Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001987 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001987
Unique NameTCONS_00001987
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length2350

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001987 ID=TCONS_00001987|Name=TCONS_00001987|organism=Clytia hemisphaerica|type=transcript|length=2350bp
AATCGATATAACTTTTTCTAACAACAGTCAAACTATATacatttgaaaaa
tctcaatgtTTCCGAAAAAGTGAACAATTATCTTTagcaaaataataata
aatttaAAACTACAGCAGTGCATTGTCTTATTAATCAGTTAATATCAATA
AGTTAATTAGCGATTGACCATAAAAAAGTCATAAATCCTTTGCATGATTG
ACTATCGATAATTCGAGATCAACCAGAAAATCTAGAGATTCTAATTGAGG
CATTTTATGGGTGTTCCATTTAACAACAAGGTTTTAATTCGAGAGTTTAA
ACGCCTATTCAACGTTTCTCGACTGTAAACCAAACTGACCCAATCGGATC
TTGAGACATTGATGTTGGATCAGGGATCAATTTCTCGACCGTTTTATCGC
ATTTTAAGACACGATATTTCATCAAAATACGACTCATAATAATTTTGACT
TCCATTGTTGCAAATCTCTGTGCGATACAATTCCTCGGTCCGTGACCAAA
ACCACCCGAAACAAACGGGTGGCGGGCGGCTTTCATCTCGGGAGCAAAAT
TTTCAGGATCGAATACTGTGGGGTTAGGGAAGTATTTCTCGTCCTTAACG
AATGCAGAAGAGGCAATTAACACATAGACATCTTTCGGGATAACCATATC
CGTATCTGGGATCTTAAAATCATTTACCGAAGCTCGCTCTAGATGCGTTA
GAGGATACATCCGAAAGCTTTCTTGAAAGAATTTCTCCATGTAAGACAAC
CCCATAATAGTGGCATAATCTAATTGATCAGAGCCATTGGATTCGGCAGC
TTCCTTGATTTCTTGGTAAAGCTTTTCTTGATACTCTGGATGCATTGCCA
AGAAGTATAACATGATTGATGAGGCTGATGATAAGGTATCAAAACCGGCG
AAAAACATCAATAAAGAATTAGCAATGATCAGTTTCTCTATCTCCTCCTT
CTTTAAGGTCGTTTCCGAATCATTAGCTGTTGAATTTTCTTTCAAGGTTG
CTTCTCCAGTTTCAGAAGGTCGCGTGCCATCTTCAATAGCTAACCCTTTC
TTTAAGAtatcaataaaaatatcaataaagtCATTCCGTTTCGATCCACT
CTCTTGGCGATCAATCATCGCCTTTTTCACAATGGCGGCAAAAAATTCCT
CAGATTTCGGATTGAAAAAACTCCAATCCATAACCACCTTAACATTGTTG
GGAAGAATTGGTACATCATAAACGTTAGAAATGTTTTAGCAGTCAATGTT
TTCCCTAACAAAGCGTCAGCGTTGGTTTTAAACATGTTCAATGGATCTTT
CATACTGTTCGATTCATAACCAAAACCAGTTGAAACGATTGTATCCAGGG
CGAATCTCCGCATCAATTCTTTGCCGTCAATTTCAGTGCCAAGGTTGTCA
TCTAAGAAGGCATCGCATTGATCTGCCACGTGGTGAATCAAAGGTACCAT
GACTTTCAATTTACCACTGGTGAATGCTGGTGTCAGTTGCGAGCGAACAT
TCTTCCATTTTTGACCACGTAACTCAATCAACATTAACTGGAAATATTGG
TTATTCTTAGAGTGAGGACTGAAAGGTTGATTCTGCAAtggttttctttc
aataaatgTATCAAAATGTTTCACCAAGACGAGCTTTGCCAGGTCTAAAT
CTCGAATCACAAGGTTGGGATCACCAAAAATACCATAAGTACCAACGACG
GGGGAATCGGGGAACTTCTTGTACGCGCCATCAGTAAGTTCACCAAAAGC
AATTTTTTGGGTCAACATGTCCCAAGTACCTTGACTACCAAATGGAAAGT
ACCCAGGGTCAGCTGGGATTCCTCGTCTCTCCCAGAAAGTCATTTTTCGT
CTAACGTAGAGATAGAATGTTGTAAAAGCAACGATGATGACTGTTAGCAC
AATCTCCCACATCTCTTGCTTTGCAAATGTGTTTTAGTAACAAAATATCG
TATATAAATCCTTCTTTTCTTGCAACTGTTGTCCAACCAAAAGTTCtttt
cacgaaaaataaaatgttatgcTTTCCAATTGCACTTATATTTCTGAAAG
ATGATGACCTGGTATTGAACACTTGTCAATGTTAACGTGTCTGTAAACAA
CGCCAAAACTGATGATAATGCACTTTTAATCGTTTTGGATATTCATCTAT
TTTTAGATAGCTCATTAAAAATAATATCACTTGGTCGCTCTTTATTTCTT
CTTACTGTAGATGAAAGGATATGAAACCATAGCAAAGATGTAGAATTTGT
TGCATAGATGTGAGCAGCTATTTGCATACAGAAAAAAACTCGATTCTAAT
TTCTATCGCTTCAAGATTACTTTTTTCGTGTAAAAAATCATGTCTTAATA
Run BLAST on NCBI

protein sequence of TCONS_00001987-protein

>TCONS_00001987-protein ID=TCONS_00001987-protein|Name=TCONS_00001987-protein|organism=Clytia hemisphaerica|type=polypeptide|length=290bp
MDWSFFNPKSEEFFAAIVKKAMIDRQESGSKRNDFIDIFIDILKKGLAIE
DGTRPSETGEATLKENSTANDSETTLKKEEIEKLIIANSLLMFFAGFDTL
SSASSIMLYFLAMHPEYQEKLYQEIKEAAESNGSDQLDYATIMGLSYMEK
FFQESFRMYPLTHLERASVNDFKIPDTDMVIPKDVYVLIASSAFVKDEKY
FPNPTVFDPENFAPEMKAARHPFVSGGFGHGPRNCIAQRFATMEVKIIMS
RILMKYRVLKCDKTVEKLIPDPTSMSQDPIGSVWFTVEKR
Run BLAST on NCBI

transcript from alignment at sc0000012:226733..229082

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001987 ID=TCONS_00001987|Name=TCONS_00001987|organism=Clytia hemisphaerica|type=transcript|length=2350bp|location=Sequence derived from alignment at sc0000012:226733..229082 (Clytia hemisphaerica)
TATTAAGACATGATTTTTTACACGAAAAAAGTAATCTTGAAGCGATAGAA ATTAGAATCGAGTTTTTTTCTGTATGCAAATAGCTGCTCACATCTATGCA ACAAATTCTACATCTTTGCTATGGTTTCATATCCTTTCATCTACAGTAAG AAGAAATAAAGAGCGACCAAGTGATATTATTTTTAATGAGCTATCTAAAA ATAGATGAATATCCAAAACGATTAAAAGTGCATTATCATCAGTTTTGGCG TTGTTTACAGACACGTTAACATTGACAAGTGTTCAATACCAGGTCATCAT CTTTCAGAAATATAAGTGCAATTGGAAAgcataacattttatttttcgtg aaaaGAACTTTTGGTTGGACAACAGTTGCAAGAAAAGAAGGATTTATATA CGATATTTTGTTACTAAAACACATTTGCAAAGCAAGAGATGTGGGAGATT GTGCTAACAGTCATCATCGTTGCTTTTACAACATTCTATCTCTACGTTAG ACGAAAAATGACTTTCTGGGAGAGACGAGGAATCCCAGCTGACCCTGGGT ACTTTCCATTTGGTAGTCAAGGTACTTGGGACATGTTGACCCAAAAAATT GCTTTTGGTGAACTTACTGATGGCGCGTACAAGAAGTTCCCCGATTCCCC CGTCGTTGGTACTTATGGTATTTTTGGTGATCCCAACCTTGTGATTCGAG ATTTAGACCTGGCAAAGCTCGTCTTGGTGAAACATTTTGATAcatttatt gaaagaaaaccaTTGCAGAATCAACCTTTCAGTCCTCACTCTAAGAATAA CCAATATTTCCAGTTAATGTTGATTGAGTTACGTGGTCAAAAATGGAAGA ATGTTCGCTCGCAACTGACACCAGCATTCACCAGTGGTAAATTGAAAGTC ATGGTACCTTTGATTCACCACGTGGCAGATCAATGCGATGCCTTCTTAGA TGACAACCTTGGCACTGAAATTGACGGCAAAGAATTGATGCGGAGATTCG CCCTGGATACAATCGTTTCAACTGGTTTTGGTTATGAATCGAACAGTATG AAAGATCCATTGAACATGTTTAAAACCAACGCTGACGCTTTGTTAGGGAA AACATTGACTGCTAAAACATTTCTAACGTTTATGATGTACCAATTCTTCC CAACAATGTTAAGGTGGTTATGGATTGGAGTTTTTTCAATCCGAAATCTG AGGAATTTTTTGCCGCCATTGTGAAAAAGGCGATGATTGATCGCCAAGAG AGTGGATCGAAACGGAATGactttattgatatttttattgataTCTTAAA GAAAGGGTTAGCTATTGAAGATGGCACGCGACCTTCTGAAACTGGAGAAG CAACCTTGAAAGAAAATTCAACAGCTAATGATTCGGAAACGACCTTAAAG AAGGAGGAGATAGAGAAACTGATCATTGCTAATTCTTTATTGATGTTTTT CGCCGGTTTTGATACCTTATCATCAGCCTCATCAATCATGTTATACTTCT TGGCAATGCATCCAGAGTATCAAGAAAAGCTTTACCAAGAAATCAAGGAA GCTGCCGAATCCAATGGCTCTGATCAATTAGATTATGCCACTATTATGGG GTTGTCTTACATGGAGAAATTCTTTCAAGAAAGCTTTCGGATGTATCCTC TAACGCATCTAGAGCGAGCTTCGGTAAATGATTTTAAGATCCCAGATACG GATATGGTTATCCCGAAAGATGTCTATGTGTTAATTGCCTCTTCTGCATT CGTTAAGGACGAGAAATACTTCCCTAACCCCACAGTATTCGATCCTGAAA ATTTTGCTCCCGAGATGAAAGCCGCCCGCCACCCGTTTGTTTCGGGTGGT TTTGGTCACGGACCGAGGAATTGTATCGCACAGAGATTTGCAACAATGGA AGTCAAAATTATTATGAGTCGTATTTTGATGAAATATCGTGTCTTAAAAT GCGATAAAACGGTCGAGAAATTGATCCCTGATCCAACATCAATGTCTCAA GATCCGATTGGGTCAGTTTGGTTTACAGTCGAGAAACGTTGAATAGGCGT TTAAACTCTCGAATTAAAACCTTGTTGTTAAATGGAACACCCATAAAATG CCTCAATTAGAATCTCTAGATTTTCTGGTTGATCTCGAATTATCGATAGT CAATCATGCAAAGGATTTATGACTTTTTTATGGTCAATCGCTAATTAACT TATTGATATTAACTGATTAATAAGACAATGCACTGCTGTAGTTTtaaatt tattattattttgctAAAGATAATTGTTCACTTTTTCGGAAacattgaga tttttcaaatgtATATAGTTTGACTGTTGTTAGAAAAAGTTATATCGATT

Coding sequence (CDS) from alignment at sc0000012:226733..229082

>TCONS_00001987 ID=TCONS_00001987|Name=TCONS_00001987|organism=Clytia hemisphaerica|type=CDS|length=873bp|location=Sequence derived from alignment at sc0000012:226733..229082 (Clytia hemisphaerica)
ATGGATTGGAGTTTTTTCAATCCGAAATCTGAGGAATTTTTTGCCGCCAT
TGTGAAAAAGGCGATGATTGATCGCCAAGAGAGTGGATCGAAACGGAATG
actttattgatatttttattgataTCTTAAAGAAAGGGTTAGCTATTGAA
GATGGCACGCGACCTTCTGAAACTGGAGAAGCAACCTTGAAAGAAAATTC
AACAGCTAATGATTCGGAAACGACCTTAAAGAAGGAGGAGATAGAGAAAC
TGATCATTGCTAATTCTTTATTGATGTTTTTCGCCGGTTTTGATACCTTA
TCATCAGCCTCATCAATCATGTTATACTTCTTGGCAATGCATCCAGAGTA
TCAAGAAAAGCTTTACCAAGAAATCAAGGAAGCTGCCGAATCCAATGGCT
CTGATCAATTAGATTATGCCACTATTATGGGGTTGTCTTACATGGAGAAA
TTCTTTCAAGAAAGCTTTCGGATGTATCCTCTAACGCATCTAGAGCGAGC
TTCGGTAAATGATTTTAAGATCCCAGATACGGATATGGTTATCCCGAAAG
ATGTCTATGTGTTAATTGCCTCTTCTGCATTCGTTAAGGACGAGAAATAC
TTCCCTAACCCCACAGTATTCGATCCTGAAAATTTTGCTCCCGAGATGAA
AGCCGCCCGCCACCCGTTTGTTTCGGGTGGTTTTGGTCACGGACCGAGGA
ATTGTATCGCACAGAGATTTGCAACAATGGAAGTCAAAATTATTATGAGT
CGTATTTTGATGAAATATCGTGTCTTAAAATGCGATAAAACGGTCGAGAA
ATTGATCCCTGATCCAACATCAATGTCTCAAGATCCGATTGGGTCAGTTT
GGTTTACAGTCGAGAAACGTTGA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_001025XLOC_001025Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001987-proteinTCONS_00001987-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001987-exon-sc0000012-1491911889:226733..229082TCONS_00001987-exon-sc0000012-1491911889:226733..229082Clytia hemisphaericaexon
TCONS_00001987-exon-sc0000012-1510915933:226733..229082TCONS_00001987-exon-sc0000012-1510915933:226733..229082Clytia hemisphaericaexon
TCONS_00001987-exon-sc0000012-1575043694:226733..229082TCONS_00001987-exon-sc0000012-1575043694:226733..229082Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000012supercontigsc0000012:226733..229082 .
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
1.11023 1.03418 1.53849 1.13806 0.6257 0.565071 7.32864 7.57899 12.4277 11.6405 13.6321 8.5639 6.68951 5.87129 3.45323 4.84689 3.78161 4.57729 8.49041 9.67721 8.50738 9.68241 5.90887 7.11663 6.70727 10.8289 4.45344 3.07964 9.71104 7.6079
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR002403Cyt_P450_E_grp-IV
IPR001128Cyt_P450
IPR017972Cyt_P450_CS
Vocabulary: Molecular Function
TermDefinition
GO:0016705oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
GO:0020037heme binding
GO:0004497monooxygenase activity
GO:0005506iron ion binding
Vocabulary: Biological Process
TermDefinition
GO:0055114oxidation-reduction process
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0055114 oxidation-reduction process
molecular_function GO:0020037 heme binding
molecular_function GO:0005506 iron ion binding
molecular_function GO:0004497 monooxygenase activity
molecular_function GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
Blast
BLAST of TCONS_00001987 vs. Swiss-Prot (Human)
Match: CP3A4 (Cytochrome P450 3A4 OS=Homo sapiens GN=CYP3A4 PE=1 SV=4)

HSP 1 Score: 123.635 bits (309), Expect = 1.176e-29
Identity = 66/179 (36.87%), Postives = 99/179 (55.31%), Query Frame = -3
Query:  390 ANSLLMFFAGFDTLSSASSIMLYFLAMHPEYQEKLYQEIKEAAESNGSDQLDYATIMGLSYMEKFFQESFRMYPLT-HLERASVNDFKIPDTDMVIPKDVYVLIASSAFVKDEKYFPNPTVFDPENFAPEMKAARHPFVSGGFGHGPRNCIAQRFATMEVKIIMSRILMKYRVLKCDKT 923
            A S++  FAG++T SS  S ++Y LA HP+ Q+KL +EI     +       Y T++ + Y++    E+ R++P+   LER    D +I    M IPK V V+I S A  +D KY+  P  F PE F+ + K    P++   FG GPRNCI  RFA M +K+ + R+L  +    C +T
Sbjct:  297 AQSIIFIFAGYETTSSVLSFIMYELATHPDVQQKLQEEIDAVLPNKAPPT--YDTVLQMEYLDMVVNETLRLFPIAMRLERVCKKDVEI--NGMFIPKGVVVMIPSYALHRDPKYWTEPEKFLPERFSKKNKDNIDPYIYTPFGSGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKET 471          
The following BLAST results are available for this feature:
BLAST of TCONS_00001987 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
CP3A41.176e-2936.87Cytochrome P450 3A4 OS=Homo sapiens GN=CYP3A4 PE=1... [more]
back to top