Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00002020 (transcript) - C. hemisphaerica

Overview
NameTCONS_00002020
Unique NameTCONS_00002020
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length859

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00002020 ID=TCONS_00002020|Name=TCONS_00002020|organism=Clytia hemisphaerica|type=transcript|length=859bp
GGATACCGGTTGTCAGCGACGTCTACAATTCAGTGTTTTTCTTCATCGCT
GCTACATTGAGCTTTTTCATCCCTTGTATATTAGTACTTGTCTCCTATGG
TTTTATTCTGGTATCAGCGTTAAAGAATatgaaaatggaaaagaaaatca
GCAAAGTTATTGTCGTTATATCCACAATGGATCAAGAGAATCTGGAAAAA
GTTGCATCAATGAGACCAGCAAGGTTTCGAGAAATCAAGATCGCTTTTAA
CGTGGCAATAATGACAGTTCCTTTTGTTTGCGGATGGGGTTATTTCATGA
CGTGTAATACTTATGAAATTGTAGCTGGCAAGGATATTACCGGTTTTCAA
AATTGGTTAATCCCTTTCGTACCGTTCGTAATTTCATGTTTAAATCCATT
GACTTATTTAATGTTCACTCGATCCTTGAGGAAGAGTTCATTAATGCTAC
TTTCAAGatcaaaattatgtaaaaaactGACGCAGTCTTTTATTAGACGC
GAGAGTGAATTAACGAGTATGTCTTTCGTGATAAACGATCGGTCAAGCAA
CAGTATGGTCGAGACAGCTTCGAGAAGACATTCTGAAAATCTATTAGACG
GTGATGGCAAAAAGGAGACCACGAATGAATCTCCAGAGAAACAAACTTTA
ATTGAACGTGAAGATTTAGATAAAGGCGTTAATGTATAATGCACgtagat
tttatttcaattccAATAATTCTAATATACTACTCTCTGATTCTGAAGGG
TAAACTTTGGTGAGTTGAAAAACTTGTAGGGCGTGAGATTAAAATCTTAC
GAATTTACTTCTATTATTACCTCTAAGAATTATAGTCATTACTTTATCTA
CGATCGCga
Run BLAST on NCBI

protein sequence of TCONS_00002020-protein

>TCONS_00002020-protein ID=TCONS_00002020-protein|Name=TCONS_00002020-protein|organism=Clytia hemisphaerica|type=polypeptide|length=228bp
IPVVSDVYNSVFFFIAATLSFFIPCILVLVSYGFILVSALKNMKMEKKIS
KVIVVISTMDQENLEKVASMRPARFREIKIAFNVAIMTVPFVCGWGYFMT
CNTYEIVAGKDITGFQNWLIPFVPFVISCLNPLTYLMFTRSLRKSSLMLL
SRSKLCKKLTQSFIRRESELTSMSFVINDRSSNSMVETASRRHSENLLDG
DGKKETTNESPEKQTLIEREDLDKGVNV
Run BLAST on NCBI

transcript from alignment at sc0000012:850244..851102

Legend: exonthree_prime_UTRCDSfive_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00002020 ID=TCONS_00002020|Name=TCONS_00002020|organism=Clytia hemisphaerica|type=transcript|length=859bp|location=Sequence derived from alignment at sc0000012:850244..851102 (Clytia hemisphaerica)
tcGCGATCGTAGATAAAGTAATGACTATAATTCTTAGAGGTAATAATAGA AGTAAATTCGTAAGATTTTAATCTCACGCCCTACAAGTTTTTCAACTCAC CAAAGTTTACCCTTCAGAATCAGAGAGTAGTATATTAGAATTATTggaat tgaaataaaatctacGTGCATTATACATTAACGCCTTTATCTAAATCTTC ACGTTCAATTAAAGTTTGTTTCTCTGGAGATTCATTCGTGGTCTCCTTTT TGCCATCACCGTCTAATAGATTTTCAGAATGTCTTCTCGAAGCTGTCTCG ACCATACTGTTGCTTGACCGATCGTTTATCACGAAAGACATACTCGTTAA TTCACTCTCGCGTCTAATAAAAGACTGCGTCagttttttacataattttg atCTTGAAAGTAGCATTAATGAACTCTTCCTCAAGGATCGAGTGAACATT AAATAAGTCAATGGATTTAAACATGAAATTACGAACGGTACGAAAGGGAT TAACCAATTTTGAAAACCGGTAATATCCTTGCCAGCTACAATTTCATAAG TATTACACGTCATGAAATAACCCCATCCGCAAACAAAAGGAACTGTCATT ATTGCCACGTTAAAAGCGATCTTGATTTCTCGAAACCTTGCTGGTCTCAT TGATGCAACTTTTTCCAGATTCTCTTGATCCATTGTGGATATAACGACAA TAACTTTGCtgattttcttttccattttcatATTCTTTAACGCTGATACC AGAATAAAACCATAGGAGACAAGTACTAATATACAAGGGATGAAAAAGCT CAATGTAGCAGCGATGAAGAAAAACACTGAATTGTAGACGTCGCTGACAA CCGGTATCC

Coding sequence (CDS) from alignment at sc0000012:850244..851102

>TCONS_00002020 ID=TCONS_00002020|Name=TCONS_00002020|organism=Clytia hemisphaerica|type=CDS|length=687bp|location=Sequence derived from alignment at sc0000012:850244..851102 (Clytia hemisphaerica)
TTATACATTAACGCCTTTATCTAAATCTTCACGTTCAATTAAAGTTTGTT
TCTCTGGAGATTCATTCGTGGTCTCCTTTTTGCCATCACCGTCTAATAGA
TTTTCAGAATGTCTTCTCGAAGCTGTCTCGACCATACTGTTGCTTGACCG
ATCGTTTATCACGAAAGACATACTCGTTAATTCACTCTCGCGTCTAATAA
AAGACTGCGTCagttttttacataattttgatCTTGAAAGTAGCATTAAT
GAACTCTTCCTCAAGGATCGAGTGAACATTAAATAAGTCAATGGATTTAA
ACATGAAATTACGAACGGTACGAAAGGGATTAACCAATTTTGAAAACCGG
TAATATCCTTGCCAGCTACAATTTCATAAGTATTACACGTCATGAAATAA
CCCCATCCGCAAACAAAAGGAACTGTCATTATTGCCACGTTAAAAGCGAT
CTTGATTTCTCGAAACCTTGCTGGTCTCATTGATGCAACTTTTTCCAGAT
TCTCTTGATCCATTGTGGATATAACGACAATAACTTTGCtgattttcttt
tccattttcatATTCTTTAACGCTGATACCAGAATAAAACCATAGGAGAC
AAGTACTAATATACAAGGGATGAAAAAGCTCAATGTAGCAGCGATGAAGA
AAAACACTGAATTGTAGACGTCGCTGACAACCGGTAT
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_001058XLOC_001058Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00002020-proteinTCONS_00002020-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00002020-exon-sc0000012-1491911889:850244..851102TCONS_00002020-exon-sc0000012-1491911889:850244..851102Clytia hemisphaericaexon
TCONS_00002020-exon-sc0000012-1510915933:850244..851102TCONS_00002020-exon-sc0000012-1510915933:850244..851102Clytia hemisphaericaexon
TCONS_00002020-exon-sc0000012-1575043694:850244..851102TCONS_00002020-exon-sc0000012-1575043694:850244..851102Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000012supercontigsc0000012:850244..851102 .
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0.286939 0.387948 0 0 8.31417 5.03671 4.74521 4.98217 2.74755 3.37785 4.87544 3.21829 4.18677 4.2281 3.38282 4.66457 0.108515 0.271345 2.37971 1.63012 0.239193 0 0.38515 1.09275 0.327201 0.667454 0.0748416 0.0712628 0.0605808 0.246889
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR000276GPCR_Rhodpsn
IPR017452GPCR_Rhodpsn_7TM
Vocabulary: Biological Process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
Vocabulary: Molecular Function
TermDefinition
GO:0004930G-protein coupled receptor activity
Vocabulary: Cellular Component
TermDefinition
GO:0016021integral component of membrane
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0007186 G-protein coupled receptor signaling pathway
cellular_component GO:0016021 integral component of membrane
molecular_function GO:0004930 G-protein coupled receptor activity
Blast
The following BLAST results are available for this feature:
BLAST of TCONS_00002020 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 0
Match NameE-valueIdentityDescription
back to top