Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00002051 (transcript) - C. hemisphaerica

Overview
NameTCONS_00002051
Unique NameTCONS_00002051
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1009

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00002051 ID=TCONS_00002051|Name=TCONS_00002051|organism=Clytia hemisphaerica|type=transcript|length=1009bp
TNTTGATATCACTGGTGAACCTGAGttTATGCAGACATGTCAAATTAAAT
ATCACAAAGCTGCTGAAGAGAAAGGTGTTCACATTGTCAGCGCTTGTGGA
TTTGATAGTATCCCTGCTGATATGGGTCTGGAAATTCTTCGAGAAAGATT
CCCAGGTGTTTTAACAGCAGCAGAGAGTTACATCCACATCAGATCTAAAA
GAGCTAATTATGGAACATATTTGACCATTATCCACAGTGTCCAAAATCGC
AATTCAGTAAAAGATCAACACAAAACCATCTTCAGACAGAAAATACCTTA
CACCGGACCAAGACTTCGTTTGAGAAATGGTGGATTCAGCAACTCTGAGA
ATCGTTGGTTCATTCCTTTCCTTGGTGCAGACCCCTCAGTTGTCAAGAGA
ACTCAATATCATGAATCGATGGTTCACGACCGAATGCCAGTCCAATATTT
CGCTTATTTCACAGTACCGtcaatcttttacatgatctgTTTTGCTATCT
TTGGAGTTGTTTTGTTTGTGTTGACCAAATTTTCTTTTGGTATCAAATTG
TTGGAAAACCATCCAAAATTCTTCACTTTTGGTACGTTTTGCAAAGAAGG
ACCAACAAGGAAGGAGATTGATGCGGGaagtttcaaaattgtttttcatG
GAAAAGGCTACAAGAAAGAACCTGAATCAAGGACAAGTGCAGGAAGACCT
GATCAAAGCATGTCATTGAAGTTCTCTGGACCAGagGCAGGATACATTTT
CACTTCAACGTGCGTCGTCGCAGCTGCTGCTACCATTTTAGATGACAACC
TCATCAACAAGGGTGGTGTTTTGACTCCTGCTTCAGCTTTCCGAAAGACC
AAATTTGTTGAACGATTGGAAAAACGAAACGTCAAAATTGAAGTGATGAA
TTAAAAGAGATTTGGGGCCCAAGTGGAAAATCAATACTAAAGCCTATACT
AAGGCCTATGTGGTACTCCTATTTCTTCTGCattaaaaagaaaaataatt
aaattgaAA
Run BLAST on NCBI

transcript from alignment at sc0000018:578858..591399+

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00002051 ID=TCONS_00002051|Name=TCONS_00002051|organism=Clytia hemisphaerica|type=transcript|length=12542bp|location=Sequence derived from alignment at sc0000018:578858..591399+ (Clytia hemisphaerica)
TNTTGATATCACTGGTGAACCTGAGGTTAGTACAATGTAAACAAATGTTT AAAATCTTTGCATATAatctttataaataaataatagcTAGGactttttc ccaatttttgatATAGGTAGAAAGTTAGGCTAGCACTTTTCAAAATAGTA CAATTGaatgttttttctttaataaaGTAATAATGATAATCACGATAATT TTCCTGAAAAGTTTCCAAGGTAAATCTGTTTTTTAATCCCTTACCAATTA AACTAGTTGGGATGATTTTCATTTGGTAAAGAAagaacaaatattttgaa aaggaaaaagagagaaaaattctAAGCAATCATgctgcttttcttttttt ccagttTATGCAGACATGTCAAATTAAATATCACAAAGCTGCTGAAGAGA AAGGTGTTCACATTGTCAGCGCTTGTGGATTTGATAGTATCCCTGCTGAT ATGGGTCTGGAAATTCTTCGAGAAAGATTCCCAGGTACCCCTGTGATTTG TTTTGCTCTCCCTCTCTCAGTACTCCATTTTTTTCAATCATAGggcaata ttatctcttttcaTCCTGTTTCGTATAGACCTACCTAAAGCTCAAATGAA TTAGCTAATTAATGTTTTAGCAATTAGCATTTTATTGAGATTGGTTTGGT ATGGGCTCGTTATATAATAGCATTatctttgattttgttttaagGTGTTT TAACAGCAGCAGAGAGTTACATCCACATCAGATCTAAAAGAGTAAGAATA GCTCACTTCCAAAGATAATCTTCACTCAGTTGTTTTCAATTTATTGGAAG CCACGTGTTTcagtatttttgtaaaatctttaattttaaggAGTGAATAC ATTCAATAGCAATAATCTCGAAAATAAATCGTTTTTAGGCTAATTATGGA ACATATTTGACCATTATCCACAGTGTCCAAAATCGCAATTCAGTAAAAGA TCAACACAAAACCATCTTCAGACAGAAAATACCTTACACCGGACCAAGAC TTCGTTTGAGGTATACCCTAGCAATATATTTTGATAGAAGTCCATAGTTC ATATTGATTATAATAACAATCATCGTGGTGTCTACGgcaccttgaaaacc ttgaaaaccttgaaattggactaagcaaccttgaaaaccttgaaattgtA ATAATGTgaaagaattctttgaaaaccttgaaaaagcaTGATTGTGACAG TATAGTAGTCTTGTTTTGGATTGGGTCCTCACTGAAGTTTTGGCTAATGC TAAAGCTCCAAAAAGTTTCTTGCTCGCATTGCTCACAATCATTTTTTATG GACCAAATGCTGGTAATAGCATCTCACGCACCTCGTCAAGTATGGTGATA TCGTACTATTTAAATCAGTTTGAGTtctgaaaaaccttgaaaataccCAA TAaatagtccaaaaaaccttgaaaaaaatcgctaaaatattgccataaaa accttgaaaaccttgaaaatcatGGAAAAATGTCCGTAGACCATTTGGCC ATTCCATTGTATATCCATACAGGgcgtggacgaacatttccagagggtaa tccaagaaaattttccagtgggtgttttatttttccaagggggtaaaaag ttattctaaaatttccagggcgTAAAAGACTaatttagttcgtccaccct cactttaaggtatgaaaagaatttttccgcTGGGGGTAActacacatttt caataattctttTCGACTTGAAAAAGTTCGTCCACCCCTGTATGTTTTTT TATTAATGGAACAACCCATTATTTAGTAATAGGTATATCAAAAAAGACCT TTAAAGGTTCTCAGCTTCTTAACTTGTATTAGTGTATGTTACCATTAATT CTAATTAAACTtatttatttgttgtttttttattctagAAATGGTGGATT CAGCAACTCTGAGAATCGTTGGTTCATTCCTTTCCTTGGTGCAGACCCCT CAGTTGTCAAGAGAACTCAATATCATGAATCGATGGTTCACGACCGAATG CCAGTCCAATATTTCGCTTATTTCACAGTACCGtcaatcttttacatgat ctgTTTTGCTATCTTTGGAGTTGTTTTGTTTGTGTTGACCAAATTTTCTT TTGGTATCAAATTGTTGGAAAACGTAAGATATTGTGTAAACTTGTATTGT GTAAACTATATTTCGGTGACTTTACTTTTTAaggaaatttagttttttta aagactcttatgtatggaatgcttttaaatttttttcgattttttattcA AGACACGATAAAATTCAGAATAAGAGAAAAGCTTGAATTATCTTATGAAA TACTCAAGTTTTATAATGGAATTTGATTTTTACTTGTGGTTGTTGATTTT AGCATCCAAAATTCTTCACTTTTGGTACGTTTTGCAAAGAAGGACCAACA AGGAAGGAGGTATAATAATGATgagtcaaaactttttttaaaatgtagaa cttaaagtttcatgcttacaatcatcagctacataTGATACAAGTTTGAT ctaattgaaaaaattcaaaattcaaacattGCTAGAATCGACAAGTCGTA AAAAATTAATAAgtaattagaaaaaatataaaataaaattataattcCCA TGTGAGCAGCTATGTCCAGTCTTTTGTTTTATAATGTTTGAACATAAATT TATTCATGTGACGACATTTAGAAACGATTTCGGATCTTTTGTTAAGCAAT TCGTCTTTGTTTTCGAATCTCaggatttctaatttttcctgTAAACAAAG GCGGCACATTTTAGAAGTGTTAGAGTAGGATTTGACCCGTTTTTGGATGG ACCATTTTAACGTCGGGAcaatattcttttcttttaaggCCCAAATATAC GTAGACAGGGTTGTACTGTTTTTGTACTTAGCGTTGTTGATAGATTGCTT GTGTTCATTATATCGCTGCTTGAATTCTCTTTTGGTAAGGCCGATGTATG ATTTCTTATCATGATTAGGTGCTGTAACTTCGCATTTATATACAATGGAT TTGGTTTTGCATTTGTTTTGTAACGGACATGCATTTTTATTACGACAGTT GCAATGTTGGTCGTTGTCTTCAGGTTTCAATAACATCTTTTTATTGTGAG AGTTTATAATAGAACGGACGTTTTCGGTACAAGAGTAGCTCACTTTGaca ttgtttttgttgaaaactgAATATAGTTTGTTTgcttttgtaaaatgttt atCAATGAGTTTTAGGAAGGTTTTTCCTACATTTGTTGAGACGTTTTTGT TGTACGGGGGGTTGAACCATATAACTTTTCGCTTTCTTGATCGACGGTTT TCTGTATTTTGGTAGGTATTTTCATATGATAAGTTGATGTTTTTGTAACC ACTTGCTTTTAAAGCTTCTTCGTAGATAGGTTTGGCTTGATTGAAAATAG TTTCATTTgaggagttttttgaaagtctcttgtTTATGGAAAGTGGCAGT TGCTTTATAATATTTTGAGGATGGTTTGAAGATGTGTTTACATATGAAAG GGTATTATTCGGTTTTTTGAACGGTCGGTAAGTACCTGTGTTTAGATCAA GTGTCAAATCGAGAAAATCAACGGTTTTCAAGTTAATATCGATTTCAATG TCAAATcctatgtttttgaaaattgaggGATTGTGCGAGGGCCCGGAGGG CCCGAAGGGCAATCCcgattttatgaataaaatcgAAGCCAACGATCTGA TGTGGGTACGCCCTACTCGCCGTCATGACTGAAGGTCATAATTTCAACTA AGGGTATAAAGATGTACAGTACTAACAAAAGAATTAATTAAACAAAATAT GGGATAGAAATAAAGTGAAACAAGCTTCGATTGGTTTTAAGGTTTCTTTG CCAGGACCACAGTTGACTGGCTTAAAGAgctattaaaaaaatgttacaaT GTTTAAAATGATTAACCACTGCCTCGTCCACGGCCACGTCCACGAAAGTT GGTTCCTGAAATGTACAAGCAAGATAAAGAATATATATGAGACAGGGAGG AGAGGGAGGGCACATCAGATCGTTGGCTTcgattttattcataaaatcgG GATTGCCCTTCGGGCCCTCCGGGCCCTCGCACAATCCCTCATTTCATTTC ATAAAATCTCCGCCCGATCTGATGTGGGTACGCCCTACTCTTGTATGACT GAAGGTCATAATTTCAACTACCTCTGTTTGAAGCTTTTTAAAATCGCACC TTGGAACGAATCTTTAATTACACTCCCTGAATTAttataaaacttttgaa aagtacTTTTATTCGACCAGTGGGCAGATTTCATAATATCCTCCACCGAA AAACCATTCAAAGAAGCCTTTGAGGTAGAGGCCGACCTAGTAGAGTGGCC ctgaaaaacttttgaatcaATGCCTGCATTATGGATGACTTCTTTTAACC ATCTAGAAACAGTAGATGTAGCGACTTTATCGTGAGGTTTTATTGTGGCA ATAAGGAGTTTAGATTCATCACCCCTAAGAGGCTTAGTCATTTCCAGATA TCTATCCAAAGCCTTAACAGGGCACAAGGCCTTATTATCTTCAAAAGACT gaaatttcaactttaaatGTTTGTCACCAGGCTTTTGAGTTTTTGTAGGA TTTGGAAGTGTAAAACTATAAAAAGAGTTTACCCTCACCATGTAGGAGGT GTCTAACTGCCAAATTTCAGAAGCACGAGAACCTGAGCACAAGGCTAACA ACATAACTAACTTATGTGTCATAAGACCAAGATTTCTCGAGTCCAACACC TCTAGATAATTTAAAACCTGGTCAACATCCCAGATAAAGTTGTATTTTGG CTTGGGGGGACGCTTGTTGAAGATCCCCTTCATCAAGGCAGAAACTCTTG GATGCATGCCCACTTTACTTCCGTCTATAGGCATGTGGAAGGCCGAAATT GCAGACCTATAACCACCTATTGTGCTGAACTCCCTACCTTCCTTAAATTG GTCAGTTAGGAATTGCAAAATCAGATTTAAAGGACATCTAAAGGGATCAG CTTGTTGGTCACTACACCAGCGACAAAACTTTCTCCAGGCCGATTCGTAA TGAGAAAGAGTTCCCTTCCTTCTAGAGTGTATGATAAGGTTGGCAGAGTC TTCAGATATTCCTTCTGCACTGAGGTTTGCCCGGATACTGTCCATGCCAC CAGTTGGAGGGAGTTGTTTAGACACAACGGATGACACTCCCCCGCTGGAT TCTTTAGCAGTTGTCGATATTTTGGTAATAATATTGGATTCCTTATCGAC ATTCTGAGTAGTAAAGGGTACCATGGCTGGGATTGCCAAGCAGGTGTTAT GAGAAACAGGGTTGCTTGATCCTTCAGCACCTTTTGTAGCACACGGCCTA TCAGGGAGAATGGTGGGAAAGCATACCCCCTCAGAGGCCCCCAGTCCTGT TGAAATGCATCTGTTCCCTGGCTTTTGTGATCCAGTCTCCAAGAGAAGAA CTTTTGGAGTTGGGTCGTTACTCTTGAGGCAAATAGATCTATCTCTGGAC GACCCCTCACCCAAGTCATTTTTTGAAACACTTTGGGATCTAGTTTCCAT TCGCTTCGATCCTTCCTTCTTGACTCCTTGTCTGCTAGACCATTCAAAAT CCCGGGAAGGTATTCCACAGTAATCGTGATCCCGTATCTTAGGAGGAACT CCCAAAGGTCCTTGCTTATCTGGTTCATTTCGTGGTTCACTGTACCCCCC ATTTTTAGGATGTAAGCTAATGCTGAGATGTTGTCCATCTGGAGATGAAC TGATGTTGGTTTTAACCTGTCTGCAAAAATCAATATGGCCATCTGGGCCC CTTTTAGTTCCAAAATATTTATATGTTTCACTCTCTCTTCCTCTGACCAA AGACCCCCTGCTGGTTGGCCTTGACAGACTGCCCCCCAACCTGTCTTGGA GGCATCTGACTGGACGACTATTTGTGGGGGTTCCATTACTAGGGTCCTCC CATTGACAGATTCTAGATTCTGAATCCACCAAAGTAATTCCGACCTTGAA CCCTTGTCCAAGGACAAGACTTTTTCGTAAGAATTCTCCATTAGGAGGTG TTTTATTTGAAGTCTCTGTATATTTCTGTAGTGAAGAGGGGCTGGAAGTA CTGCTACTGCTGCAGCTGTCAATCTCCCTAATATCTTTGCCAAATCCCTC ACAGAAACCTCCCCCTTCTGTAACAGATTCTTGCAATGTGTTTTTATTAT TGCAACCTTGTCCTGTGGAAGAGATATCTTCATATTGACTGAGTCTACAA TTACCCCAAGGTACTCTAGTTTTTGGCAAGGCTCTAACACTGATTTTTTC ATGTTGATTACAAAACCCAAATTCTGTAAAAGGTAAATCAAGGTATCCCT CAAAGCTATCAATTCCTCCTTGGACTGAGCTAGAAGAATAATGTCGTCCA AGTACACTATCACTCTCCCATGCAAGCGTCGAATTATTGCTATCGGGATT TTCATAAGTTTTGTGAACACCCAAGGTGCTGATGAAAGGCCGAAACATAG GCAAACAAACCGATAAAGTTTTTCTTTCCAACTGAAACCCATATAATCCT GAGACTCTTTGTGGAGAGGGACCACAAAGTAAGCGTCCTTGAGATCGATT TTCACCATATAATCGCCCCTCATTAAAAGATCTTTCAAGGAGTGCAAACC CTCCATTTTGAAATGCTCCTGGGGAATGTATGAgtttaactttttcaaat ttatgacTGGCCTTTGACCAGAATCCTTCTTTTCTACCAGAAAAATTGTA CTGAAAAACTTTCCCTCCCCGGGCTGAATTTCCTGGATAGCACCTTTCTC CAAAAGGGATTTGATCTCCTTGTCCACTAGAGTCACTTCCTTTTCTCCCA TTGGAATCTCCTTTGGAGGCATTCTCTGATGAGGCTGAGCATTTAAAGGC ACCTTGTACCCTGAAACAATATTCAAAATTGCCCGGTCGTTTGTCAAAAC TTCCCAATTTTTTAGGAAGTGTTTTAGCCTTCCTGCTAATGCTAATGGAA TGTCTCCCGGGCTTTCCTTTGAGAAAAGAGGCATCACTAATGGATGAACC CTGGACTTTTGAGGCAAATTCAAGAAATGGTTTTCCCTTACCTCTGTTAT TTCCTCTGTAGTTTCCTCTGAATGAAGAGAACTGAAATCTTGGCTGAAAA CTGCCTCTTTGACCGCCTGACGACTGCCCCCTACCACCTCGGTAACTTGT TGGCAAGGGGCCTCTCTGAAAGGGCTGATTTGAACTTGAACCTGCCTTCA TCATTCCTTTAAACACATCTTTTGACTTCTTTTTCGTCTTTGCACTTCGG CAAATTTCTTCCTCAAATTTGTTACCAAAAAGATCCTTTGTTGTGTTTTC TGAGAGGGTTGTCTCCCAATCTCCCAGCATTACTTTTGCTCTCTTATGGT CTGAGAAGAGGCTTTCTAGAATTAAATGCCGACGGTAGTACGATGTTCTC TGAGAAGCTTGCCCTACCAGAGCAGTGACTGCATCTAACGTTTTACTTAT AATTTCCAGCCTCTGGAGTTCTGTTTTGGATTCCTCTGAATCAGTGTCCC CAGACGACATCAAAGCCTCTCTCTCATTTGCCACAGAAATCCACATCTGG GACACTGGGCCCATTATACTCCGGATGGATTGTTGAATATGAGTCATATA GCCATCGATACGTAAGGTTTTTGCTTTACCAAAAGTTTCATTCACAAGCT CTTTAATGTAAATGTCTAGCTTGGGAGGCTTGTCGACGTTTGAAGGTACG GGACAGTCCGTTAAAATCTTCTCTTTTATAGATTTGTCACTAAAATGTTT GGTCAGGTATTTACGAGCATAATCTTCCAGTTCTTTTGGTAGGCTCACAG ATGAATCCTCATCCTCTTCATCTAACTCCACTCTTGGCATCTTCTCAGGT GGGGCAGAAGTCTCTTCCTCATCTTCTTCCCTTTCTCTTCGGCCATTTCT CCTGAATTTCAAATTGGAAAACATTATCAGAACTGCCCTAAGCAAATTCC TTGTTTCATTATCTTTCACTACCTTCTCTCACCGAGTGAAGAGAGGAATA AACTCAAAGACCTCTCCTAGAGAGTCTAGTTTCATGTAATGAGTGACCCT GTGTCCACTGCCTAACAGTGGAATAAGGTCCTCTTTTAAGGGACTGTAAA TTTAGATATTGACAAAATACACAACAATGGTGCAACACCAATTGTTATTA TAGCTTTTCCTAGATTATGATAGGGTTGCCAAAGGCAAAACCACAGATAT TTAAGGAATTTTAATGATCAATTTATACTTACAAGGAATTTGCGTCCGAC ATCTTTAGCGAGTAGAAAACAAGAGGTAGTTGAAATTATGACCTTCAGTC ATACAAGAGTAGGGCGTACCCACATCAGATCGGGCGGAGattttatgaaa tgaaattcGACAATCTTTTGACGGGTAGATTCAGCGTCTTTTCTTGTCAG GTTACGGAATATCATTAAACCATCGTCACGATACAAACCAATATTACGCT TGTCAGTGATTTGCGAAAGGTTGTTCAAAATGTAAATACCGACAAGTTCA CACACTTCAGCACCATCGTAACTTCCCATTGTGACGTCGAAGCAATCGTG AGATTTGTTCTTTTTCCATGATACGTTGTTTGAAAAGAGAAGGGATTTAC GGCAGTGATTGATTGTTCTGAGATCATTTTCTGAAATTGTTGTGTGTTGC ATTGCGAAATTTAGTGCGTTGTCAAGTATTTCTTTAGTGATATTTGGGTA AAACTCTTTAATGTCCATTTGAATAAAGGAgtgttcatttttattttcga tgGATGAAAACCATTCGATGACTTGGTCGGAATTCTTCCATTGGTTAAAG TGAAGGATGTTACGAAGGTCTGTATTGACTCTGTCTAGAATAGATTTACT GATTGCACCAAGTTCACTTTTGCATGGGTTGATAAGACGACAGGGTTGTT TTTGGTGGAAGTTTNGCCAATGTTAACTTTTACATGGGTTGATGAGACGA CAAGGTTgtttttggtggaaatttggTTTATGGTCTTTCAGCGTGATAAA AGCAGGTGAAGGTGCAAGAATTTCTGCGCGTTCGTGGACTTTGTATGAGA CTGCTATGTGCTTTGCTTCGTTGTTGATTGCAGATTCGAGATTGATGGGt gctttttggtaattttttgttacattttcgCGAAGCAATTTATTGTGTTG ATCGGCAGGCATTTTGTATATATTTGTATATATTTGaggttttgtatata ttttgttttgaggaaGGAGGTATATAAATATCAATTATACATTTCAggta aaaagcaaaaaaaagtcttCTCGATTCTTGATCAACTTTTAATAAATAGA ACTGAATAATGCTGGCAGCCTTGTTGTGACTCTTACCCAGTGTCAACATA GTTTCATCCCCGTATGTTTAGGGGGGTTCTTCAAATTCCTGTTAGGGAGG GGGTTGAAAAACTCCCAATTATTAGAGAGAGGGGGGGTATGGTTATATAG GGGGGTTTAGAAATTTTTACCAAataaatttatcattttcagtGTCATTC CCGTCGATAATTTTATCCCAGGGTTCACGACCTTGGTTATTAAGGGGAGG ATCTGAGAAATTTATATATAGGGGGTTTGGcctttagggggggggggggt tggttAAANATTTTATCCCAGGGTTCACGACCTTGGTTATTAAGGGGAGG ATCTGAGAAATTTATATATAGGGGGTTTGGcctttagggggggggggagt tGATTATATAGGGGGGGGCTTGAACCACCCAGGAAACTATGGTCAATACA AATGTtctaaagctttaaaatgtcaatCTGATTTTAGATTGATGCGGGaa gtttcaaaattgtttttcatGGAAAAGGCTACAAGAAAGAACCTGAATCA AGGTTAGTGGCGTTTTTACGTGAAGTACTTGAAAGCTACTGCACTACTCA ACCTAACTAACAGACTTTGTGAAAAGGAGGTCAAGCCATGATTTAGACTT GAATCGCTATTAAACGctgtttggttagatattcccgcttctaaatcaag ttttgttcgttagtagttgatacattattttcagggcttacttcctactg tttgtacataaaagttatctttaaagttctatttcaatgttcttaagtta tcaaaaatagcgaataaatttttttttccatccggccgcatgagagcttt tttccttcacccgcattccgaaaacactacattttttactTTCGTCTTAC TTCATCATTTTTAGGACAAGTGCAGGAAGACCTGATCAAAGCATGTCATT GAAGTTCTCTGGACCAGGTATTATTCTATTTTGTATCTAAACAGTGCTGT GTTTATTAACCAGATAGGATTGGCGTCAAATGTTGATAGCCCTTACATTG GTTTTCTCATAGTCACAGAATTTTGATGTCATCTTCCCTTGGTAAACTTT ACCCAATCCTTTCGTGGCTGTTAGAGGTTGAAAAGTGTAttgtttgattt gatttttagatACATTAATCCGTTTTGGAAAAGAAAACAGCTTTAGTTTA GAATTCAACCCCCACCTAAGGAAACCAAGGACTCTTAtactaaaaaaaaa tcaaaacattgagcaGCAGAATCATCTGACAGTTTTCAtcttaattatta tttttcagagGCAGGATACATTTTCACTTCAACGTGCGTCGTCGCAGCTG CTGCTACCATTTTAGATGACAACCTCATCAACAAGTAAGTTCACTCATTG ATTGGTTGTCATTTATCCGATGCAACTGGGGTGATGAAATGACTAACAAT GTTGAATCACTCTNATCATTTATCTGATGCAACTGGGGTGATGAAATGAC TAACAATGTTGAATCACTCTTGAGAGCAATCTATCTCTCAGCTTGTCACT CAACATCGCCAATATCTCATGGCTATGTTACGTCGCAAGCACTTGGGTCA AAAGTGTGTTGTGAATGACTACTCCATGATTAGTCTATGCTAGAATAGGC GATTATCCTGGGACAGGGCCCGCAAGGCCGACCACCCTTACTTTAATTAT CTTCCTCCTCACAGTTAGGCATATAATTTATATGACAATACTGTTTCGAA TTCATGTTGCGAATTAGACTGTTACATTagatttccatacaggggggggg gttgacgaaccttttcaaggcaaaaagAGATTCTGGAAAGTGACAAGACT TTCAAAAGAACCCCTGGAAAGATTCATTTCCGACCTTAAAAGTGATgatg gacgaactaaaatcagtcttttaccccctggaaatttaagaataaacttt caccccctggaaaaatgaaaaaatattcctttatacccctggaaattctt ctccgattacctcctggaaatgttcgcccaccccctgtatggatataaaa tggaatgccCTATTCCGTTTAGGATACCTTTAGCCTGATAATTCGGCGGG TTTTTGTGGCGTAAAAgtaatttgttaaaaaatgtcTTTAATTACTTGAA GAGATTTATGAGCGACTCAAATAAATAATGTTTTCATGGAActaaattgc aatttttaactCTTCATTTATTTACAGGGGTGGTGTTTTGACTCCTGCTT CAGCTTTCCGAAAGACCAAATTTGTTGAACGATTGGAAAAACGAAACGTC AAAATTGAAGTGATGAATTAAAAGAGATTTGGGGCCCAAGTGGAAAATCA ATACTAAAGCCTATACTAAGGCCTATGTGGTACTCCTATTTCTTCTGCat taaaaagtatttaaaatgattttgatatttAGTTTGTTTCTTGCAATTTT AGAATTTAGACCTTTGTTTTTCAATGCAGCTCGTTTTATACTGCATTATC TTgaagttaattaaaaaaaaaggtttttgtagggataatttataatttga aatgatttttaatTACGTGCGTTCGTACAGATTTGATTATGTATAGTTTT TGTCAATATCAAAATACAGTATTTTCTAGCATTCACATTTTATACAGGTA AATCTCAGACCAAATATATCAACTTTTACAAATCCGAGGGTATACGATAC TTCCATGGGGTCTAGacaatgttgattttttttagaattttatatTCTCG ATTGATACCTTTTCAACCTGTCTTATTATCGTCTTATCAGCTCAACCCTT TTCGAACCTCATCGAACCCTTTATAGTGTATCTCGTGACCAGAGCCAACT CAGCCCTCTAACCAAATTTGGTCGGTAAATGAGAACTCCTGCAATTAGTG GGTCAATCACGGGTCTTCGGCTACCGCAGGTTGCGCTGTGTTGACTTCAC TTCCAGTGAAGTAAAACTTGCCTTGCTACAAGAATCCATAGGTCAAAGAA TTAGCCAATGTAACCCTCTGAAAACggctgattgattgattgattgattg attgattgattgattgattgattgattgattgattgattgattgattgat tgattgattgattgattgattgattgattgattgattgatgatTTTAATG TGATTTTCATTGATTCTTATaggaaaaataattaaattgaAA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_001079XLOC_001079Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00002051-exon-sc0000018-1491911889:578858..578882TCONS_00002051-exon-sc0000018-1491911889:578858..578882Clytia hemisphaericaexon
TCONS_00002051-exon-sc0000018-1510915933:578858..578882TCONS_00002051-exon-sc0000018-1510915933:578858..578882Clytia hemisphaericaexon
TCONS_00002051-exon-sc0000018-1575043694:578858..578882TCONS_00002051-exon-sc0000018-1575043694:578858..578882Clytia hemisphaericaexon
TCONS_00002051-exon-sc0000018-1491911889:579212..579341TCONS_00002051-exon-sc0000018-1491911889:579212..579341Clytia hemisphaericaexon
TCONS_00002051-exon-sc0000018-1510915933:579212..579341TCONS_00002051-exon-sc0000018-1510915933:579212..579341Clytia hemisphaericaexon
TCONS_00002051-exon-sc0000018-1575043694:579212..579341TCONS_00002051-exon-sc0000018-1575043694:579212..579341Clytia hemisphaericaexon
TCONS_00002051-exon-sc0000018-1491911889:579552..579598TCONS_00002051-exon-sc0000018-1491911889:579552..579598Clytia hemisphaericaexon
TCONS_00002051-exon-sc0000018-1510915933:579552..579598TCONS_00002051-exon-sc0000018-1510915933:579552..579598Clytia hemisphaericaexon
TCONS_00002051-exon-sc0000018-1575043694:579552..579598TCONS_00002051-exon-sc0000018-1575043694:579552..579598Clytia hemisphaericaexon
TCONS_00002051-exon-sc0000018-1491911889:579746..579867TCONS_00002051-exon-sc0000018-1491911889:579746..579867Clytia hemisphaericaexon
TCONS_00002051-exon-sc0000018-1510915933:579746..579867TCONS_00002051-exon-sc0000018-1510915933:579746..579867Clytia hemisphaericaexon
TCONS_00002051-exon-sc0000018-1575043694:579746..579867TCONS_00002051-exon-sc0000018-1575043694:579746..579867Clytia hemisphaericaexon
TCONS_00002051-exon-sc0000018-1491911889:580746..580980TCONS_00002051-exon-sc0000018-1491911889:580746..580980Clytia hemisphaericaexon
TCONS_00002051-exon-sc0000018-1510915933:580746..580980TCONS_00002051-exon-sc0000018-1510915933:580746..580980Clytia hemisphaericaexon
TCONS_00002051-exon-sc0000018-1575043694:580746..580980TCONS_00002051-exon-sc0000018-1575043694:580746..580980Clytia hemisphaericaexon
TCONS_00002051-exon-sc0000018-1491911889:581210..581266TCONS_00002051-exon-sc0000018-1491911889:581210..581266Clytia hemisphaericaexon
TCONS_00002051-exon-sc0000018-1510915933:581210..581266TCONS_00002051-exon-sc0000018-1510915933:581210..581266Clytia hemisphaericaexon
TCONS_00002051-exon-sc0000018-1575043694:581210..581266TCONS_00002051-exon-sc0000018-1575043694:581210..581266Clytia hemisphaericaexon
TCONS_00002051-exon-sc0000018-1491911889:588695..588759TCONS_00002051-exon-sc0000018-1491911889:588695..588759Clytia hemisphaericaexon
TCONS_00002051-exon-sc0000018-1510915933:588695..588759TCONS_00002051-exon-sc0000018-1510915933:588695..588759Clytia hemisphaericaexon
TCONS_00002051-exon-sc0000018-1575043694:588695..588759TCONS_00002051-exon-sc0000018-1575043694:588695..588759Clytia hemisphaericaexon
TCONS_00002051-exon-sc0000018-1491911889:589122..589174TCONS_00002051-exon-sc0000018-1491911889:589122..589174Clytia hemisphaericaexon
TCONS_00002051-exon-sc0000018-1510915933:589122..589174TCONS_00002051-exon-sc0000018-1510915933:589122..589174Clytia hemisphaericaexon
TCONS_00002051-exon-sc0000018-1575043694:589122..589174TCONS_00002051-exon-sc0000018-1575043694:589122..589174Clytia hemisphaericaexon
TCONS_00002051-exon-sc0000018-1491911889:589516..589591TCONS_00002051-exon-sc0000018-1491911889:589516..589591Clytia hemisphaericaexon
TCONS_00002051-exon-sc0000018-1510915933:589516..589591TCONS_00002051-exon-sc0000018-1510915933:589516..589591Clytia hemisphaericaexon
TCONS_00002051-exon-sc0000018-1575043694:589516..589591TCONS_00002051-exon-sc0000018-1575043694:589516..589591Clytia hemisphaericaexon
TCONS_00002051-exon-sc0000018-1491911889:590435..590613TCONS_00002051-exon-sc0000018-1491911889:590435..590613Clytia hemisphaericaexon
TCONS_00002051-exon-sc0000018-1510915933:590435..590613TCONS_00002051-exon-sc0000018-1510915933:590435..590613Clytia hemisphaericaexon
TCONS_00002051-exon-sc0000018-1575043694:590435..590613TCONS_00002051-exon-sc0000018-1575043694:590435..590613Clytia hemisphaericaexon
TCONS_00002051-exon-sc0000018-1491911889:591380..591399TCONS_00002051-exon-sc0000018-1491911889:591380..591399Clytia hemisphaericaexon
TCONS_00002051-exon-sc0000018-1510915933:591380..591399TCONS_00002051-exon-sc0000018-1510915933:591380..591399Clytia hemisphaericaexon
TCONS_00002051-exon-sc0000018-1575043694:591380..591399TCONS_00002051-exon-sc0000018-1575043694:591380..591399Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000018supercontigsc0000018:578858..591399 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
37.5862 38.7998 77.6423 85.226 21.2076 18.798 35.946 46.1958 68.3238 65.3719 155.981 55.956 63.6059 71.4017 55.9197 101.097 54.1138 48.0994 39.8571 43.7432 33.9582 40.2507 57.0665 46.4681 124.457 160.248 47.6515 45.1462 190.331 147.037
Blast
BLAST of TCONS_00002051 vs. Swiss-Prot (Human)
Match: SCPDL (Saccharopine dehydrogenase-like oxidoreductase OS=Homo sapiens GN=SCCPDH PE=1 SV=1)

HSP 1 Score: 216.468 bits (550), Expect = 9.765e-66
Identity = 117/306 (38.24%), Postives = 179/306 (58.50%), Query Frame = 2
Query:    5 DITGEPEFMQTCQIKYHKAAEEKGVHIVSACGFDSIPADMGLEILRERFPGVLTAAESYIHIRSKRANY----GTYLTIIHSVQNRNSVKDQHKTIFRQKIPYTGPRLRLRNG-GFSNSENRWFIPFLGADPSVVKRTQYHESMVHDRMPVQYFAYFTVPSIFYMICFAIFGVVLFVLTKFSFGIKLLENHPKFFTFGTFCKEGPTRKEIDAGSFKIVFHGKGYKKEPESRTSAGRPDQSMSLKFSGPEAGYIFTSTCVVAAAATILDD--NLINKGGVLTPASAFRKTKFVERLEKRNVKIEVMN 901
            DI+GEP+F++  Q+KYH+ A +KGV+I+ + GFDSIPAD+G+   R +  G LTA ES++ I S         GT+ + I+   ++++++        + +P  GP+L+ R    +      + IPF+G+D SVV+RTQ +     +  PVQY AY TV  I  +I     G+      +F  G +LL   P FF+FG F K+GPT+K+IDA SF + F G+GY +   + T   +P+  +  +  GPEAGY+ T   +V AA T+L D  +L   GGV TP +AF KTK ++RL K  ++  V++
Sbjct:  122 DISGEPQFLELMQLKYHEKAADKGVYIIGSSGFDSIPADLGVIYTRNKMNGTLTAVESFLTIHSGPEGLSIHDGTWKSAIYGFGDQSNLRKLRNVSNLKPVPLIGPKLKRRWPISYCRELKGYSIPFMGSDVSVVRRTQRYLYENLEESPVQYAAYVTVGGITSVIKLMFAGLFFLFFVRFGIGRQLLIKFPWFFSFGYFSKQGPTQKQIDAASFTLTFFGQGYSQ--GTGTDKNKPNIKICTQVKGPEAGYVATPIAMVQAAMTLLSDASHLPKAGGVFTPGAAFSKTKLIDRLNKHGIEFSVIS 425          
The following BLAST results are available for this feature:
BLAST of TCONS_00002051 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
SCPDL9.765e-6638.24Saccharopine dehydrogenase-like oxidoreductase OS=... [more]
back to top