATTCTTTAGTTAATGATATATGATATAGAAGGGAACATGATCTCTTA TGCTAACAAAACATTAAAACAATCCAATCGAATTTCTCAAAGTTTGTTCT CGCGCGGTGCAGAAAGAAGAAAGAAAAGTTGATCTTTCTTTTTGTTTAAA AATGCTGTGTAATCGAATAGTAGGAGGTACGTTAAATCATGTCGTATAAG GATAGTCAAATACCAGCGAAACTTTTTTCTCACATTTTCAGGTGGTGACC GAGTTGCTAAATTACTTTCGAAGAAGGTTCGAATTCTATGTTGGATCATG ACGCAACCGAAAACATTGAAAACCAAAGCACAAGCTGTCAAGAACACGTG GGGAAAACGTTGTAATACACTGCTGTTCATGAGTTCAAAGGGTGATAAAG ATTTCCCAGTAGTTGGGCTGAACGTACCAGAAGGTAAAATCTCATTTGAT GAGAATTTTATTTCAATATATTATATATAGAGAGGTTTATCTAAAGAATC CTGCATTACTAAAAGTAACCAAAAGAACGACAAATTTCACCATTCATAAC CCCGACAGAAAGTGACCACCCTTACATATTCATTCCTTTTTTATTATCAC GGGAATTAACTACATGCGGTTTAAAAGAACGACAAATTATGCATGCGTGT TACAATGCAGAATTCTTTAGAGGGACAGACTGATATTATTACCTGATATT ATCTGATACCATATAGGTTCTATTCTTATTTTTATGTTTTGGACGTTAGA TAGAAATTGTGTTGACGTTAGGCTTGGCTGGTAGTATCCTCTTATATGTT CTGTTATAACTTATGATAAAAATTATCTTTGTATTATGCGCGGCCAACCT TATTTTGGGCGGGGTTGGTTTCGCTAAGCTTTTCATGGTGTTTCAATGCA GATTCTGGAGATGAGTTTGAAAAAAAAATTCACAGTGTACAAGCCAACCC AGTTTCTTAACCACCTAGCCTGGTGTGTTGGCAAACGATATCATACTCCA GGATGCAAGTGAAATTTTTCAATCCGCGGACGTAGACGGGGGTTTGGTTA TTATCAGTTAGGATTAGCGTTGGAGCTCGAGAGTCACAATATCAGGCCGA AGGCCTTCTTAGGGGCATTCGCACCCTGTGACTTAACTTTGGATCCCCTA GGGATCCTTGTAGGGGCACCGGTAGGGTTGGGAGCTTTCTTAATTAAGGT CTGTAAATTACACGTTATAAGTATTTGTGAATGACAGCTTTTTGTCGTGT CTCGATGGCGCAAGCGGTTAGGCTGGTATGTAAACCAAGATTGCTTGCAT TTGGTGGTTCGAGCCGGGGTCGATGACCTGTTTCACCGGTACGGGCAAAT TTCAGAAAAATACTTAGAAAACGGTTAGAAACACTTGAGAACGATAGAAA ATCAGGATAGAAGATAAGAAAGTAGAAAATAGGGGGAAAATAAGAGACGA TGCATCCTGGAGTATGATATCGTTTGCCAACCTAGCCAACCACCTTCCAA ACTTAGTCGGCGTCTCTTAGACTGTTTATTACCTGGCACGTTGGTAAAGT CAGCACTATTTAGCACTTTTTATCTGTGTTTTCTTCTAATCTTGCTTTTA TTTCTTTTCATCCAGGTCGAAAAAACTTGTGGTTGAAAACACGCGCAGCT TGGAAATATATTTACGAGCACCATTTCTACGACGCTGATTGGTTCTTAAA AGCCGATGATGACTCATTTGTCGTTCTCGAAAATCTACGTTATTTCTTAT CAAAGCATAATTCAAGTCAGACTCATTATTTTGGGCGACATTTCCGCCCT TTTGGCGGCTACAACTCTGGTGGGGCGGGCTATGTTTTCAGTAAAGCCAC CCTGATAGTATTCAACCAAGTACTACGTGATCCAAGTGTTTGCAAACTAA AAGCAGGCGCCGAGGATGCAGAAGTAGGCGTTTGTTTACGAATGATGGGC GTTGTGCCCGGTGATACTAGAGACGAATTTGGGCGTGAAAGTTTCCACCC GTTTGCGCCTGATTATCATTTAGTACCGAATGGTATACCCACTACGAACT GGTTACATAAATATAATAAACATCCGGTCAAATCGGGACCTGGATGTTGT TCAGACCATAGTATAGCTTTTCATTATATTCCGCCAAACCGGATGTATGT GATGGAATATTTTATTTATCATTTGAGGCCGTTCGGTGTGCACCACGTAC ACAACTGACATCATTCAGCCTAGTTTGCTACAAGTAGTGCTCTGAATGGT GACATTGGGTTATTCTAGAAATACTCTGTATTTTGTTATCGTCTCCCTTT TTACTTTACAAATAGTAGCTCTTATTAGAGCGTGATCAGTTCTGTTTACC AATAATCCATTTCAACCGTGAAATTGTTCATCGGTATAGGGGGTTGTTAT ATTGTTCTTGGAAGTAATAACATTCGAGAGATTCATCCCTGACGGAATAT TTATAATTTTAAAATCGAAATTGATGGGAAATTGGTTCTGTTTTCATCAC CATTTGAAATTCAATGGAAAAATATTGCATTCCAAAACCATCCCCACTTG GGTTTTTGACCTTGATCCCCCTTTGGACTTCGATAGAAATGTTATCTCCA CTGTTGTGGGAAGAAGTTCCACCGGGGCTGTGAGACATGTGTCATAAAGC TTTTAACCAATGAGAGATTTTGGCACTGCCACTTGTGGCTTTTTATGAAT ATCGATCAAGTTTATATTGTAGATATTTTTTGAATCAATTTATATAAAAG TAAAGTGACTCTATATTTTTTAGTATTTTTAATAAATTATATGAAAATAT AAAGGAATAACAAAAATTTAAAAATTCATACTCTA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_001114XLOC_001114Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00002138-exon-sc0000018-1575043694:375603..375731TCONS_00002138-exon-sc0000018-1575043694:375603..375731Clytia hemisphaericaexon
TCONS_00002138-exon-sc0000018-1575043694:367897..368273TCONS_00002138-exon-sc0000018-1575043694:367897..368273Clytia hemisphaericaexon
TCONS_00002138-exon-sc0000018-1575043694:367054..367184TCONS_00002138-exon-sc0000018-1575043694:367054..367184Clytia hemisphaericaexon
TCONS_00002138-exon-sc0000018-1575043694:366399..366590TCONS_00002138-exon-sc0000018-1575043694:366399..366590Clytia hemisphaericaexon
TCONS_00002138-exon-sc0000018-1575043694:363997..365216TCONS_00002138-exon-sc0000018-1575043694:363997..365216Clytia hemisphaericaexon
TCONS_00002138-exon-sc0000018-1510915933:375603..375731TCONS_00002138-exon-sc0000018-1510915933:375603..375731Clytia hemisphaericaexon
TCONS_00002138-exon-sc0000018-1510915933:367897..368273TCONS_00002138-exon-sc0000018-1510915933:367897..368273Clytia hemisphaericaexon
TCONS_00002138-exon-sc0000018-1510915933:367054..367184TCONS_00002138-exon-sc0000018-1510915933:367054..367184Clytia hemisphaericaexon
TCONS_00002138-exon-sc0000018-1510915933:366399..366590TCONS_00002138-exon-sc0000018-1510915933:366399..366590Clytia hemisphaericaexon
TCONS_00002138-exon-sc0000018-1510915933:363997..365216TCONS_00002138-exon-sc0000018-1510915933:363997..365216Clytia hemisphaericaexon
TCONS_00002138-exon-sc0000018-1491911889:375603..375731TCONS_00002138-exon-sc0000018-1491911889:375603..375731Clytia hemisphaericaexon
TCONS_00002138-exon-sc0000018-1491911889:367897..368273TCONS_00002138-exon-sc0000018-1491911889:367897..368273Clytia hemisphaericaexon
TCONS_00002138-exon-sc0000018-1491911889:367054..367184TCONS_00002138-exon-sc0000018-1491911889:367054..367184Clytia hemisphaericaexon
TCONS_00002138-exon-sc0000018-1491911889:366399..366590TCONS_00002138-exon-sc0000018-1491911889:366399..366590Clytia hemisphaericaexon
TCONS_00002138-exon-sc0000018-1491911889:363997..365216TCONS_00002138-exon-sc0000018-1491911889:363997..365216Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000018supercontigsc0000018:363997..375731 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
1.86725 3.1776 1.58565 0 14.4809 13.6906 9.60258 16.7787 4.32711 1.3911 2.83766 1.1559 0.310462 1.72559 2.65072 1.70677 3.85478 3.23265 1.98493 1.55781 2.2567 5.28356 5.88762 4.37948 9.52293 14.7066 1.92028 0 1.03625 3.69521
Blast
BLAST of TCONS_00002138 vs. Swiss-Prot (Human)
Match: C1GLT (Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 OS=Homo sapiens GN=C1GALT1 PE=1 SV=1)

HSP 1 Score: 285.804 bits (730), Expect = 5.698e-89
Identity = 146/340 (42.94%), Postives = 205/340 (60.29%), Query Frame = 1
Query:  391 MAFLLGLSFGFFI-AVIFRELQSSFSETKDLVNKGPPSGRAMEEDYAMLLSEEYEGKHLXXXXXXXXXXXXIIFNDLDSIHHKGGDRVAKLLSKKVRILCWIMTQPKTLKTKAQAVKNTWGKRCNTLLFMSSKGDKDFPVVGLNVPEGRKNLWLKTRAAWKYIYEHHFYDADWFLKADDDSFVVLENLRYFLSKHNSSQTHYFGRHFRPF--GGYNSGGAGYVFSKATLIVFNQVLRDPSVCKLKAGAEDAEVGVCLRMMGVVPGDTRDEFGRESFHPFAPDYHLVPNGIPTTNWLHKYNKHPVKSGPGCCSDHSIAFHYIPPNRMYVMEYFIYHLRPFG 1401
            + FL G + GF + + +F  L     +T+  V    P  R  +++    L    EG+              + FN   S H      +A+ L +KVRILCW+MT P+ L+ KA+ VK TW +RCN +LFMSS+ +KDFP VGL   EGR  L+ KT  A++Y++EH+  DADWFLKADDD++V+L+NLR+ LSK++  +  YFGR F+P+   GY SGGAGYV SK  L  F    +    C   +  ED  +G C+ +M V  GD+RD  G+E+FHPF P++HL+   +P T W   YN +P   GPGCCSD +++FHY+    MY +EY +YHLRP+G
Sbjct:   10 LTFLCGSAIGFLLCSQLFSILLGEKVDTQPNVLHNDPHARHSDDNGQNHL----EGQ--------------MNFNADSSQHKDENTDIAENLYQKVRILCWVMTGPQNLEKKAKHVKATWAQRCNKVLFMSSEENKDFPAVGLKTKEGRDQLYWKTIKAFQYVHEHYLEDADWFLKADDDTYVILDNLRWLLSKYDPEEPIYFGRRFKPYVKQGYMSGGAGYVLSKEALKRFVDAFKTDK-CTHSSSIEDLALGRCMEIMNVEAGDSRDTIGKETFHPFVPEHHLIKGYLPRTFWYWNYNYYPPVEGPGCCSDLAVSFHYVDSTTMYELEYLVYHLRPYG 330          
The following BLAST results are available for this feature:
BLAST of TCONS_00002138 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
C1GLT5.698e-8942.94Glycoprotein-N-acetylgalactosamine 3-beta-galactos... [more]
back to top