Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00002129 (transcript) - C. hemisphaerica

Overview
NameTCONS_00002129
Unique NameTCONS_00002129
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1502

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00002129 ID=TCONS_00002129|Name=TCONS_00002129|organism=Clytia hemisphaerica|type=transcript|length=1502bp
CTTGGTGACGGTGCCCCATTTTGCTTAAACagACTGTGCGAGCAtttcaa
ataacaataatggtgtCATTTTCAATGTAATAACAGATAGCTATTAACTG
ATAACAGATTTTCAAAGTATGAAAAACTTCGTTTCGGAATAAACCATGTG
TGATGCCGAGAGCGCCACCAGATACAAATCGGATGAAATTATCTCCCACT
AGTGGACCCATGGCGTATAACGACTTCCGGCCGCGGCATTCATACGTCAA
AAGGTCAGTGTCTAaacagtttgtttttatattaaATTCTTCCTCTGGAT
CCTCGCGTAGTAAATGCTCCTCTTTGATGAAGTCCAGATTCGGTTTTGAT
CCAACATGGATGATGACTCGGCTCACGTGAACTTTGAACGAGGCACCGCC
CTTTTTACCACATGGCTCAATAAGTACTTCCTTATTGGGTAAGATTTCGG
CCAATCGGTGTTGAGGAAGTGGCGTGTAAAATTCACATTTTGATTTGAGC
TGTATCAGcgattttaatttcaaatagtCTGCGTAGGCAGACGATAATTG
GTTTAGAACGAGATTAGGGTCTTTAGGCGAACGTCTGAACACGTGTATGA
CTGGTATCTGTCGTGAGATGAGGTAAAGGACTGCGTCTGCTGCAACTAGC
CCACATCCTACTACAACCACAGGGCATTTGTGTGTCTGGAGTCGATCGAA
ATCTGGGAAGTGGTGATGTACGAAGGTGAAGTCTTCACCAGGGATCTCGA
GTTTGCGTGGATTATTGAAAGCTCCGGTTGCCATAACAATGTTGTCCGCT
TTCACGGTATACGTTTCACCTGTTTGTTGGTCTGTATATTGAACGCCTTC
CACCGTCCATTGTGACGTGTTGGATAAGCTCTGTGAGATGGATTTGACGT
AAACGTTATCAACGAAAAATGATGATAAGCCCATATATTTGACATAGTCG
GAATAATAAAGCCCTATATAATAAGGGTTTGTACGCTCTGGATGTACACC
ACCGACGCTGGGAACTTTTGGTAGATTACCAAGACTCAATTGTTTCTGTT
CATACCATTCATTGAATGTATATCCAGGTAATTCCAACCAGTTTGCCAAA
CTAACAGTCAATTGTGAGTTAATCATATTATGCCATGAACCACCTGGTGG
ACCGAATCCAAGAACAACATGTCGGACTTCATTTTCGGGTAAATATTTCC
ATTCGATAACCGATTCGNCGGTGGACCAAATCCAAGAACAACATGTCGGA
CTTCATTTTCGGGTAAATATTTCCATTCGATAACCGATTCGGGTTTGGTC
AACATATCAGCATTTGGATGGTATAAATGGTCGAAGAGAATTGATACAGG
ATTCATGGTTCGTGAATCGAACAAACCTTCGCTCAGCCATTGTAAATCCT
GCGGAAATGAAGAGAATCAAATTCTTTATTACATAGAAAAAGACAACTAC
AGATGAACATTCTTCAAGTGatataaaaatcaaatatgAATTTAAAAAGT
TC
Run BLAST on NCBI

transcript from alignment at sc0000018:321428..325689-

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00002129 ID=TCONS_00002129|Name=TCONS_00002129|organism=Clytia hemisphaerica|type=transcript|length=4262bp|location=Sequence derived from alignment at sc0000018:321428..325689- (Clytia hemisphaerica)
CTTGGTGACGGTGCCCCATTTTGCTTAAACAGGTTAAAATTTGAAATACC CTTTACTTTATACCCTCAATATGACAATAATACCCTTTCGAAAAAGTCTC AAAATCATAATCTGATTGAACGTTTTTTTTTCTCTAGTACTTCCTAGTAC TTTGGATGAGGGTCAAGTATTCTTAACTTATTAACACTTGACTTTTTTAC AAACATGAGAAATGATCAATTTGAGAGTTTTGGACTTTTGAGTGAACATT TGGGTTAAAATTACATTTCTTCCTCAAAGCTTTCAATTTATCTCTAACAA AGAAAGCAGTTTTCTTCTGTTAACCAAATACGAAATAACTTATCAAATAA CTTATTCTTATCAAATTCTGTGAAATTCACACTAGAGGGTATTCTTAGGG TATTCTAAAGATTTGGCCAATTTTCACCCTGATATTCTTATAGAAGATAT TCTTATAAAAAAAGCGTGAACCAGCCACGTGTGGTCGAGTCCCACTAAAG ATGCTACAGATCCTAAAGGTTAGCCTATTACCTAATGGACGGGGTTGGTG GGATTAGCAGGGTAGGTAGAAAAATACAATAAGACTAGGGAGGGGAGTTT TCCTTAGTGGAAAGCTTGTAAAAGGCGACTAACAAAAAAAAACTACTTCA AAATTTCGCTGCTCAAATAAAAAAGTGAACCAAGGTTTAGCATTTTGCTC TTTAAGTTCCGTTTTCTTTTTACTTTCTGTTATTTTACCAGGTTAAATTT TCTTGTAGTTGTTGTTTTTTAATTTTCTTTTGGGCTGAAATGGAATGAAA TATGAGATTGGATTAAAGAAAAAAAAACTAATTAGTTGAATAGTGCTTAA AACCAGAACCTGTTACTCGAACTTTCCGAACCGACTTTTCACTCAAACTT ATTGAACCCCGGAGGGGCACTCGATTTCTAAACGGCGGCATGTGCCGCCG AAAATTGCCTTTCAAAATCGGACCCTTATGCAGTTCTTGAGCAGTGAAAA GGTACCCTTACAGTGCATTTTACCGAACGTTTCTGACCCTTACAGTGCAG CTTGATTTCATATCTTATTTTGCTGAAGCCATCTGAAAATGAGTCTGAGA TGTCGACACAATAATGTGAATTAAAACTGTAAAGATACACCAGATTTTTA CTGTCAGACTTGCAATTAAGTAGTTCTCGAACACACCCTTACAGTGTATC CAGCTAAAAGAACACCCTTGTAGTGCACTCTATCAAAGTACACCCTTACA GTGCATTTCAAGGGTCTCGAAAAATCGAACCATATGAGTGCCCCTGTTCG AGTAATAAGGTCTGAAAAATTTGATTTTGGAAGGTAGAAACCAAATGTCA ACTCATTAAGAAAATACAAGCTTTTTTTCGTCAACCAATATATATTTTCT GTTTTTTAAAATTTTCAATTTTCGTCAAAAAAGTGATGTTACTACATAAT ACAATGTCGTCATTAAAAAAGAAAAGAAAAAGAAAAAGAAACTGTTTATG AAAAATCCTCTTCAAAAAGTATGTTCGCTTTAAGCTTGAGGTACCTTTGA ACTTTATGTTTGTTCGTAATATAAGAGACATTATATTCCGACTAGGCTTA AGGGGTTCTTATCCAACGCTTGCGCCGAAATTGAGCATACAGTGTGTCCC AAAAAAGTAAACAAATTATTATATTAAAGTCATCATTATATATGCGAAGT TTTATGACTTAGTTTACTTGTTTACTTTCAATCTCCAAAAATTAATTTAG TCATCTTGGGAATTGAATATCTAATGATTGAACAAAGAATTCTAATCTTC AATTATTCCATTCCCCAGTTTAGATGACGAGTTTTGTGTTTTGAGGATTT TCCTTTATATAAAAATATGCCCGCTTTTTTTTGGGACATACTGTACATTC TTGTTCTCACTCGTTATAGAGAGACGAAAGCTTTCCAATAAAATTTAAGC TTCTGCGAATATTACTTTTTGAAGGATCTCCTGTTTTTATAGTTTTTAAA ATTCAGATACCATAATATCGAAAAATATTCATGCACATTTCTATTTACAA TACAATAGTTCTATTTATACTGAGACGATTAATTTGTCTGAGACGAGCAA TTTAGAAAATGAGCATTATGGAGGAGTGTACTTTTTATTCATGTTTCAAT AAATAGGATTTCCTCCACAGATCACATTTTACAAACTACTCGTCTCAGAC GATTTTTCCGTCTCAGTATAAATGGAACTAATGTTTAAAAAAAGTGTAAA ATTGGTTGTTCTTGTTTAATAAATTGGGAATAAATTACTGCGTGTCTTTA ACTTAATAATATAGCTCATAATTTCTACGACTACTAATTTTAATAATACC TTGAAATTAACTCATTTATTTTTCTACAGACTGTGCGAGCATTTCAAATA ACAATAATGGTGTCATTTTCAATGTAATAACAGATAGCTATTAACTGATA ACAGATTTTCAAAGTATGAAAAAGTAAGTTTGTTCAATCCTTATTACCAT ACTGCATTAATATCCCAACTTCGTGTTTCAAATCCCCATATGCCCTAACC TTTATATGTAAACCCCACCTATCGCCTCCAATTTTAAGGAGACCCAAAAT TTTCACTTTTAGATTTAAAGATTATATCCAAAAAGATATATTTATTTACA TCTATCTATCTACATATATTGAAAGTTCTCTAACTACTTAGCTCATTTCC CCTACAGCTTAAGAGAGCCTGTCTACAGAGCATCCTCGAAAGAAATGAGA ACCTGTTTTTAAAGTATCCTTTAATCACAAAGACCAGATATTTCAACACG TTTTTTACATCAAAAAGGTGAACCTGTATTTCAACCATCCTTGGAAGAAA AATGACCAGCTGTTTTTCACACATCTTCATTTTCAGCTTCGTTTCGGAAT AAACCATGTGTGATGCCGAGAGCGCCACCAGATACAAATCGGATGAAATT ATCTCCCACTAGTGGACCCATGGCGTATAACGACTTCCGGCCGCGGCATT CATACGTCAAAAGGTCAGTGTCTAAACAGTTTGTTTTTATATTAAATTCT TCCTCTGGATCCTCGCGTAGTAAATGCTCCTCTTTGATGAAGTCCAGATT CGGTTTTGATCCAACATGGATGATGACTCGGCTCACGTGAACTTTGAACG AGGCACCGCCCTTTTTACCACATGGCTCAATAAGTACTTCCTTATTGGGT AAGATTTCGGCCAATCGGTGTTGAGGAAGTGGCGTGTAAAATTCACATTT TGATTTGAGCTGTATCAGCGATTTTAATTTCAAATAGTCTGCGTAGGCAG ACGATAATTGGTTTAGAACGAGATTAGGGTCTTTAGGCGAACGTCTGAAC ACGTGTATGACTGGTATCTGTCGTGAGATGAGGTAAAGGACTGCGTCTGC TGCAACTAGCCCACATCCTACTACAACCACAGGGCATTTGTGTGTCTGGA GTCGATCGAAATCTGGGAAGTGGTGATGTACGAAGGTGAAGTCTTCACCA GGGATCTCGAGTTTGCGTGGATTATTGAAAGCTCCGGTTGCCATAACAAT GTTGTCCGCTTTCACGGTATACGTTTCACCTGTTTGTTGGTCTGTATATT GAACGCCTTCCACCGTCCATTGTGACGTGTTGGATAAGCTCTGTGAGATG GATTTGACGTAAACGTTATCAACGAAAAATGATGATAAGCCCATATATTT GACATAGTCGGAATAATAAAGCCCTATATAATAAGGGTTTGTACGCTCTG GATGTACACCACCGACGCTGGGAACTTTTGGTAGATTACCAAGACTCAAT TGTTTCTGTTCATACCATTCATTGAATGTATATCCAGGTAATTCCAACCA GTTTGCCAAACTAACAGTCAATTGTGAGTTAATCATATTATGCCATGAAC CACCTGGTGGACCGAATCCAAGAACAACATGTCGGACTTCATTTTCGGGT AAATATTTCCATTCGATAACCGATTCGNCGGTGGACCAAATCCAAGAACA ACATGTCGGACTTCATTTTCGGGTAAATATTTCCATTCGATAACCGATTC GGGTTTGGTCAACATATCAGCATTTGGATGGTATAAATGGTCGAAGAGAA TTGATACAGGATTCATGGTTCGTGAATCGAACAAACCTTCGCTCAGCCAT TGTAAATCCTGCGGAAATGAAGAGAATCAAATTCTTTATTACATAGAAAA AGACAACTACAGATGAACATTCTTCAAGTGATATAAAAATCAAATATGAA TTTAAAAAGTTC
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_001111XLOC_001111Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00002129-exon-sc0000018-1575043694:325658..325689TCONS_00002129-exon-sc0000018-1575043694:325658..325689Clytia hemisphaericaexon
TCONS_00002129-exon-sc0000018-1575043694:323217..323310TCONS_00002129-exon-sc0000018-1575043694:323217..323310Clytia hemisphaericaexon
TCONS_00002129-exon-sc0000018-1575043694:321428..322803TCONS_00002129-exon-sc0000018-1575043694:321428..322803Clytia hemisphaericaexon
TCONS_00002129-exon-sc0000018-1510915933:325658..325689TCONS_00002129-exon-sc0000018-1510915933:325658..325689Clytia hemisphaericaexon
TCONS_00002129-exon-sc0000018-1510915933:323217..323310TCONS_00002129-exon-sc0000018-1510915933:323217..323310Clytia hemisphaericaexon
TCONS_00002129-exon-sc0000018-1510915933:321428..322803TCONS_00002129-exon-sc0000018-1510915933:321428..322803Clytia hemisphaericaexon
TCONS_00002129-exon-sc0000018-1491911889:325658..325689TCONS_00002129-exon-sc0000018-1491911889:325658..325689Clytia hemisphaericaexon
TCONS_00002129-exon-sc0000018-1491911889:323217..323310TCONS_00002129-exon-sc0000018-1491911889:323217..323310Clytia hemisphaericaexon
TCONS_00002129-exon-sc0000018-1491911889:321428..322803TCONS_00002129-exon-sc0000018-1491911889:321428..322803Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000018supercontigsc0000018:321428..325689 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0.0688203 0.00921273 0.204788 0 1.66992 5.30841 0.443715 2.13754 7.06636 24.6255 5.41693 8.4988 8.04979 10.2747 2.93688 4.58469 2.78114 3.55196 7.98723 17.0414 0.00947919 2.10408e-05 5.26355e-08 2.04731 1.57341 0.429554 9.65838 1.62843 1.51426 0
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR023753FAD/NAD-binding_dom
Vocabulary: Biological Process
TermDefinition
GO:0055114oxidation-reduction process
Vocabulary: Molecular Function
TermDefinition
GO:0016491oxidoreductase activity
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0055114 oxidation-reduction process
molecular_function GO:0016491 oxidoreductase activity
Blast
BLAST of TCONS_00002129 vs. Swiss-Prot (Human)
Match: OSGI2 (Oxidative stress-induced growth inhibitor 2 OS=Homo sapiens GN=OSGIN2 PE=2 SV=1)

HSP 1 Score: 229.18 bits (583), Expect = 9.356e-68
Identity = 141/396 (35.61%), Postives = 199/396 (50.25%), Query Frame = -2
Query:  140 SVIEWKYLPENEVRHVVLGFGPPGGSWHNMINSQLTVSLANWLELPGYTFNEWYEQKQLSLGNLPKVPSVGGVHPERTNPYYIGLYYSDYVKYMGLSSFFVDNVYVKSISQ----------------------SLSN--TSQWTVEGVQYTDQQTGETYTVKADNIVMATGAFNNPRKLEIPGEDFTFVHHHFPDFD------RLQTHKCPVVVVGCGLVAADAVLYLISRQIPVIHVFRRSPKDPNLVLNQL-SSAYADY------XXXXXXXXXXXKCEFYTPLPQHRLAEILPNKEVLIEPCGKKGGASFKVHVSRVIIHVGSKPNLDFIKXXXXXXXXXXXE-FNIKTNCLDTDLLTYECRGRKSLYAMGPLVGDNFIRFVSGGALGITHGL 1213
            SV+ WK    + + HVVLG GPPGG+WHNM  S LT+S  +W+ELPG  F +W   K+ SL              +R  P  I  YY  YVK MGL   F +N Y+ S+S+                        SN     W + G Q     +   + + A+N+ +ATG  ++P  LEI GEDF FV H  P+F       +L+    PV++VG GL AADAVL   +  IPVIHVFRR   DP+L+  QL    Y +Y      +  +S     +    YT  P+HR+     + + +++      G      +S  ++ +GS PNL F+K++         +    K N ++ D  TYEC    +L+A+GPLVGDNF+RF+ GGALG+T  L
Sbjct:  105 SVLHWKLEQHHYIPHVVLGKGPPGGAWHNMEGSMLTISFGSWMELPGLKFKDWVSSKRRSLKG------------DRVMPEEIARYYKHYVKVMGLQKNFRENTYITSVSRLYRDQDDDDIQDRDISTKHLQIEKSNFIKRNWEIRGYQRIADGSHVPFCLFAENVALATGTLDSPAHLEIEGEDFPFVFHSMPEFGAAINKGKLRGKVDPVLIVGSGLTAADAVLCAYNSNIPVIHVFRRRVTDPSLIFKQLPKKLYPEYHKVYHMMCTQSYSVDSNLLSDYTSFPEHRVLSFKSDMKCVLQSVS---GLKKIFKLSAAVVLIGSHPNLSFLKDQGCYLGHKSSQPITCKGNPVEIDTYTYECIKEANLFALGPLVGDNFVRFLKGGALGVTRCL 485          
The following BLAST results are available for this feature:
BLAST of TCONS_00002129 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
OSGI29.356e-6835.61Oxidative stress-induced growth inhibitor 2 OS=Hom... [more]
back to top