Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001979 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001979
Unique NameTCONS_00001979
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length6866

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001979 ID=TCONS_00001979|Name=TCONS_00001979|organism=Clytia hemisphaerica|type=transcript|length=6866bp
agaagaaaagactaaccaaaattgttgtgcacgaaagcttttagctgtga
aagagtatatttgaactctttcacttcacccacctctgtccccttttctt
ctccatcttgcagttcttacAACCTCTTTCTTCTCATGTCTTCTCTTCAA
ACTGCTAGATGTAGAAGAagagactaaccaaaattgttgtgcacgaactc
ttttagctgtgaaagagtatatttgaactctttcacttcacccacctctg
tccccttttctNAGAATGACTTTACCAGGATTGTCACGCGAAGTATGGTG
TCAACACctcaaatcaaaatcaaagaaaatgttgCTGGTAGTACTGCTAA
AAAACAGaagtCAGAAGACATTGATTTGGCATGTAAGTCTTCCAAAAACA
AGAAAAGGTTATCGGCTGAGAAGAAGAACTCTATGCCCTCTCCCGAGCTC
AATTCAAGTCTCCAGTTATCACAATGGGGTCTTCCAGAAGTTATACTGGA
GAATTATAAAGCTAAAGGAATCAATAAAATGTTTGAATGGCAAAAAGAAT
GCTTACTACAAGACCAAGTTTTGGATGGTGCTAATTTGATCTATTCTGCT
CCAACGAGTGCTGGTAAAACGTTAGTCGCTGAAATCCTCATGTTGAAAAG
AGTCCTGGAAACAGAGAAGAAAGCCATCTACATCTTACCCTTTGTCAGTG
TGGCGAGAGAGAAGATGTATTCACTAAGGAATCAATTTGAGGAAGCTGGC
ATCAATGTGGGTGGATTTATGGGAAACGAGACACCTCCTGGTGGATTAAC
CAACATTGATATCGCTATATGCACCATTGAACGAGCAAACTCTCTGATCA
ACCGCCTCATGGAGGAAGACAAGCTATCTCTACTTGGAAGTATTGTTATT
GATGAAATGCACATGATTGGTGACCCATCACGTGGTTATTTACTTGAACT
CTTATTGACCAAGATTCGATTTTTAATGGCTAAGAATGCAACCAATGTTG
GTGAAAATAATGAGAGCAGCAGTAACCATGACAATGGGATACAAATCATA
GGTATGAGTGCTACTTTACCGAATTTAGACATGATGGCGCGATGGTTGGA
TGCAAGGTTCTACGTTACAGATTACAGACCAGTGCCTTTGGATGAATATT
TGAAAACCTCTAAGACTATTTACGATTGCGCAGATACTGTAGTACGGACT
ATTTCACCTGAGGACACAATTAAAGGCGACGACGATGACGTTATCAATTT
ATGTCTTGAAACAATGCGAGATACAAACTCTGtcttgattttttgtccaa
CCAAGAACTGGTGTGAAAAATTATCCATCAGCATTGCCAACTATCTCGCC
AACAATGTTTTGAGTAAAGAATCTGATACAGAgaatatctttgataaaga
aGGCTTACAAGATGTGTTAAGTGAGCTGCAGCAAACACCAGCTGGTTTGG
ATCCAAGTTTGGAGAAGGTGGTCAGCTCTGGTGTGTCTTACCATCACGCT
GGACTGACCATGGATGAAAGGGATATCATTGAAGGAGCATTCCGAAGAGG
TGTCTTGAAGATTATTATCGCAACGTCTACGCTGTCATCCGGTGTGAACC
TTCCAGCTCGCCGTGTCATCATTCGATCCCCTATGTTTCATGGAAAATTG
ATCGACGCCTTGGTGTATAAACAAATGGTGGGGCGTGCTGGGCGGAAAGG
CGTCGACACTCAAGGAGAAAGTATCTTGATATGTAAACCAAACGAGAAAC
AAAAATCACTTGCTATGATGACGTCACTCTTGAAACCTGTCTATAGTTGT
TTGTTAGATGCAAGTCGTACTATGAATCGTGCATTACTGGAGGTCATTGC
TGGCGGAGTCGCAGTGTCCCCACCTGACGTCGAGCTCTACGCAAAGAGTA
CTTATTTGAACACGTGTTTGGCCGTTCAAACGGGCCGTCACCCTGAAGAA
CTGATATGCACATCTATGAAGTTTCTACTGGAAAATGATTTCATCAAACT
GCGCTTTGAGAAAAATAAGGATGATGTGAACGAGAAATCGAAAGAACAAT
ACTTCCCATCACAATTGGGCACCGCTACAATGGCCTCTTCTATGAAACCA
GATGAAGCCATAATAGTTTATACAGAGTTGCAAAAAGCACGCCGTAATTT
TTGCCTGGAAAACGAACTTCATATCATATATCAGGTAACACCAACATCCA
TTTGTGACCAATGGCCAGACTTAGATTGGTACACTTACTATAACATCTGG
GAACGCCTCTCTGCACAATGTAAGCACGTGGGCGAAATGATCGGTGTCAA
AGAATCCTTTTTAGGACGTGCCATGCAGAACCGTGTCAGTTGTGTGACGG
CCGAGCAGAAGCGTGTCATGCGTATCCATCGCAGATTTTATGGTGCTTTG
GTATTAAATGACCTTTGTAATGAAGTCCCTATGTCAGACGTCAGCCGTAA
ATATAAAGTCCATAAAGGTCTTTTGCAATCGTTACAAAACTCAGCCGCGA
CCTACGCAGGTATGATGACCGTGTTTTGTAAGAAACTTGGCTGGTCATGT
TTAGAAGTCTTACTGGAGCAATTTCAAAGTCGTTTGTCATTTGGTGTTTG
CCGGGACCTGTGTAATCTGGTTCGCATATCGTTACTGAATCGTTTCACTG
CTCGTTTATTCTATCAGAACGGATTTCAAACTGTGAGTGCCATAGCCAAT
GCAAGTGAAAAAGAAATCTCTAAATTGCTTCGTGAATCGACACCGTTTTA
CAGTAACAAACTAAAAGGAAAGGATGCTGAAATGGTGGGTAAATCAGTAC
CTAAATGTTTATGGTTGAGTGGGAAAGAAGGCTTGTCGGAGCAGGAAGCT
GGCAGATTGATCATTGACGAAGCCAAACGTATCCTTGCAGCGGATGCACA
AGCACTAGGCATTCCCATTGGGCAGTTAAATCTCTCATCCAAGAATTCGA
CAATCTCTAAATCTTCCTCCAGTTCATCAGGCAAGAAAAGAAGATCCAGC
CTCACTAAGAGTACTATAAAACGTAGGAATCGTAAAAGAGCATCGGCTGA
GAAAATCACTCCGTTGAGATCTTCGAAACGTTTATCTCCCGAACAACGTA
GTGGTGAAAGAGTTGATAGTAACTCAAAAGTTGGAACACAACTAGCGTAT
GCTTTGCAGAAAAGCACGTCTCAATCGCCTAGTCCTGTGTTACGAGAAAT
ACAGAATCTTTCGACTCAGAATCTCAGTAGAAATTTATCTTTGGCTGATA
ATGACATGTCTctatttcaagaaaatcaagTCATTAACACTGCTCAAAAG
ATGGTTGAAAATTTGAGTAATGATTCGTTACTCTTTGGCGAATCATTGCC
AAACATACtaggaaaagaaaatcaatctgATATTAAAATGACTACAGACA
TTTTGATTGAACAATTGAAAGATACAGTGCTCCACAACCAATTATCCGAT
AAATCCGAAACTCAAGACTCGTTATTCTTGATACCAAACCAAGACTTCAA
TAGCTTTTCAACTAAGAATCAAGACCAAACTATGTCAGAGCAAACACCGA
ACCTTTCCGAAGATCGAATCCTGAACACTGGGAATTTTTGTGATAAACTG
CACACCCAagattctttgtttttgaatgataaaattcCAAGCTTCTCAAC
CCACACAGTTAATAAAACCAGAGATATTGTTACCAAGGACGAACCAGAAT
CTCGAACGATTGCAGAATGTGAACTCAACCACCAGGAGCAACAGGGTTCT
GTGaacagtaagaaaaccaaacGAAAGACAAGCGATTACTTGGAATCATC
TGATTCGCTCTTACTCTTGTCTGACAGTGCTTTAAAACCGAAAGAAAAAT
CACCAATACTAATCGAGTCGCCGAAAACCGAACTAAGTGTGACCACACCC
TCGCCAAACCTTTCCTTGCGACTATCAACAACTGACGAAGCACTGGACAC
TTTTCCTAAAATATTACCACCCATGAAATTACATTCCCAATTCAATGACG
CTTTAACCGGGGAAGCATCAACTTTGCAACGAAATTTAACGTCAGTTACT
TCACCGGAGGTTGATTTATTCGATCAGAACATTGAAAGCAATGACAACAG
TGGAGACCTATTCGAGAGTACTGAACTTTTCACTAAGAATTCTACATCTC
AAGCAACAGAGAGAGTCACTCCTCAAGAAACCAACCTAAACGAAAGTGCA
TCTAATGAATTCCTAATTATCGATGTCGCATCCTCCAAAACGTTATTCTT
GACATTCATCCAAGAATGGAAAGCCAAATCATCCTTCACCGTTGCCTTCT
CTTGTGAAACTCATAAACCCACCAGTCAAACAACTTCATCAAAGATCGGC
CGTCCCTTGAGATCTGCCAGAGACGTTTCAACCACATCCAAACCATCTGC
AATGTCGTCAACCAGCAATCGTTTACTATATACCAGAGATGATTTACAGT
TGACAGGACTTGCCATATGCTGGGGTAAAAAGGATTCATACTACATCAGT
TTGCAGGAAGACGGTGTACGTCACAACGAATTGGACGATACTGCCTTACC
TCCAGATGTCTGCCAGGAACTGCCTTTGCCAGTCCGTTTAAAGAGTATCC
AATCCGTCCTTAACCAGCATGCATCTTCGACTATCATGGGTTTTGACCTG
AAGGAGCAGTTGAAGATCATATACGAGTTGTGTGATACTTTGTTGNTATC
ATTGGTTTTGACCTGAAGGAGCAGTTGAAGATCATATACGAGTTGTGCGA
TACTTTGTTACCAAAAGCAGTTTTGAAAGACCCGAAAGTAGCTCACTGGT
TACTAGAGCCTTCACAGCGAGAGAAGAATTTGTTCGGAATAACTAAACAA
TGGTTGGATGAAGACCATGTTAGCTTGACTGAAGGTTTGAGTGGTGGAGT
AGGGACACGTGGGTTTGGAATGGTCCCTAAACCCGGTTGTTCAGGGCGTG
TACGAGCATGCGTCGAAAGTGTACTTGTCAATCAACTCATGTCTACCCTG
CACCAAAAGTTGACACAAGAAAATCTACTGGCACCATTCTTAGAGATTGA
GATGCCATCTTTGCGAACTCTCTCCATCATCGAAATTAACGGTATCGGTT
TCTGTGATCAAGCctgtgaaaaattgaagaaactgATGAAAGACAAGCTG
TCCAGTCTAGAGAAGCAGTGTTACCAGCTGGCCAAACGTACGTTTTCACT
AACCTCCCCTGACGATGTAGGTAGGGTACTTTTTATCGAGCTCGCGTTAC
CTTGTTTAACTGAAAATGGTCGCGCGACACGCACTAAAGGAAAAGTCAAA
CATTTTCGCACGTCAAAAGACGTGCTAGAGAAACTGGTTACCTATCATCG
TTTGCCAAAGTTGATTTTGGAATGGCGTCGTATCAATAGTACTTTAACCA
AGATCGTGTATCCAGTGCAACGCAAGAAACTTAAGCTACCCGAATATTCA
ATGTACCGGATTTATACGGAATCCCAATTTCATACGAGTACCGGTCGTGT
AACCTTCACTGAACCTAACATACAGAACGTGCCGAAAGAATTTGATATTA
AAGTTTCGGTCAATGAACCAAGTATGAAACGTACTGTCGATGCAGAATCA
CCTGGGGTTGTCAAAGCAGTTAGCATGCGAGGCGCTTTTGTACCTTTCGA
AGGTGGCGTTTTCGTATCTGCTGATTACTCTCAATTAGAACTTCGAATCA
TGGCTCATCTGTCTGGAGATGTGAAACTCATTAAGGCTATCAACGAATCC
AAAGATGTGTTCAAGAGTATTGCTGCTGAAATTTATCGGATCGATGCAGA
CGAAGTGATGCCGTCTCAAAGACAGCAAGCTAAACAAGTTTGTTATGGGA
TTCTTTATGGTATTGGTTCGAAATCACTTGCCGAACAACTTGAAACGAAT
GTCGAGGAAGCTGCAAtgtatgttgaaaattttaaacgGAAGTTTAAAGG
CGTAAACTCGTTTATTAAGAAAACAATTGATAGTTGTCGGAAACTTGGCT
ATGTTTCTAGTATGGCTGGACGTAAGAGATACTTACCTGCAATCAGCTCG
TCTGATTCACACGCGCGCTCGCAAGCGGAGCGCCAATCGGTCAACACGGC
CGTGCAAGGGTCGGCAGCTGATCTTGTTAAGAAAGCTATGAATAATATTT
CCGATAAACTACGAGAACATTTTTCGCGACTGTGCTTGAAACGGAACTCT
CGAGGTTCCCGATCGGTTTCTTCGGATTCGGGACCAGCGAAAGGAGCTTT
TCTAGTTCTCCAAATACACGATGAACTCTTATACGAAGTCAATCGAAAAG
ACGTTGATTTGGTTTTACAAATCATTAGAAATGGTATGGAAAATGCGTAT
AAATTACTTGTCAAAACACCTGTTAAAATGCATATTGGTAATAGTTGGGG
TCAGTTGAAGGATGTAGAGTGAATTTGTATGTTGTAGTGGAACTATATGG
AGATACCCAGTTAGCCTTTAGACAACTTAAGGGAACTCTTTGGGTTTTCA
CCGAAATTGAAATAATTCCTGCCTTGCAAAAGTAAGTTAAGTAAGTTCTT
GCAAAAATTATGTTATCGAAGTTAACCTAATTTGCTCATTTTAggggaaa
aattatttttcgacaAAATTAAGAAATTACAATACTCGCCAATATTATTT
TTCgccaaatttcatatttttacgatttttgctctttgtcaaaattagtt
tagtggggtcgtttagcataatttacaggaaaaaaataatatatagctga
aactttctccagacctctctataggatgcttatgcctcaggaaaaaaatc
CCCTagaatcccactggtggaacattccctttttgggcaatttctttttt
ccccaggcaaaaccct
Run BLAST on NCBI

protein sequence of TCONS_00001979-protein

>TCONS_00001979-protein ID=TCONS_00001979-protein|Name=TCONS_00001979-protein|organism=Clytia hemisphaerica|type=polypeptide|length=1473bp
MVSTPQIKIKENVAGSTAKKQKSEDIDLACKSSKNKKRLSAEKKNSMPSP
ELNSSLQLSQWGLPEVILENYKAKGINKMFEWQKECLLQDQVLDGANLIY
SAPTSAGKTLVAEILMLKRVLETEKKAIYILPFVSVAREKMYSLRNQFEE
AGINVGGFMGNETPPGGLTNIDIAICTIERANSLINRLMEEDKLSLLGSI
VIDEMHMIGDPSRGYLLELLLTKIRFLMAKNATNVGENNESSSNHDNGIQ
IIGMSATLPNLDMMARWLDARFYVTDYRPVPLDEYLKTSKTIYDCADTVV
RTISPEDTIKGDDDDVINLCLETMRDTNSVLIFCPTKNWCEKLSISIANY
LANNVLSKESDTENIFDKEGLQDVLSELQQTPAGLDPSLEKVVSSGVSYH
HAGLTMDERDIIEGAFRRGVLKIIIATSTLSSGVNLPARRVIIRSPMFHG
KLIDALVYKQMVGRAGRKGVDTQGESILICKPNEKQKSLAMMTSLLKPVY
SCLLDASRTMNRALLEVIAGGVAVSPPDVELYAKSTYLNTCLAVQTGRHP
EELICTSMKFLLENDFIKLRFEKNKDDVNEKSKEQYFPSQLGTATMASSM
KPDEAIIVYTELQKARRNFCLENELHIIYQVTPTSICDQWPDLDWYTYYN
IWERLSAQCKHVGEMIGVKESFLGRAMQNRVSCVTAEQKRVMRIHRRFYG
ALVLNDLCNEVPMSDVSRKYKVHKGLLQSLQNSAATYAGMMTVFCKKLGW
SCLEVLLEQFQSRLSFGVCRDLCNLVRISLLNRFTARLFYQNGFQTVSAI
ANASEKEISKLLRESTPFYSNKLKGKDAEMVGKSVPKCLWLSGKEGLSEQ
EAGRLIIDEAKRILAADAQALGIPIGQLNLSSKNSTISKSSSSSSGKKRR
SSLTKSTIKRRNRKRASAEKITPLRSSKRLSPEQRSGERVDSNSKVGTQL
AYALQKSTSQSPSPVLREIQNLSTQNLSRNLSLADNDMSLFQENQVINTA
QKMVENLSNDSLLFGESLPNILGKENQSDIKMTTDILIEQLKDTVLHNQL
SDKSETQDSLFLIPNQDFNSFSTKNQDQTMSEQTPNLSEDRILNTGNFCD
KLHTQDSLFLNDKIPSFSTHTVNKTRDIVTKDEPESRTIAECELNHQEQQ
GSVNSKKTKRKTSDYLESSDSLLLLSDSALKPKEKSPILIESPKTELSVT
TPSPNLSLRLSTTDEALDTFPKILPPMKLHSQFNDALTGEASTLQRNLTS
VTSPEVDLFDQNIESNDNSGDLFESTELFTKNSTSQATERVTPQETNLNE
SASNEFLIIDVASSKTLFLTFIQEWKAKSSFTVAFSCETHKPTSQTTSSK
IGRPLRSARDVSTTSKPSAMSSTSNRLLYTRDDLQLTGLAICWGKKDSYY
ISLQEDGVRHNELDDTALPPDVCQELPLPVRLKSIQSVLNQHASSTIMGF
DLKEQLKIIYELCDTLLXSLVLT
Run BLAST on NCBI

transcript from alignment at sc0000012:1126727..1162938-

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001979 ID=TCONS_00001979|Name=TCONS_00001979|organism=Clytia hemisphaerica|type=transcript|length=36212bp|location=Sequence derived from alignment at sc0000012:1126727..1162938- (Clytia hemisphaerica)
AGAAGAAAAGACTAACCAAAATTGTTGTGCACGAAAGCTTTTAGCTGTGA AAGAGTATATTTGAACTCTTTCACTTCACCCACCTCTGTCCCCTTTTCTT CTCCATCTTGCAGTTCTTACAACCTCTTTCTTCTCATGTCTTCTCTTCAA ACTGCTAGATGTAGAAGAAGAGACTAACCAAAATTGTTGTGCACGAACTC TTTTAGCTGTGAAAGAGTATATTTGAACTCTTTCACTTCACCCACCTCTG TCCCCTTTTCTNAGAATGACTTTACCAGGATTGTCACGCGAAGTATGGTG TCAACACCTCAAATCAAAATCAAAGAAAATGTTGCTGGTAGTACTGCTAA AAAACAGGTAGGTCAGTAGTTAAAATGAGCAAGCGTAGCCGTAGGAATGT TTAGATCAGCTTTAAAGAAAAGCTATCCTCACTTGACATTTTTTGCTGAC TTCTTTTCCTGGTAAATGGTATCTATTTTATAGTTTAAAAATCCATTTTA CAATGACTTTTTAGTATCAGAGTTGTACTTTTAATACCCAATGCATGATG TAATGTTAATGAATTATTAAGCTTTTGGGTGTGTTTGTGTAGGTCTTGAG ATAATTGGTTTTGAATTGAGTGAAGCCAAGTAACTGAAAACGTTTGACCC CTCAATTCAATTTTGAGGTTTCAACTAGAGTGATGTCTCTTCAGCTTATG GACTCAAATTTTGTTGCTGACGATGAATATTTTCTTCTTTAATCTTTTCT TTTTTAGAAGTCAGAAGACATTGATTTGGCATGTAAGTCTTCCAAAAACA AGAAAAGGTTATCGGCTGAGAAGAAGAACTCTATGCCCTCTCCCGAGCTC AATTCAAGTCTCCAGTTATCACAATGGGGTCTTCCAGAAGTTATACTGGA GAATTATAAAGCTAAAGGAATCAATAAAATGTTTGAATGGCAAAAAGAAT GCTTACTACAAGACCAAGTTTTGGATGGTGGTAAGTTTTTTTTCACGTTT ACTTATAACCAAACAAAAATATTTGATGCCTGTTGATAAAGCCTTTGATA AAACCATCCAACGAATTCCCCCTTTTTGACCCTTTATTAGTCTTGGTGGC TGGTCGAAAGTGACCCGTTTGATAATGACACAACTGGTAATTCTGCCTTT CTTCCTGGAAATAGCAGCCTGGACTGTGCTGTTTCTTCTTAACCTAGCCC TATCGCAGCACGTGATTTTTTAGACACCGTTGGAACGGTGCTGAGAAAAA AGCCACTTCCGTCTGGTACAAGCAATATCAGCTGATTGCCGACCAAGCAG AGTCCGAAGTATGAAATGTCAAACCAATCATATCAAGTGTAACTTTCAAA GTCTTTCATTTTTGTTGTATTTCTCCTTACAGCTAATTTGATCTATTCTG CTCCAACGAGTGCTGGTAAAACGTTAGTCGCTGAAATCCTCATGTTGAAA AGAGTCCTGGAAACAGAGAAGAAAGCCATCTACATCTTACCCTTTGTCAG TGTGGCGAGAGAGAAGATGTATTCACTAAGGGTTTGTATTTAAGATTTCT GAATCTTATCTAGATCACCTAGTCAAACAGAAAAGACTCTTTATTCGTCA TTGCATTATTGTTCTTATCAACGATGTTACTGCAGCCTTTTCTTCTTAAA ATGATGACTGAAGTTTCTATTGACATCAAAAGACTTGTATATCAGTAATA CATTGAATTGTGTGATTATTGATAAAAATTGATAATCGCATTTTAGGAAA TAGGAAATAAAGTTCTCACGTAAAGTACATAATATTTGTAAATCTCACAT GCAGGCTTCAAATCTACTAGGGTATGAGTGTTGAAAATTTCACGGCGATA AGATAAACAGAAAAAAAGTTACGTCAAAAATTCTAGGGGTGCGGTTTTTT TTTAATCACCCTGTATTTGCGTATAAGTTTAAACAAATTCTATATCGTAG AATCAATTTGAGGAAGCTGGCATCAATGTGGGTGGATTTATGGGAAACGA GACACCTCCTGGTGGATTAACCAACATTGATATCGCTATATGCACCATTG AACGAGCAAACTCTCTGATCAACCGCCTCATGGAGGAAGACAAGCTATCT CTACTTGGAAGTATTGTTATTGATGAAATGCACATGATTGGTGACCCATC ACGTGGTTATTTACTTGAACTCTTATTGACCAAGATTCGATTTTTAATGG CTAAGAATGCAACCAATGTTGGTGAAAATAATGAGAGCAGCAGTAACCAT GACAATGGGATACAAATCATAGGTATGAGTGCTACTTTACCGAATTTAGA CATGATGGCGCGATGGTTGGATGCAAGGTTCTACGTTACAGATTACAGAC CAGTGCCTTTGGATGAATATTTGAAAACCTCTAAGACTATTTACGATTGC GCAGATACTGTAGTACGGACTATTTCACCTGAGGACACAATTAAAGGCGA CGACGATGACGTTATCAATTTATGTCTTGAAACAATGCGAGATACAAACT CTGTCTTGATTTTTTGTCCAACCAAGAACTGGTGTGAAAAATTATCCATC AGCATTGCCAACTATCTCGCCAACAATGTTTTGAGTAAAGAATCTGATAC AGAGAATATCTTTGATAAAGAAGGCTTACAAGATGTGTTAAGTGAGCTGC AGCAAACACCAGCTGGTTTGGATCCAAGTTTGGAGAAGGTGGTCAGCTCT GGTGTGTCTTACCATCACGCTGGACTGACCATGGATGAAAGGGATATCAT TGAAGGAGCATTCCGAAGAGGTGTCTTGAAGATTATTATCGCAACGTCTA CGCTGTCATCCGGTATGTCTTACCATTTCCATTTCTTGATTTGATGACTA TTTTATTTCTGTTATCACATCATCTCACAAGATATTTTGGTCCTAGATAA AGGTCCTTTAACAGTAAATTCATGGAACTCAGTTCTTTAAGGAAATTTTA ATTCGTAGCCAATAACTTAGATTCGTTCCATCAAAAGTCATGAAACTTTT TGTGATCACTTTTCTTGATGGACCAAAATCTATGTACACGGATGCTTTTA GCTTTGAAAGAGTATATTTGAACTCTTTCACTTCACCCACCTCTGACCCC TTTTCTTCTCCATCTTGCAGTTCTTACGACATCTGTCTTCTCAGGCCTTC CCTTTAAAGAAAGGTAGATGCATTGATTTGATCCTTACAAATCGGCCTCT TTGCTTTAAAAACAGTGGGACTTTTGAAACAGGAATCAGTTCTCAACTTC AGTTGAGCTACAATCTGACAATGTCTGTCTGTCTCCTGTGTGTGTGTGTG TGTGTCTGTCTGTCTGTCACAAAAACTTTAGGGCAGCCTGGAGACTTCAA AAATGCTTGGATTTGGCTGAAATTTGGCACACTTGTTCCTTGGGTGAATA TCTGGAAGATCTTTTTTCGTTTTTCAAAAATTTAGATTTTTGAGGCCTGG GGACGAGTTTTTCACCAAAACGAGGCTAAAACTTTGGGACAGCCTGGAAA CTTCAAAAATTGTCGTATTTAGCTGAAATTTGGCACACTTGTTCCTTGGG TGAATATCTGGAAGCGTTTTTTTTCGTTTTTCAAAAAACTTGATTTTTGG GGCCTGGGGACGAGTTTTCCGCCAAAACGAGGCTAAAACTTTAGAGCAGA GCCTACAGGCCTCAAAAATGGTTGGATTTGGCTGAAATTTGGCACACNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAA TTTGGCACACTTGTTCCTTGGGTGAATATCTGGGGGTCTACAATCGGGCC TATGAATAATTTGAAGCCACTGAAGTTGAGCCCAGTGCGTTGCGCACGTT GCGTGACTACCATCACTTGATTTATAGCATGTTCAAAGCTAGTTTTAAAA AACTTCCTCCCAAAATTATAGAATATAGATCTTTTAAAAATTTTGATGAA AGTTGTTTCCGCTCAGCTTTAAGTCGTAATTTTGATTGCGATTTCTCAGA TTTTGAAGACTTCAGCAACACTTTTGAAAATATTCTGGATGCCCGTGCAC CAATGAAAAAGCGAACCATAAGGGGAAATCAAAAGCCCCATATAACTAAA GCTGTCCGAAAAGCTATTATGATTCGCTCTTTTTACAAAAACAAAGCAAA TAAGACCGGAAACACCTTTTATAAAAACTTATATTGTAAACAAAAAAATA ATATTGTAAATCTGAATAGGAAAGCAAAGAGAAAGTATTTTCGTGATTTA AAGGGCAACAGAAAACTTTTGGAAATCTGCAAAACCATACTTTTCAAACA AGGTCCAACACCACGAAAAAATGTTCTTGCTTGACGATTCAAGTGAATCA AACGAGCTGATAGATGACGAGGCTACTATAGCTCAAACCTTTAATGATTA TTTTGTAAATATCGCTTCTTATCTTGGCATAAAAACTTCAGAATTTAGTC TTCCTGGGAACACTGAAAATAATCCGCTCGAAAATCATCCTAGCGTCCTT CGCATCCTCGAATCTCAGTCTACGAACAGATCATTTTCGTTTAGCGAGGT TACCCCCGAAGATATCCACCGAATCATGATTAAACTTAACCCTAGTAAAT CCGTGAGCGGTCCTTTTTCAGTTAAGCTTGTTAAAATGGTCTCTGACTTA TTATCAGAACCATTATCAAAACTAGTAAATCTTGCATTTAGCACTTCTCA ATTCCCTCAAACTCTAAAAAAGGCGAGGGTCACTCCTGTCTTTAAAAAGG AAGACAAATTTCTGAAGACAAATCATCGGCCAATTAGCATATTGCCAATT TTTTCAAAAATTTATGAAAGAATTATGCATGACCAACTTTCATCTTACTT TGATGGCATTTTTGACTCAAGACTTTGTGGGTTCTGAGCTAAACACAGCA CCCAGCATGCTCTAATCAAAATGATTGGTCAATGGCATCAAAGCTTGGAT GCGTCTGGTAAAGTTGGAGCAGTTTTAATGGACTTATCTAAAGCTTTCGA TTGCATAGACCACAAACTTTTATTAGCTAAACTCAAAGCTTATGGACTCG ATGCTAAAAGTCTTGGCCTTCTCAAATGCTATATGAGTAATCGCTATCAG AGAACAAAAATATACTATACTCAGTATAGTGAATGGTTGGAAATACATCT TGGTGTTCCACAGGGCTCTATACTCGGACCCCTTTTATTTAACATTTTTT TGAATGACTTATTCTTTTTCATAGTCAAAACCAGCATTTGCAATTTTGTA GATAATAATACATTGTATTCTTGTGCTGAAACTCTTGCAGAGGTCATCTT AAATCTTGAGTTTGACTTAGAAATTATTCTAGATTGGTTCTCAAAAAACT ACCTTGAAGCAAATCCTGGAAAATTTCAAATGTTGGTATTAGGAAATAAT AAAGATATTATTGTAGAACTTTTGGTTGGACATGTAAAAATATCATCAAC GGATTCTGTTGAGCTCTTAGGCATCACCATCGACAATAATCTATCATTTA GCACTCATATCAATTCTCTTTGCTCTAAGACTAAAAAGAGAATTTGGAGC TTAAACAGAATTCGAAACCTTCTTACATTTGACCAANCTCTAAGGCTAAA AAGAGAATTTGGAGCTTAAACAGAATTCGAAACCTTCTTACATTTGACCA TGGATGTTCTGTAACAAGACTACAGTACATATGAGGAAATCACTAAAGTC CACAAGCGGGCTCTGAGAATATTACTTTGTGATTTCCAAGAAGACTATGA ATCTCTGTTACAGAGCGCCAAGTGTAAAACGGTCCATGAAATTCATCTTC GCTTCTTACTTTGTGAGGTTTTCAAATCTGAGAAAAAATTAAATCCTGAA TTCATGCAGCAGGTCTATAAATCAAAAACAATTAAGTTTGATTTGCGAAA CAAAGTCTTGATGGCAATACCCAAGGCTACCTCCCATCGTTTCGGAACAC AATCCTTTTTATTTCGTGGAAGCTCACTTTGGAATCAAATTCCTGAAAAT AATAAGCTTAAGCCTTCCATCGATTCATTTAAATCCTTACTTAATGAAAT AAACCTAACAAATATTTGCCTTTATAAAATATGTACCTAAAAATTTATAG TTTCACTTTATTATATAGTTTTATAGAAATTATCTTTTCATATAATCATT TTTGTCAATAGTTGGTATAAATTAGTATTTAATTATAACTATGTAACACC AACGTTAAATAAATCGGGAAAAAAATAAAAAATAAAAAATAAACTGCTAG ATGTAGAAGAAAAGACTAACCAAAATTGTTGTGCACGAACGCTTTGAGCT GTGAAAGAGTATATTTGAACTCTTCCACTTTACCCACCTCTGACCCCTTT TCTTCTCCATCTTGCAGTTCTTACAACCTCTTTCTTCTCAGGTCNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNCCTTGCCTTCAAACTGCTAGATGTAGAAGAAA AGACTAACCAAAATTGTTGTGCACGAACGCTTTTAGCTGTGAAAGAGTAT ATTTGAACTATTTCACTTCAACCACCTCTGGCCCCTTTTCTTCTCCATCT TGCAGTTCTTACAACCTCTTTCTTCTCAGGCCTTCCCTTCAAACTGCTAG ATGTAGAAGAAAAGACTAACCAAAATTGTTGTGCACGAACGCTTTTAGCT ATGAAAGAGTATATTTGAACTCTTTCACTTCACCCTCCTCTGACCCCTTT TCTTCTCCATCTTGCAGTTCTTACAACCTCTGTCTTCCAGGCCTTGCCTT CAAACTGCTATATGTAGAAGAAAAGACTAACCAAAATTGTTTTGCACGAA CGCTTTTGGCTGTGAAAGAGCTCGCGTGAACTCTTCCACTTTACCCACCT CTGTCCCCTTTTCTTCTCGATCTTGCAGTTCTTATGACCTCTTTCTTCTC AGGCCTCCCCTTCAAACTGTTAGATGTAGAAAAAAGACTAACCAAAATTG TTGTGCACGAACGCTTTTAGCTGTGAAAGAGTATATTTGAACTCTTTCAC TTCACCCACCTCTGTCCCGTTTTCTTCTCCATCTTGCAGTTCTTATGACC TCTTTCTTCTCAGGCCTCCCCTTCAAACTGCTAGATGTAGAAAAAAAGAC TAACCAAAATTGTCGTGCACGAACGCTTTTGGCTGTGAAAGAGCTCGCGT GAACTCTTCCACTTTACCCACCTCTGTCCCCTTTTCTTCTCCATCTTGCA GTTCTTATGACCTCTTTCTTCTCAGGCCTCCCCTTCAAACTGCTAGATGT AGAAAAAAAGACTAACCAAAATTGTTGTGCACGAACGCTTTTAGCTGTGA AAGAGTATATTTGAACTCTTTCACTTCACCCACCTCTGTCCCCTTTTCTT CTCCATCTTGCAGCTCTTACGACCTCTTTTTTCTCAGGCCTTCCCTTCAA ACTGCTAGATGTAGAAGAAAAGACTAACCAAAATTGTTGTGCACGAACTC TTTTAGCTGTGAGAGAGCTCGCGTGAACTCTTCCACCTTACCCACCTCTG TCTCCTTTTCTTCTCCATCTTGCAGTTCTTACGACCTCTGTCTTCTCAGG CCTTGCCTTCAAACTGCTAGATGTAGAAGAAAAGACTAACCAAAATTGTT GTGCACGAACTCTTTTAGCTGTGAGAGAGCTCGCGTGAACTCTTCCACCT TACCCACCTCTGTCTCCTTTTCTTCTCCATCTTGCAGTTCTTACGACCTC TGTCTTCTCAGGCCTTGCCTTCAAACTGCTAGATGTAGAAGAAAAGACTA ACCAAAATTGTTGTGCACGAACTCTTTTAGCTGTGAGAGAGCTCGCGTGA ACTCTTCCACCTTACCCACCTCTGTCTCCTTTTCTTCTCCATCTTGCAGT TCTTACGACCTCTGTCTTCTCAGGCCTTGCCTTCAAACTGCTAGATGTAG AAGAAAAGACTAACCAAAATTGTTGTGCACGAACTCTTTTAGCTGTGAGA GAGCTCGCGTGAACTCTTCCACCTTACCCACCTCTGTCTCCTTTTCTTCT CCATCTTGCAGTTCTTACGACCTCTGTCTTCTCAGGCCTTGCCTTCAAAC TGCTAGATGTAGAAGAAAAGACTAACCAAAATTGTTGTGCACGAACTCTT TTAGCTGTGAGAGAGCTCGCGTGAACTCTTCCACCTTACCCACCTCTGTC TCCTTTTCTTCTCCATCTTGCAGTTCTTACGACCTCTGTCTTCTCAGGCC TTGCCTTCAAACTGCTAGATGTAGAAGAAAAGACTAACCAAAATTGTTGT GCACGAACTCTTTTAGCTGTGAGAGAGCTCGCGTGAACTCTTCCACCTTA CCCACCTCTGTCTCCTTTTCTTCTCCATCTTGCAGTTCTTACGACCTCTG TCTTCTCAGGCCTTGCCTTCAAACTGCTAGATGTAGAAGAAAAGACTAAC CAAAATTGTTGTGCACGAACTCTTTTAGCTGTGAGAGAGCTCGCGTGAAC TCTTCCACCTTACCCACCTCTGTCTCCTTTTCTTCTCCATCTTGCAGTTC TTACGACCTCTGTCTTCTCAGGCCTTGCCTTCAAACTGCTAGATGTAGAA GAAAAGACTAACCAAAATTGTTGTGCACGAACTCTTTTAGCTGTGAGAGA GCTCGCGTGAACTCTTCCACCTTACCCACCTCTGTCTCCTTTTCTTCTCC ATCTTGCAGTTCTTACGACCTCTGTCTTCTCAGGCCTTGCCTTCAAACTG CTAGATGTAGAAGAAAAGACTAACCAAAATTGTTGTGCACGAACTCTTTT AGCTGTGAGAGAGCTCGCGTGAACTCTTCCACCTTACCCACCTCTGTCTC CTTTTCTTCTCCATCTTGCAGTTCTTACGACCTCTGTCTTCTCAGGCCTT GCCTTCAAACTGCTAGATGTAGAAGAAAAGACTAACCAAAATTGTTGTGC ACGAACTCTTTTAGCTGTGAGAGAGCTCGCGTGAACTCTTCCACCTTACC CACCTCTGTCTCCTTTTCTTCTCCATCTTGCAGTTCTTACGACCTCTGTC TTCTCAGGCCTTGCCTTCAAACTGCTAGATGTAGAAGAAAAGACTAACCA AAATTGTTGTGCACGAACTCTTTTAGCTGTGAGAGAGCTCGCGTGAACTC TTCCACCTTACCCACCTCTGTCTCCTTTTCTTCTCCATCTTGCAGTTCTT ACGACCTCTGTCTTCTCAGGCCTTGCCTTCAAACTGCTAGATGTAGAAGA AAAGACTAACCAAAATTGTTGTGCACGAACTCTTTTAGCTGTGAGAGAGC TCGCGTGAACTCTTCCACCTTACCCACCTCTGTCTCCTTTTCTTCTCCAT CTTGCAGTTCTTACGACCTCTGTCTTCTCAGGCCTTGCCTTCAAACTGCT AGATGTAGAAGAAAAGACTAACCAAAATTGTTGTGCACGAACTCTTTTAG CTGTGAGAGAGCTCGCGTGAACTCTTCCACCTTACCCACCTCTGTCTCCT TTTCTTCTCCATCTTGCAGTTCTTACGACCTCTGTCTTCTCAGGCCTTGC CTTCAAACTGCTAGATGTAGAAGAAAAGACTAACCAAAATTGTTGTGCAC GAACTCTTTTAGCTGTGAGAGAGCTCGCGTGAACTCTTCCACCTTACCCA CCTCTGTCTCCTTTTCTTCTCCATCTTGCAGTTCTTACGACCTCTGTCTT CTCAGGCCTTGCCTTCAAACTGCTAGATGTAGAAGAAAAGACTAACCAAA ATTGTTGTGCACGAACTCTTTTAGCTGTGAGAGAGCTCGCGTGAACTCTT CCACCTTACCCACCTCTGTCTCCTTTTCTTCTCCATCTTGCAGTTCTTAC GACCTCTGTCTTCTCAGGCCTTGCCTTCAAACTGCTAGATGTAGAAGAAA AGACTAACCAAAATTGTTGTGCACGAACTCTTTTAGCTGTGAGAGAGCTC GCGTGAACTCTTCCACCTTACCCACCTCTGTCTCCTTTTCTTCTCCATCT TGCAGTTCTTACGACCTCTGTCTTCTCAGGCCTTGCCTTCAAACTGCTAG ATGTAGAAGAAAAGACTAACCAAAATTGTTGTGCACGAACTCTTTTAGCT GTGAGAGAGCTCGCGTGAACTCTTCCACCTTACCCACCTCTGTCTCCTTT TCTTCTCCATCTTGCAGTTCTTACGACCTCTGTCTTCTCAGGCCTTGCCT TCAAACTGCTAGATGTAGAAGAAAAGACTAACCAAAATTGTTGTGCACGA ACTCTTTTAGCTGTGAGAGAGCTCGCGTGAACTCTTCCACCTTACCCACC TCTGTCTCCTTTTCTTCTCCATCTTGCAGTTCTTACGACCTCTGTCTTCT CAGGCCTTGCCTTCAAACTGCTAGATGTAGAAGAAAAGACTAACCAAAAT TGTTGTGCACGAACTCTTTTAGCTGTGAGAGAGCTCGCGTGAACTCTTCC ACCTTACCCACCTCTGTCTCCTTTTCTTCTCCATCTTGCAGTTCTTACGA CCTCTGTCTTCTCAGGCCTTGCCTTCAAACTGCTAGATGTAGAAGAAAAG ACTAACCAAAATTGTTGTGCACGAACTCTTTTAGCTGTGAGAGAGCTCGC GTGAACTCTTCCACCTTACCCACCTCTGTCTCCTTTTCTTCTCCATCTTG CAGTTCTTACGACCTCTGTCTTCTCAGGCCTTGCCTTCAAACTGCTAGAT GTAGAAGAAAAGACTAACCAAAATTGTTGTGCACGAACTCTTTTAGCTGT GAGAGAGCTCGCGTGAACTCTTCCACCTTACCCACCTCTGTCTCCTTTTC TTCTCCATCTTGCAGTTCTTACGACCTCTGTCTTCTCAGGCCTTGCCTTC AAACTGCTAGATGTAGAAGAAAAGACTAACCAAAATTGTTGTGCACGAAC TCTTTTAGCTGTGAGAGAGCTCGCGTGAACTCTTCCACCTTACCCACCTC TGTCTCCTTTTCTTCTCCATCTTGCAGTTCTTACGACCTCTGTCTTCTCA GGCCTTGCCTTCAAACTGCTAGATGTAGAAGAAAAGACTAACCAAAATTG TTGTGCACGAACGCTTTTAGCTATGAAAGAGAATATTTGAACTCTTTCAC TTCACCCTCCTCTGACCCCTTTTCTTCTCCATCTTGCAGTTCTTATGACC TCTTTCTTCTCAGGCCTCCCCTTCAAACTGCTAGATGTAGAAGAAAAGAC TAGCCAAAATTGTTGTGCATGAACGCTTTTAAATGTGAAACAGTATATTT GAACTCTTTCACTTCACCCACCTCTGACCCCTTTTCTTCTCCATCTTGCA GTTCTTACGACCTCTGTCTTCTCAGGCCTTGCATTCAAACTGCTAGATGT AGAAGAAAAGACTAACCAAAATTGTTGTGCATGAACGCTTTTGGCTGTGA AAGAGCTCGCGTGAACTCTTCCACTTTACCCACCTCTGTCCCCTTTGCTT CTCCATCTTGCAGTTCTTATGACCTCTTTCTTCTCAGGCCTCCCCTTCAA ACTGCTAGATGTAGAAGAAAAGACTAGCCAAAATTGTTGTGCATGAACGT TTTTAAATGTGAAACAGTATATTTGAACTCTTTCACTTCACCCACCTCTG ACCCCTTTTCTTCTCCATCTTGCAGTTCTTACGACTTCTTTCAATTCTCA GGCCTCCCCTTCAAACTGCTAGATGTAGAAGAAAAGACTAACCAAAATTG TTGTGCACGAACGCTTNTTCTTCTCAGGCCTCCCCTTCAAACTGCTAGAT GTAGAAGAAAAGACTAACCAAAATTGTTGTGCACGAACGCTTTTGGCTGT GAAAGAGCTGGCGTGAACTCTTCCACTTTACCCACCTCTGTCCCCTTTTC TTCTCCATCTTTCAGTTCTTATGACCTCTTTCTTCTCAGGCCTCCCCTTC AAACTGCTAGATGTAGAAGAAAAGACTAGCCAAAATATTTGTGCATGAAC CCTTTTAAATATGAAACAGTATATTTGAACTCTTTCACTTCACCCACCTC TGACCCCTTTTCTTCTCCATCTTGCAGTTCTTACGACCTCTTTCAATTCT CAGGCCTCCCCTTCAAACTGCTAGATGTAGAAGAAAAGACTAACCAAAAT TGTTGTGCACAAACGCTTTTGGCTGTGAAAGAGCTTGCGTGAACTCTTCC ACTGTGTAGAGTTATGGCGAAGAATAAGGGTGATCTTGCAGTTCTTATGA CCTCTTTCTTCTCAGGCCTCCCCTTCAGGGGGCTAAATGTAGAAGAAAAG ACTAACCAAAATTGTTGTGCACAAACGCTTTTGGCTGTGAAAGAGCTTGC GTGAACTCTTCCACTGTGTAGAGTTATGGCGAAGAATAAGGGTGATCTTG CAGTTCTTATGACCTCTTTCTTCTCAGGCCTCCCCTTCAGGGGGCTAAAT GTAGAAGAAAAGACTAACCAAAATTGTTGTGCACAAACGCTTTTGGCTGT GAAAGAGCTTGCGTGAACTCTTCCACTGTGTAGAGTTATGGCGAAGAATA AGGGTGATCTTGCAGTTCTTATGACCTCTTTCTTCTCAGGCCTCCCCTTC AAACTGCAAGATGTAGAAGAAAAGACTGACCAAAATTGTTGTGCACAAAC CCTTTAACCATATGCAATGTTATATTTCTTTTTCTTTTTTTGCCTTTTTA TAAATTTTCTAAATTTTCAAATGTCAAATTTTATATTTGACGTCACTTAC ACAAACCTTGATTTTATTGTCAATGAGATTCCTACAACTCAGTTCAAATT ACGTAAATTTCATTATTATCTAAAGAACCATAAAATTGTTTCGATTAAAC TATTTGTATAATAATAGTGCTTTGTGTTTTGATGCCGTATTAATTTCCTT ATTCTGAGACCCGAGCTTTTCTAAAATTGATAATGATAATAATATGCCTA GCCTCGATGTCGAGTTAAATAGTAACAAGTTCATATCTCTGAATACGATA GTTTAATAAACTCTTTTTTACAACCAAACCGTCGTTGGTTTACGCATTGC ACAGGATCAGTATTTTATACTAACATTGTACCCAAACATTTTACCCCAAT GAATTTCCTTATGGGCCTCACCCTATACACTACACTCAACACTCCGTACT CATTTATGCCTAGTTTTGTCTTCCGGTAGAAAGACACCTTTTTACGGTGA AAACTTTTCTTGATCATCTTTTCCCATAAACATTAAACCTCAATGAATCT TTTCAGGGTCTAACCTTAAAGTCCCCTTAAACCCTGCATCCATGATTCTG CACCCATGGCCAGGCTTCTATCGGTGAGGCAGATTTTTTTCCGTCAAGAG ATAGGGACCTACGTCAGCGGCCGAAGTCCCTCAAAACTTCAACGCGGGGC TCCATCTGGCAAAGACCTACACGAACGGTCGAATACCTACAGATTATTGT GTGATTACTTTTCAACTGTCGAAGACCTACAGGAACGGCCTGTAATGTGA CCTAGCGGACGAATATCTCTGAATCGATTTTCTCTTTTTGCATCGCTAAA TTATCGCGTACAAATAATTGCCAGTTAAGCTATAATTTCTTATTCACGAT ATATAATTTGTGAATAGAGTAGCCTTTGCAAACGTTGAGATATTCAATTA CTGATTTGATTGACCAGTATTCACTTGGCATCAAACTTGCACAAAATGTA TTTCTTATTTTTTTCCCAAAAGTGTCATCTGTGAAGCTAAGATCAGAAAT GTGCTCAACCGAAGATTTATCCTGGAAATTTGATCGCGCCTCGAATGGTT ATAGCAGATTGAAGCTAACAAATCTCCTGTATTTTTAGTTGAATCTAAGA CCAAGTCCTTCAAGAAAATGGGAATTTCAGTTCATTCTAATTTCTTATGT CAAAAATTACTTAACAAACGAATTTTAACCGAATTTTCTCTACCGGTTTT AAAGGGCTCTGACCATGTCGGAAAATTGGTTTTAGTATTTGAACATAAAT GTTATGTTTTAGGTTCTTAACACTTTTAACAAGGAATTGCCTTTATAGAT TGCTTTTTAATCAAATCCCTTAAGAGTAATTAAGATTTTAGTTACAAAAA TAACGTTATGAACTTTAAAAAGACGTGCTAAGTTTTAATGGGTAATTAAC CTTTTTGTTTCGAAGTTTTTTTCAAACTGTCCGCCAAGAATTGAACTGTT TTAAATTTTTCGTTAAATAAATGCATCAAAAGTTATGGCTGTTTTTCTAT GAAGAATTGGGATGGAAAATGGTCAATTTTCAAGATTTTGAGACAAATAA GCTTTTAGAAAAACTTTCCGAAAAAATAATTTTAATTTGATAAAAGATAC ACCATCTACTGCAAATATTTTTTTTAAATGTTTTTTATCCGCCGAAACTA AGCTCTTCANAAAAGATACACTGCAAATATTTTTCTTAAATGTTTTTTCT CCGCGGAAACTAAGCTCTTCCAAGTTGAAATACTCTTCTTCGCAAAAGTC TTCATTTTCTTCTTCATCAAATTTTTTCATTACGATTATTAAATTTTCAG ACTCAAGGATAATTGGCCTAACAGAAAATGTATAACATGCCACAGTTTTG TGGGCTATATGAAGTAGAAATTTACATTTTGTAAGTGACAAATATCAAAA ATTCACTATGGTCAGAGCCCTTAAATCATACAAGTACCGACTCTTTTTAT TATTACCGACTTTTTGTAGCTTGCCTCGCACAAGTATATTAGTCATTAGC GTTGAAGAGCTTTCAAATCTTTCAACGAGTCATCCTCAATTTCAAAATTT TAACAAATGACTTCGAACCTTCTTGAAACGATTTTTATTATTCCTGATCG AAGGTTTGTAAGTATTTATAAGCAATAATAAATAAGCAACTCCAATAGTT TGCCCAACAGGGTTTGATTACTTTGATTTCCAATCACTTTCCGTCCACTC CGTCACATTTGGATTCTCAAATGTCCAAGTCTTGATGTTTGCCTTCAGTC TTCTTCGACCGTAGAAAACTAATTACACATATTAAATCTCTAGATATTTT GCCGTTTTTGTCTTTCATCGCTAGAATACCCCATGTTAATTTTTTGGCTT TTGGCGTAGGTCCTCGTCCGTTGACGGAAAAAATCCGCATTTGCCAGAAG CCAGTTTTCATATCTATATTTATTTATCACTGGTCATTTAAGGCTTATTT TTGCTTAGAGGTAGGTCCTAAAATATAATAAGAAAATACTCACACGCACC AAAATGATGACACAGGAAAATATTAGAAAATGAAATGGTTCTTAGACACT GACAAATGTTTTCGGATTGTTTGTTTGTGAGTGCAAGTATACTTATGACC AGACAGGTTTGATTTGTTGTCCGATTAACAACAAGCTAATAATCACATCA CTGCCATACCAAAACACTCTGTAGGGACACTTCCATTTCTAATATTTTCC TGGTTAATTGATCGCCGAAACACTGCTTTTTCCAAGTCAAGTCCATTTCT TATTGAAGTAAATCCGTATTCTAATTTTAATGCGACAATTCTAACAAGCA TCAGCTTTCAAATTATTATTTGACGTCAGTTATCAAATTTCCTGCATTAT TCTACGTCACCCAGTTTCATTATCGATCGAAGTGTAGTTCTCATGAATTC TGATAGTGTTACCGTGTTAAAATCATATCATAGTCATATGAACATGTTGC GCTAGAACTGAACCCCCTGAAGGGAAATGAATTACTATTTAAATCATAAA ATACTCCCAAAATTTGATGTGCTCGTAATTTTGAAATTTTAAGGCTTCAT GTCATATTCCTATTACATAAACTTTAATTTGTATAAGATCCACTTTTTCT AGTATCAGGGTTTTTTACTCATTGTTCTCATAAAATTCTTCTTAAATGTA TAACAAAGATTTCATGGATCCAATCATTCACGTCTTTTTCTTTGTTTATT ACAATTTTCCCTTTATTTGTTAGGTGTGAACCTTCCAGCTCGCCGTGTCA TCATTCGATCCCCTATGTTTCATGGAAAATTGATCGACGCCTTGGTGTAT AAACAAATGGTGGGGCGTGCTGGGCGGAAAGGCGTCGACACTCAAGGAGA AAGTATCTTGATATGTAAACCAAACGAGAAACAAAAATCACTTGCTATGA TGACGTCACTCTTGAAACCTGTCTATAGTTGTTTGTTAGGTAATACGCTT TTTAGAAGTACACATATATCACTTTTGGAATTTAAAGTTTAATGCCGTCC GTATGAACGACGATCTTCAGCCAAATTCAATGAAACCTAAAATTCAAATT AGTTTTAAATTTCAAAATAGTGTCCACTGTGTTTAAGTTTTTCATAAACT GCGTAAGAAGATTTGTGTCTTCTAAAGCGAAAACTATTCATAACATTTTA GATGCAAGTCGTACTATGAATCGTGCATTACTGGAGGTCATTGCTGGCGG AGTCGCAGTGTCCCCACCTGACGTCGAGCTCTACGCAAAGAGTACTTATT TGAACACGTGTTTGGCCGTTCAAACGGGCCGTCACCCTGAAGAACTGATA TGCACATCTATGAAGTTTCTACTGGAAAATGATTTCATCAAACTGCGCTT TGAGAAAAATAAGGTATAGATGAATGTAATTTGTCTTTTTCAAGTTACGT CTTCTTTTCTTATATCTTTTTGTAGAATTTGGATGAAAAAATCAAGTTGA CGCTTCGAGACAAAATGTTACTAGAAACCTCTGAGGATAAAATGGCGATC TTACAAGATGTCAAGAGGGGGCGAGGACCCAAATTAGTACTTTCGATGAT TTAGTGTACATATTCTGACCGTTGTGCTAGCAATGGCCTGAATGGAGCAG GGAGAGAAAAAAGCCGTTAGCCCCGCTGTCAGGGGGATAATTCTACGTTC TTTAAAAACTACCAAAACTCAGATGGAAAAATAATTCGAGTGATAGTATA GATTTTAATTTATCAAGCTTCGGATTAGAAAAGTTGGACGGCGTGTTTTT TACACAAAACTGCAACTTAAGTTTGAGTTTCTTACATCCACGTTTTTGCA AGAATTGCCTTTTGATTCTTTCTCATAGGATGATGTGAACGAGAAATCGA AAGAACAATACTTCCCATCACAATTGGGCACCGCTACAATGGCCTCTTCT ATGAAACCAGATGAAGCCATAATAGTTTATACAGAGTTGCAAAAAGCACG CCGTAATTTTTGCCTGGAAAACGAACTTCATATCATATATCAGGTGTCGT ATTTTTACATTCTTCTTTTTTACCCCTGAAAAACAGTACCTGTTTCCATT ATGTAATTTTGATACCTGNGCGGAAAGGCGTCGACACTCAAGGAGAAAGT ATCTTGATATGTAAACCAAACGAGAAACAAAAATCACTTGCTATGATGAC GTCACTCTTGAAACCTGTCTATAGTTGTTTGTTAGGTAATACGCTTTTTA GAAGTACACATATATCACTTTTGGAATTTAAAGTTTAATGCCGTCCGTAT GAACGACGATCTTCAGCCAAATTCAATGAAACCTAAAATTCAAATTAGTT TTAAATTTCAAAATAGTGTCCACTGTGTTTAAGTTTTTCATAAACTGCGT AAGAAGATTTGTGTCTTCTAAAGCGAAAACTATTCATAACATTTTAGATG CAAGTCGTACTATGAATCGTGCATTACTGGAGGTCATTGCTGGCGGAGTC GCAGTGTCCCCACCTGACGTCGAGCTCTACGCAAAGAGTACTTATTTGAA CACGTGTTTGGCCGTTCAAACGGGCCGTCACCCTGAAGAACTGATATGCA CATCTATGAAGTTTCTACTGGAAAATGATTTCATCAAACTGCGCTTTGAG AAAAATAAGGTATAGATGAATGTAATTTGTCTTTTTCAAGTTACGTCTTC TTTTCTTATATCTTTTTGTAGAATTTGGATGAAAAAATCAAGTTGACGCT TCGAGACAAAATGTTACTAGAAACCTCTGAGGATAAAATGGCGATCTTAC AAGATGTCAAGAGGGGGCGAGGACCCAAATTAGTACTTTCGATGATTTAG TGTACATATTCTGACCGTTGTGCTAGCAATGGCCTGAATGGAGCAGGGAG AGAAAAAAGCCGTNTGGCAGACGACCTACCAACAGAAAATTGGATTTAGA CAGGTGAGCGCGTCCTCAAACCCCCATGATGTTATACATTTTTGGAACTG GAAGAGATCAGCGCTATTTGTTTTTTTTTCTCAACTTCAGTTGAGTTAGA ATCTGAGAATGTCTGTGTGTGTGTCTGTGTGTGTGTCTGTGTGTCTGTCA CCAAAACTTTGGGGCAGCCTGGANNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTGAT GAATGACCCCTCATTTTTTTTCTTTTTTGATGCTCTTTCCAATGAGCATG GTTTCAATGCGCTAAAAACAATTTGAAAAAATCATTGCGGTCCCTAACAG CCTGTTCTCTTGGTCCTGTCTGTGTTGCATTCATACTAATATTATTGTTT TCACATTTTAGTATGATCAGTTTTCATTTATTTTCAATATATAATTTCAT ACTTTCTAATTTTTAGCTTTTTTCTTCCCTCTTTATAGCCCCTTTATAAC ATCTTAATTAATGAATACTTTGATATAATTCTTTATAATAACCATAAGAT CATGTGCCCGACGGGGTAAACCCCTGCACAAGCATCCCGCTTTCTTTTCA AATGATCAGCTGATGTTTTTTTAGTTTAATTGTGAATTGTTTTAATCGGG GAACATAGGCTTTTAAATTGAAGTTTTCTTCCTTCGAACTTAAGATTTTC TTCAATTCCCATCTGTTGGCGCGCGCGCACTTTTTACACTTCCATTCAAA AAAAGATTTATTGAAAAAATATCACCGTCTGATCGTCTGAGCAAAGACTC AGAAAGACAGTAAGAATAAAAAGCAAAAAAATTTCGGTACAGAAAGAAAT GATTAATTCTAAAGTTTTTTGATATCGAAAAGCTCCGAGTCAGACGCGTT TGCGAGAGTTCAGATTTTATTTCGAGTCGATTTTAAGTTAAGGTAGTGCG CCATATCCTCTTTTATCGTTTGATATTGATAAATGAAGTCGATATCACGT TAACTACACAATTTTAATGTAAAAACCCTTTATTACACGAGAGGTTTTAG TATGTTTTGTCCCAATGATGAATTATTCATTTCTGACCCCTACTTTAAAA ACACGATTATTCGCGCCCTTTTTTTCCTTTCCCTCTTCCCGGGATATAAT CGTTAGCTTGGCGCGCGCGCACTTTTTTAATTCCTATTTAAAAAAAAAGA TTTTGATGAAAGATAATCTTGGTCTGATCGTCTGAGCAAAGGATTAAAAT GAAAATGAAAAATAATAATCCAAAGATCAAAATTTGTTCATGGTTATTTC AGATTTCTCACGCGAGTAGCTTAGCAGGCAAACTGTGTTATCTTTTAATG AAAAAGTTTGAAATTTTGATCTTTCAAGAATTTAATATTATGACACGCCC TTTTGCCAGTGCGATAGCTTTATTGTTGTTATGTGGTTTTCATGAATTTC AACGGGACAGTACCTTGTATCTCAAAATGAAAAAAAAAATCAAAAGCGAT CGTCGGATTATTCTAAAGATCAAATAATCCACAGGGTTTTATAGTATAAA ACCCCTATCTCATTAATCAACCGATTCCAGCTTAGCAGCAAGTATTATAT CTTAGGAAATAAATAATATATTATTAAATCGTAAATATTTCAGTTCATCT TATGAATAATTAAGATTAAACCACCAAATTTTAAATTTACATTTTAAATT TAGATGGCGCGCGCGCCTTTTTCATGAATATTTTCATAATTTCATTTTTT TTTTCATCTGCCAGCAGTTACGCCCTTCCCCCACCCCGGCAAAAAAACTT GCCTCGGTGTTAGCTTATTTGTGATCAATCAATATACCAAGTTTAGCAGA AATAAGTTATTTGGTCGAACAATCGGGGAATCATAAAGGTTTGCTTCATT TTGAATTCTACATTAGTTTACTCAACTTTAATAAATCCTTGTCAATGACC CCTCAATGATATTCATTTTCGTATCTTTTATACTTTAGGTAACACCAACA TCCATTTGTGACCAATGGCCAGACTTAGATTGGTACACTTACTATAACAT CTGGGAACGCCTCTCTGCACAATGTAAGCACGTGGGCGAAATGATCGGTG TCAAAGAATCCTTTTTAGGACGTGCCATGCAGAACCGTGTCAGTTGTGTG ACGGCCGAGCAGAAGCGTGTCATGCGTATCCATCGCAGATTTTATGGTGC TTTGGTATTAAATGACCTTTGTAATGAAGTCCCTATGTCAGACGTCAGCC GTAAATATAAAGTCCATAAAGGTCTTTTGCAATCGTTACAAAACTCAGCC GCGACCTACGCAGGTTTCCTTTAATTTCTTTTATTAATCGTCCTTCATCC TTTTAATACCCACTCCTGAGGTCGCATGTATTAGCTATGATATGATAATT AGAAAAACCACTTGACCATGGTAATATTTGAGTTATGTAACTAATCTATC GTCAAAAGGGACCCCTCATTAAACCCTCATTAATTACGTCTAGCTCGATC TGTATTTCTAACTTACTTCCCATTCGAGTTCAAATAAGCGAGATGAACCT GTACAATGATCTTTTAGATTGTGCTATCACCAGCTTTTACCCCACTTTAC TTATTGGAAAGTTATTTTGGAAGGTTAAATCTCTTGGATTTTTCGCTAAA TTTCACTGACTACCCCTGGATTTTATAGGTCTGAGATGAGGGAATCTTTT TTTTTCTGAAATCAGCCGAGACCATTGGTTTTGATTTGGCTTTTCTCCTT ACCTTTGTTAGGTATGATGACCGTGTTTTGTAAGAAACTTGGCTGGTCAT GTTTAGAAGTCTTACTGGAGCAATTTCAAAGTCGTTTGTCATTTGGTGTT TGCCGGGACCTGTGTAATCTGGTTCGCATATCGTTACTGAATCGTTTCAC TGCTCGTTTATTCTATCAGAACGGATTTCAAACTGTGAGTGCCATAGCCA ATGCAAGTGAAAAAGAAATCTCTAAATTGCTTCGTGAATCGACACCGTTT TACAGTAACAAACTAAAAGGAAAGGATGCTGAAATGGTGGGTAAATCAGT ACCTAAATGTTTATGGTTGAGTGGGAAAGAAGGCTTGTCGGAGCAGGAAG CTGGCAGATTGATCATTGACGAAGCCAAACGTATCCTTGCAGCGGATGCA CAAGCACTAGGCATTCCCATTGGGCAGTTAAATCTCTCATCCAAGAATTC GACAATCTCTAAATCTTCCTCCAGTTCATCAGGCAAGAAAAGAAGATCCA GCCTCACTAAGAGTACTATAAAACGTAGGAATCGTAAAAGAGCATCGGCT GAGAAAATCACTCCGTTGAGATCTTCGAAACGTTTATCTCCCGAACAACG TAGTGGTGAAAGAGTTGATAGTAACTCAAAAGTTGGAACACAACTAGCGT ATGCTTTGCAGAAAAGCACGTCTCAATCGCCTAGTCCTGTGTTACGAGAA ATACAGAATCTTTCGACTCAGAATCTCAGTAGAAATTTATCTTTGGCTGA TAATGACATGTCTCTATTTCAAGAAAATCAAGTCATTAACACTGCTCAAA AGATGGTTGAAAATTTGAGTAATGATTCGTTACTCTTTGGCGAATCATTG CCAAACATACTAGGAAAAGAAAATCAATCTGATATTAAAATGACTACAGA CATTTTGATTGAACAATTGAAAGATACAGTGCTCCACAACCAATTATCCG ATAAATCCGAAACTCAAGACTCGTTATTCTTGATACCAAACCAAGACTTC AATAGCTTTTCAACTAAGAATCAAGACCAAACTATGTCAGAGCAAACACC GAACCTTTCCGAAGATCGAATCCTGAACACTGGGAATTTTTGTGATAAAC TGCACACCCAAGATTCTTTGTTTTTGAATGATAAAATTCCAAGCTTCTCA ACCCACACAGTTAATAAAACCAGAGATATTGTTACCAAGGACGAACCAGA ATCTCGAACGATTGCAGAATGTGAACTCAACCACCAGGAGCAACAGGGTT CTGTGAACAGTAAGAAAACCAAACGAAAGACAAGCGATTACTTGGAATCA TCTGATTCGCTCTTACTCTTGTCTGACAGTGCTTTAAAACCGAAAGAAAA ATCACCAATACTAATCGAGTCGCCGAAAACCGAACTAAGTGTGACCACAC CCTCGCCAAACCTTTCCTTGCGACTATCAACAACTGACGAAGCACTGGAC ACTTTTCCTAAAATATTACCACCCATGAAATTACATTCCCAATTCAATGA CGCTTTAACCGGGGAAGCATCAACTTTGCAACGAAATTTAACGTCAGTTA CTTCACCGGAGGTTGATTTATTCGATCAGAACATTGAAAGCAATGACAAC AGTGGAGACCTATTCGAGAGTACTGAACTTTTCACTAAGAATTCTACATC TCAAGCAACAGAGAGAGTCACTCCTCAAGAAACCAACCTAAACGAAAGTG CATCTAATGAATTCCTAATTATCGATGTCGCATCCTCCAAAACGTTATTC TTGACATTCATCCAAGAATGGAAAGCCAAATCATCCTTCACCGTTGCCTT CTCTTGTGAAACTCATAAACCCACCAGTCAAACAACTTCATCAAAGATCG GCCGTCCCTTGAGATCTGCCAGAGACGTTTCAACCACATCCAAACCATCT GCAATGTCGTCAACCAGCAATCGTTTACTATATACCAGAGATGATTTACA GTTGACAGGACTTGCCATATGCTGGGGTAAAAAGGATTCATACTACATCA GTTTGCAGGAAGACGGTGTACGTCACAACGAATTGGACGATACTGCCTTA CCTCCAGATGTCTGCCAGGAACTGCCTTTGCCAGTCCGTTTAAAGAGTAT CCAATCCGTCCTTAACCAGCATGCATCTTCGACTATCATGGGTTTTGACC TGAAGGAGCAGTTGAAGATCATATACGAGTTGTGTGATACTTTGTTGNTA TCATTGGTTTTGACCTGAAGGAGCAGTTGAAGATCATATACGAGTTGTGC GATACTTTGTTACCAAAAGCAGTTTTGAAAGACCCGAAAGTAGCTCACTG GTTACTAGAGCCTTCACAGCGAGAGAAGAATTTGTTCGGAATAACTAAAC AATGGTTGGATGAAGACCATGTTAGCTTGACTGAAGGTAACGTTCTTCTT TACTTTTATTCTTATAAGGCTTTTCTGTCTATAGGTCATAAATGTTATTC CTGTACCATATTTTTATCGGATGAGCTGGAGTTTTTACAAGCTGGGATGC GATTTTCTTTGTGTGTATTTTACGGAACAAGCACACCCGATATGTTATAC CTCCAAAAAGTTCTCTAACCCAAAGTTCCGAAGTCCCGAGTTGAACTATA TCAATATTCTCTCCAAAAAAATTAAACAGCCCAGGTCCCGAGGTCCCGAG GTCCCGAGTTGAACTATATCAATATCATTTCCAAAAGATCTACAACCCTA GGTCCCGAGGTCCCGAAGTCCCGAGTTGAACTGTAGCAACACTCTCCAAA GTATCTACAACCCCAGGTCCCGAGGTCCTGAAGTCCCGAGTTGAACTGTG CCAACACTCTCCAAAGTATCTACAACCCCAGGTCCCGAGGTCCTGAAGTC CNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNCCAACACTCTCCAAAGTATCTACAACCCCA GGTCCCGAGGTCCCGAAGTCCCGAGTTGAACTGTGCCAACACTCTCCAAA GTATCTACTCCCCCAAGTCCAGAGGTCCCGAGTTGAGTTATGTATGCTCT CTTCACCCATAAAAACCCACACCCCCAGGTCCCGAGGTCCCGAGTTGAAC TATATCAATATTATTTCCAAAAGATCTACAACCCTAGGTCCCGAGGTCCC GAAGTCCCGAGTTGAACTGTAGTAACACTCTCCAAAGTATCTACAACCCC AGGTCCCGAGGTCCCGAAGTCCCGAGTTGAACTGTGCTCACTTTTCCCGC GTGATACCATTCCAGCCCGACTGGCGTGCCGTCTACTCTTTCGGTAGGTT GAATGAGCTCAAAAACCAAACATATTAGTCTTGAAAACTCTAAGTTAACG GAAACTATATGAGAACCACCATCCAAATATATATTTATCTAGGGATTGAC CTATTTTTTGACCATATTATAATTTTCAATCTTGCTGTTCTCAACTTCAG TTGAGCTAAAATCTGACAATGTGTGTATGTATGTGTGTATGTGTGTCTGT CCGAAAACTTTGGGGCAGGCTGGAGACTTCAAAAAAGATTGGATTTGGCT GAAATTTGGCACACTTGTTCNTGAGTTATGCATGTTCTCTTCACCCATAA AAACCCACACCCCCAGGTCCCGAGGTCCCGAGTTGAGTTATGTTCATGGG TGAATATCTGGGGGTGTTTTTTCATTTTTTGAAAATTTTCATTTTTAAGG GCGTGGTCACGAGTTTTCGCCATAACGAGGCTAAAACTTTGGGGCAGGCT GGAGACTTCAAAAATGATCTGATTTGGCTGGAATTACTTAGTTTTTACAT TCAAATCAATTCTAAACCCTAATTTTTTTTATCAGACTTAGCCTATTGAT TTTACAATTGGGCCTACGAATGATTTAAAGACACTGCAGTTGAGCCCAGT GCGGTTAACACGTTCGTCAGTGACGTTAAGAAAAGAGCACATATGATTAT ACAGTTGAACTTGGGTGGTTTAAAAAAGTCGATAAAAATAGAGGATCCTT GTAGACGTGACACTGATGAACTAATTAAAGGCAATAAAAGATGAAGAAAC CTAGGGAAGATTTTTTAGAGGGTAACTAGTAGGCCCTCAATTTACGGCTG TTAAGTTAGCCAGTATCAGTAAGCCAGCCACCTGACTGCCGATAAAGTTT GGCTTTAAATTTTCATGACCTCGGATTGTAGATACTTTGGAGAATATTGA AATGATTCAACTCGGGACCTCGAGAACTGGCGTTGTAGATACTGTTGAGA ATGTAACCTCAGTACCTGGGGTTGTAGATACTTTGGAGAGTGTTGGCACA GTTCAACTCGGGACTTCGGGACCTGGGGTTGCAGATAGTTTTGACAGTGT TGGCATAATTCAACTCGGGACTTCGGGACCTCGGGACTTGGAGGAGTAGA TACTTTGGAGAGTGTTGGCACAGTTCAACTCGGGACTTCGGGACCTCGGG ACCTGGGGTTGTAGATACTTTGGAGAGTGTTGGCACAGTTCAACTCGGGA CTTCGGGACCTCGGGACCTGGGGTTGTAGATACTTTGGAGAGTGTTGGCA CAGTTCAACTCGGGACTTCGGGACCTGGGGTTGCAGATAGTTTTGACAGT GTTGTTATAGTTCAACTCGGGACTTCGGGACCGCGGGACCTGGGGTTGTA GATACTTTGGAGAGTGTTGGCACAGTTCAACNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNCGCTCCGAAAACAATTAAAATGCTAG ATCCTATCCATCGGCACGAAATTTAAAAAGTCAAATTTTTGCTTCACTTT TTTTTGCTGGAGAAAGTTTAAAGTTGCAAATCTAGCCCTTCGGGCTTAGA TATCTGTGAGTTCAACTCGGGACCTCGGGACCTGGGGTTGTAGATACTTT GGAGAGTGTTGGCACAGTTCAACTCGGGACTTCGGGACCTCGGGACCTGG GGTTGTAGATACTTTGGAGAGTGTTGGCCCAGTTCAACTCGGGCCTTCGG GACCTCGGGACCTGGGGGGGTAGATAGTTTTGACAGTGTTGGCATAATTC AACTCGGGACTTCGGGACCTCGGGACCTGGGGTTGTAGATACTTTGGAGA GTGTTGGCACAGTTCAACTCGGGACTTCGGGACCTCGGGACCTCGGGACC TGGGGTTGTAGATACTTTGGAGAGTGTTGTTGTAGTTCAACTATCGGGAC TTCGGGACCTCGGGACCTGGGGGTGTAGATAGTTTTGACAGTGTTGGCAT AATTCAACTCGGGACTTCGGGACCTCGGGACTTGGGGGAGTAGATACTTT GGAGAGTGTTGGCACAGTTCAACTCGGGACTTCGGGACCTCGGGACCTGG AGTTGTAGATACTTTGGAGAGTGTTGTTATAGTTCAACTCGGGACCTCGG GACCTCGGGACCTGGGGTTGTAGATACTTTGGAGAGTGTTGGCACAGTTC AACTCGGGACTTCGGGACCTCGGGACCTGGGGGTGTAGATAGTTTGGAGA GTGTTGTTATAGTTCAACTCGGGACTTCGGGACCGCGGGACCTGGGGTTC TAGATACTTTGGAGATTGTTGTTATAGTTCAACTCGGGACTTCGGGACCT CGGGACCTGGGGGTGTAGATAGTTTGGAGAGTGTTGTGATAGTTCAACTC GGGACTTCGGGACCTCGGGACCGGGGGGTGTAGATAGTTTTGACAGTGTT GGCATAATTCAACTCGGGACTTCGGGCCCTCGGGACCTGGGGGTGTAGAT ACTTTGGAGAGTGTTGTGGACGCTTGAGGGATTTATCTTTTATTTACCTC CTATCTGTTCTGTATTTTATAAATCAATTCTACTGTATACGATAGGAAAA AGTTCTATGCTCAAAGCATCTCTGATTTGTAAGTATCTTGTAAAAACTCC AGCTTGACCCATTTTTATTGCACATGTGCTTTTTATATGCTTCAAGCATT CTTTTTTAATGCCAAACTCATAAATCTTGATTTGCTTTTCATTTAGGTTA CCTTATGTACACCGGGTACTAGCATCAGATTGACCGACTCTAAGACCTCA AAACACTGTTTTGATCAGTTTTGTCTTGGATGTTCTAACAGTTTTATTGT TCAATTTAAATCTCAGTAAACTGAAGTTTAACACGATTAATTTTCCAAAA GAGTCGATATAATTTCAAGAGAGAATACAGAGAAAGAAAAGAGCGATAAA TTGGGTAAAAAGTTATACATATTTTACGAGATAGTATGAATTGTTTTGGT CAAGAAATTTTGAAACCAATTGGTTTTGGACCAAACTTCTTTTTGTGTCT TCTGTTTCTATCAGATAAAAATACAATGTTTAAAACACAAAAAGAAAAGA AAAGTGATCATAAATTAATGAAAAGCTACAAAGTGTTTTAGCGAAAAAAA TGGAGAAAATTCTTCTTCTGGTTCAGTAGTACGTAGCTATATTTTCCCGT TTGGATAAGACAACATAAATAATACAAACACAGATAAATAATAAATAATT TTTTTCTTCTTACTTGATATATAAAGAAATCGCTCAAAAAATAACCCCCA AAAAAATATTAGTAAAGAAAAATGTATTGTAGTTGCAACACGAGGCAAAA AAATTGTTGTTGTAATTTTTTTTGACATTGCCAAAAAATGTTGACGCTGA CAAAACATGACAGGTGTCTACAGGCGGTTTTGTCACTATCGATGTTGATA ATTGATCAAATATTGAAATAGTATGAATTGCATCCTAAATCGACGACTTT CATAAAATCGTAAAATTTGAAGAAAAAAAACGAGTTAAAAATGCGTTGTT TATTTTTAATGCCGAAACGAGTAAAATTATCAATTGGATTGTTATAATTT TGAAGATTCAAATATTACAAATTGAGATGGTAATTGAAATTCTGGGAAAC TTTATTGGGGGAGACTCGATGATTAAAGCGTTATTCTCGTATAGGTTTGA GTGGTGGAGTAGGGACACGTGGGTTTGGAATGGTCCCTAAACCCGGTTGT TCAGGGCGTGTACGAGCATGCGTCGAAAGTGTACTTGTCAATCAACTCAT GTCTACCCTGCACCAAAAGTTGACACAAGAAAATCTACTGGCACCATTCT TAGAGGTATGATTGTGTTTCTTTTTTGAGGTCTTAAGTATATTTTTATCC ACTTGGCTCCGACTTTAATTTAGGAAGAGGTAAATATACTCAAACAATGT ATCCTTTTTTTATCAACTACAGTACTGTATAAAGTTTTGGTTCATCTTTA TATAGGACTTATTATAGAGATTTTGGAAATTTGGAAATTACTTCAGTGCT GGGGTCTTTCATTTCCGATAGTTACGAATAAGCACTTTTATGAAATGAGA AAAATTTGTAGGCGAAAGAAATATTTCGATTGAAAAGCAACTGAAAAATA TCCTTTCTTCTGTACTTTACTTTTTCTCGAAATTTATTATTTCTTCTTTT TTCATTATTTTTTGTTCTATTTCTGACATTATTTCCCCAAAAATGATGAA TAATTTAGGCCCGAAAATTATATTTTCATTGAAAAAAGGAATATTCGATT TTTCTATTTTATCACATTTGTTTTCAAATTCTTTCTTATGTTTCTATTGC AATGTTATCTTTCTTTCTCCATTGTTTCATGAAGCAAATTCGAGGGATTA TGCTTCGCAGGTTCATCTTCCATTTGCTTCTTCCCTTCTTAGTACCCTTT GTTTCTTCGATATAACTTAATTTTGTCAATCTTTCTTCTTCTACTTTATG TTGATAAAAAAGGAAAGTTCTGATCAAGCACTTTACCGCACTAAGATATC AAAAATTAGTGTCAAAAGAAAGTTCCAAAGTCCGAAGATTATTGATACCC TACCCCTTTTTCCTTTTGATTTAAAGTTAGGGGTTTTGACACTTGAGGCA AGCTGAAAAGAGCTGATAAGTCGTCCATCAAAATGGAAGGACGAATAAAG TCTTTTTAATAATTTGTATTTGTGAAACCATTAAACTTGGCACTTAACGT ATCTTTAATAGTTATACCCAAATAAAAAAAACCTCAGAATGAAACCCAGC AATTAAAGAGGAACAATAATTTTAGCAAAATTATACCTCTACGATTGTGC ATTTTCCTCTCTTAATCTAAACCGGTATATCTTTATGATAATAAATTCTT ATTTTTTGAAGAAAAAAGTGCCATGGGGGGAAACGAATGATGCTTTTTAA GGAAAGACTTTATTTTAGAGGGATTTGATGCAATTTTTATCATGCTTTCT TAAAGAAAAACCATAATCCTATAAGGTAAATAGCAATGTATTCTTAAAGG AAATGACGATGTAAATTTTGGAGACAAAACTACCAAGTGTTTTTTTAAGG AAGATGATGATACCTCTTAACCCTTCGAGCACCTTCCTTTCTTTAGTAGG GGAAGAAACATCTTAGGGAGAGGGTTGAGCCCCCCTTAAAATCTTAAGAA CGACCTTGAAATTTTGACCATATATTGATAATTGGAGATGATTTGCAAAA TTTTCGATTTGACGCAAATTTGTTTTGAAGGCTGATTTGTCAAATAAAAA GTATAGTAACTGAAAAAAATTGGTTTTGTGAGTATTTGGTACTTTCCAGA CCAAGCTGTAAAATACACATCGACCCCTGCCGGAAATTATAGACTACTGG AGCTCTCGAAGAATTTTCACCAGTGGTAGATGACCATATGACAGTATGTA TAATTTTAGTTTGATCACGTGCGTGGTTGATATTTTACAGACTGGTCCAT TTCTTACTGAAAATGCTCAATTTCGGCTTTAAGCTTGTTTCATCATGATA CCTTACGCTTGTCAAAATTTCAAGTCAATACATTTTCCAACACTGACTCA GATACAGTAATCCGGGCATAATTTTGGGTCAGTCTGTAAAATACACGACC AGCAGGTGGCAATATATTTGCCTTGTGCTCTAGAAATACATATCACGTGA AGTTGTCTCTATGCTCTCAAATTTGAGCAAAATTAATTAAAAGTGAAAAA AGCGAGAGGGGGTCCTACTTTTCAAAATTTCCAAAGAATGTACTGTATCA ATGTAGCCATCAATGTAGCCAAAATTTTCACTAAAAATGCCAATTCGCGT ACACTTGCAAAATTTCAGTTCAATTGGAAACATATTTCGAAATTTATCAA TAATTAGAGAGAGGCTTCTTTGCCCCAATAAGCACGAAGGGTTAAAAGGA AATCTAACATGTGTTTTTTTAATGAAGTAGTGGTGCCTTTTTGAAGAAAA CTGTCAATATATTTTTAAAGGAAAATAATGATATGGCATTTTAAATGATC TTCCTGGTTGGCCAATGGTGTCACTAAACCTCAGCCCCGATTTCAAAATA CGGTAAAACTTTCGAGGAAAAGTTTTTTTATGTAAAGGTTTTTTCGAAAG GAAATGACGATGCCGTATTAGAGAAAATCTGCCATGTAAATAGTCATTCC TTCCGATAGAGAACTGGCATGTATTTTTAAAGGAAAACGGTAAAGCTTTT GGAAAAACTCCCCTCTTTTAAAGGAAAACGAGAATGGCATCTTTTTGAGG AAAGCTGTTAAGTATTTTTAAGGAAAATAGTGGAGGAATATTGCTACTAT GATCCCATTAATTTTCACTCTCCTAAAAATCAAGATCAGGCTTCTATTTC TAGTCTAGTTAACCGTGTCATCCAGTCTAAAAAGCTTTTTTAGGAAAACA GCGATGTATTTTTAACGGTAAATATCGACTTCATTTTGAACAAAAATAAA AAAAACTGCGAAGCGGAATTTAACCCTTCGAGCATCTTGGGGAAATTTTT GATCACTTTTGAAATATTTATCAAATTGACTTGAAATTTTGCAAGTGCAC CAAGTATAAATTGGCATCTTTTGTAAAAAAATAGGTAATGACGTCTTTAT TACTTGATGATATCATCATTCTTTGAAAATGCCGAAAGGCAACCCAATGT ACCATCTATTTAGCACATAGGGTTAATTCTATACCACTAGCTGGTATCAA CCGACGCAAAATTTCCCTTTTTGTCTAAATCAGCCCCAGGTTACTATATC TAGGGTTAGGAAATTTTGACAATTGTTGTACGAGCTTAGAACCGAAATCT AGCATTTTTTACAGAATCAGACGAGGGGTTATTTATGATATCAGTGAGCA TTTTAGGTAAAACAAACGGACTGGTCTGTAAAATACTAACTACGCACGTG ACCAAACTAAAATTTCGAACACTAAATGGTCAATATTTACCACTAGTGAA AATTTCTAAAAAAATGTCAAAAGCTCCAGTAGACGCTTTTTTTATAAGAA TAGTGTACTTTGGATGAGGGTCAAGTATTCTTAAGAAAGTGCCAAAATTG AGGGTGAATTATTCTTAACGTATTCTTACTTTTTTAAGACTTGACTTTTT TACAAACAAGAGAAATGATCAATTTGAGAGTTTTGGACTTTTGAGTTAAC ATTTGAGTTAAAATTACATTTCTTTCTAAAGCTTTAATTTATCTCTAACA GTTTTTTCTGTTAACCAAATACAAAATGACTGTATTCTAATCAAATTCTG TGAAATTCACCCTAGAGTGTATTCTTAGGGTATTCTTACGATTTGGCCAA TTTTCACCCTGATATTTGTTATAGTTCCTGAGTTCCGGCAAGGGGTCGAC TTGTATTTTAGAGAACGTGGTCTGCAGAGTACCAAATACTCATGGGACCA ATTCTTTTCCGTTACTAGTCTTATTTGCTTGACAAACCTGCTTTCAGAAA CAAAAAAAAAAAATGCCAACGGTATGTAGTGACGAACGAACCGATCAAAA TTTGATCGGTCGTACGTAGCACTTTTGCCGGGTGAGTTAAGGAAAGTCCA AAACATATTTCAAAAAATTATGATGACGTCAGCACATTTTAACGTTTTTT CATTTTGACCGACAGAAAATGACGTCTTTTCGGCCCAACACTTTTCGAAA TCCTCTCGTTAATATGCTTCTTTAAAGCTATACATAATTTGGTAAAAAGG GTGGGAAGTGGTCGGCGTCACGCAAAATATGTTTTAGACTTACCTTAACT CACCTGACTTTCGCTAATCGCCTAGTAGTTTAAAGATAAAACTTAACTTT AACAAAAAAGATTGAAATTGTAATTTGTTTATGTAAATTGTAATGTGGAT TTCTGGTTTGGTTTCCTAAAACAGCCTGGTTCGTGGAATTCATTTCGCAG CTACAAAATTAAAGTCGCTAAATCGGGAAAATCAACCCCACGATAGGTCC AATAATACTAAGCCTTATTCCCTCTGAGTCTGAAGAGTAACTTTCAACGG AGAGGGGGATTGGGTGATTAAATTGGAGACGATCGTCCCAAAATCAACAA AATTAAAAGATGAGACGGTCAGATTCGTAAATATTTTTATAAAATTAAAA CCTCCAATTAACGGACACTCTAAAAGACGGACACCTCTGATTAGCGGACA ATTCTATTTTCCCCGACCATCTCCTATTCTAATCCACATAAAAAGGTTTT CAATAGGGGACACTCCATTAGTGGGCCCTCCAAATTAGCGGATATAGTTT TTTGCATGAAATGGCCAAAACCCTTCTTTTTCCTCTCTAGCGGACATCGA CGGCCAAACTGATCACAGACTTTAAAAAAATGAGACAAGATTGATTAATC CAAACTATTTATTTCTTAAACACTTCAAAGTTTCATTGAACAAATTGCTT ATAAACGTTTGGAGCGCTCCGTTTATCTGGTCGGTGAATTTGCTAACATC GTAAAAATGATAAATTTCAGGGACCTCAAGACTAATATGATTCATAAAAA CTACATTGTTGCATTTGAATAATCATTCTCTTGTTCTTCCATGTCCCAGT GTCTCTAGAAAAGCATTTTGGACCAACATTTTACATACCTAACAACCCCT TGATAATACTTTATACCAAAATTAGAGTACAAATTGAAAAGTTTCTAAAT GGTGGGTACTTCTAATTAGCGGACACTAACCCTATATCCGATGGTGTCCT CTAATTAGAGATTCCACTGTATTCCTTTGTTCCTTCTGCAGATTGAGATG CCATCTTTGCGAACTCTCTCCATCATCGAAATTAACGGTATCGGTTTCTG TGATCAAGCCTGTGAAAAATTGAAGAAACTGATGAAAGACAAGCTGTCCA GTCTAGAGAAGCAGTGTTACCAGCTGGCCAAACGTACGTTTTCACTAACC TCCCCTGACGATGTAGGTAGGGTACTTTTTATCGAGCTCGCGTTACCTTG TTTAACTGAAAATGGTCGCGCGACACGCACTAAAGGAAAAGTCAAACATT TTCGCACGTCAAAAGACGTGCTAGAGAAACTGGTTACCTATCATCGTTTG CCAAAGTTGATTTTGGAATGGCGTCGTATCAATAGTACTTTAACCAAGAT CGTGTATCCAGTGCAACGCAAGAAACTTAAGCTACCCGAATATTCAATGT ACCGGATTTATACGGAATCCCAATTTCATACGAGTACCGGTCGTGTAACC TTCACTGAACCTAACATACAGAACGTGCCGAAAGAATTTGATATTAAAGT TTCGGTCAATGAACCAAGTATGAAACGTACTGTCGATGCAGAATCACCTG GGGTTGTCAAAGCAGTTAGCATGCGAGGCGCTTTTGTACCTTTCGAAGGT GGCGTTTTCGTATCTGCTGATTACTCTCAATTAGAACTTCGAATCATGGC TCATCTGTCTGGAGATGTGAAACTCATTAAGGCTATCAACGAATCCAAAG ATGTGTTCAAGAGTATTGCTGCTGAAATTTATCGGATCGATGCAGACGAA GTGATGCCGTCTCAAAGACAGCAAGCTAAACAAGTTTGTTATGGGATTCT TTATGGTATTGGTTCGAAATCACTTGCCGAACAACTTGAAACGAATGTCG AGGAAGCTGCAATGTATGTTGAAAATTTTAAACGGAAGTTTAAAGGCGTA AACTCGTTTATTAAGAAAACAATTGATAGTTGTCGGAAACTTGGCTATGT TTCTAGTATGGCTGGACGTAAGAGATACTTACCTGCAATCAGCTCGTCTG ATTCACACGCGCGCTCGCAAGCGGAGCGCCAATCGGTCAACACGGCCGTG CAAGGGTCGGCAGCTGATCTTGTTAAGAAAGCTATGAATAATATTTCCGA TAAACTACGAGAACATTTTTCGCGACTGTGCTTGAAACGGAACTCTCGAG GTTCCCGATCGGTTTCTTCGGATTCGGGACCAGCGAAAGGAGCTTTTCTA GTTCTCCAAATACACGATGAACTCTTATACGAAGTCAATCGAAAAGACGT TGATTTGGTTTTACAAATCATTAGAAATGGTATGGAAAATGCGTATAAAT TACTTGTCAAAACACCTGTTAAAATGCATATTGGTAATAGTTGGGGTCAG TTGAAGGATGTAGAGTGAATTTGTATGTTGTAGTGGAACTATATGGAGAT ACCCAGTTAGCCTTTAGACAACTTAAGGGAACTCTTTGGGTTTTCACCGA AATTGAAATAATTCCTGCCTTGCAAAAGTAAGTTAAGTAAGTTCTTGCAA AAATTATGTTATCGAAGTTAACCTAATTTGCTCATTTTAGGGGAAAAATT ATTTTTCGACAAAATTAAGAAATTACAATACTCGCCAATATTATTTTTCG CCAAATTTCATATTTTTACGATTTTTGCTCTTTGTCAAAATTAGTTTAGT GGGGTCGTTTAGCATAATTTACAGGAAAAAAATAATATATAGCTGAAACT TTCTCCAGACCTCTCTATAGGATGCTTATGCCTCAGGAAAAAAATCCCCT AGAATCCCACTGGTGGAACATTCCCTTTTTGGGCAATTTCTTTTTTCCCC AGGCAAAACCCT

Coding sequence (CDS) from alignment at sc0000012:1126727..1162938-

>TCONS_00001979 ID=TCONS_00001979|Name=TCONS_00001979|organism=Clytia hemisphaerica|type=CDS|length=39798bp|location=Sequence derived from alignment at sc0000012:1126727..1162938- (Clytia hemisphaerica)
GTATGATGACCGTGTTTTGTAAGAAACTTGGCTGGTCATGTTTAGAAGTC
TTACTGGAGCAATTTCAAAGTCGTTTGTCATTTGGTGTTTGCCGGGACCT
GTGTAATCTGGTTCGCATATCGTTACTGAATCGTTTCACTGCTCGTTTAT
TCTATCAGAACGGATTTCAAACTGTGAGTGCCATAGCCAATGCAAGTGAA
AAAGAAATCTCTAAATTGCTTCGTGAATCGACACCGTTTTACAGTAACAA
ACTAAAAGGAAAGGATGCTGAAATGGTGGGTAAATCAGTACCTAAATGTT
TATGGTTGAGTGGGAAAGAAGGCTTGTCGGAGCAGGAAGCTGGCAGATTG
ATCATTGACGAAGCCAAACGTATCCTTGCAGCGGATGCACAAGCACTAGG
CATTCCCATTGGGCAGTTAAATCTCTCATCCAAGAATTCGACAATCTCTA
AATCTTCCTCCAGTTCATCAGGCAAGAAAAGAAGATCCAGCCTCACTAAG
AGTACTATAAAACGTAGGAATCGTAAAAGAGCATCGGCTGAGAAAATCAC
TCCGTTGAGATCTTCGAAACGTTTATCTCCCGAACAACGTAGTGGTGAAA
GAGTTGATAGTAACTCAAAAGTTGGAACACAACTAGCGTATGCTTTGCAG
AAAAGCACGTCTCAATCGCCTAGTCCTGTGTTACGAGAAATACAGAATCT
TTCGACTCAGAATCTCAGTAGAAATTTATCTTTGGCTGATAATGACATGT
CTCTATTTCAAGAAAATCAAGTCATTAACACTGCTCAAAAGATGGTTGAA
AATTTGAGTAATGATTCGTTACTCTTTGGCGAATCATTGCCAAACATACT
AGGAAAAGAAAATCAATCTGATATTAAAATGACTACAGACATTTTGATTG
AACAATTGAAAGATACAGTGCTCCACAACCAATTATCCGATAAATCCGAA
ACTCAAGACTCGTTATTCTTGATACCAAACCAAGACTTCAATAGCTTTTC
AACTAAGAATCAAGACCAAACTATGTCAGAGCAAACACCGAACCTTTCCG
AAGATCGAATCCTGAACACTGGGAATTTTTGTGATAAACTGCACACCCAA
GATTCTTTGTTTTTGAATGATAAAATTCCAAGCTTCTCAACCCACACAGT
TAATAAAACCAGAGATATTGTTACCAAGGACGAACCAGAATCTCGAACGA
TTGCAGAATGTGAACTCAACCACCAGGAGCAACAGGGTTCTGTGAACAGT
AAGAAAACCAAACGAAAGACAAGCGATTACTTGGAATCATCTGATTCGCT
CTTACTCTTGTCTGACAGTGCTTTAAAACCGAAAGAAAAATCACCAATAC
TAATCGAGTCGCCGAAAACCGAACTAAGTGTGACCACACCCTCGCCAAAC
CTTTCCTTGCGACTATCAACAACTGACGAAGCACTGGACACTTTTCCTAA
AATATTACCACCCATGAAATTACATTCCCAATTCAATGACGCTTTAACCG
GGGAAGCATCAACTTTGCAACGAAATTTAACGTCAGTTACTTCACCGGAG
GTTGATTTATTCGATCAGAACATTGAAAGCAATGACAACAGTGGAGACCT
ATTCGAGAGTACTGAACTTTTCACTAAGAATTCTACATCTCAAGCAACAG
AGAGAGTCACTCCTCAAGAAACCAACCTAAACGAAAGTGCATCTAATGAA
TTCCTAATTATCGATGTCGCATCCTCCAAAACGTTATTCTTGACATTCAT
CCAAGAATGGAAAGCCAAATCATCCTTCACCGTTGCCTTCTCTTGTGAAA
CTCATAAACCCACCAGTCAAACAACTTCATCAAAGATCGGCCGTCCCTTG
AGATCTGCCAGAGACGTTTCAACCACATCCAAACCATCTGCAATGTCGTC
AACCAGCAATCGTTTACTATATACCAGAGATGATTTACAGTTGACAGGAC
TTGCCATATGCTGGGGTAAAAAGGATTCATACTACATCAGTTTGCAGGAA
GACGGTGTACGTCACAACGAATTGGACGATACTGCCTTACCTCCAGATGT
CTGCCAGGAACTGCCTTTGCCAGTCCGTTTAAAGAGTATCCAATCCGTCC
TTAACCAGCATGCATCTTCGACTATCATGGGTTTTGACCTGAAGGAGCAG
TTGAAGATCATATACGAGTTGTGTGATACTTTGTTGNTATCATTGGTTTT
GACCTGAGTAACACCAACATCCATTTGTGACCAATGGCCAGACTTAGATT
GGTACACTTACTATAACATCTGGGAACGCCTCTCTGCACAATGTAAGCAC
GTGGGCGAAATGATCGGTGTCAAAGAATCCTTTTTAGGACGTGCCATGCA
GAACCGTGTCAGTTGTGTGACGGCCGAGCAGAAGCGTGTCATGCGTATCC
ATCGCAGATTTTATGGTGCTTTGGTATTAAATGACCTTTGTAATGAAGTC
CCTATGTCAGACGTCAGCCGTAAATATAAAGTCCATAAAGGTCTTTTGCA
ATCGTTACAAAACTCAGCCGCGACCTACGCAGGATGATGTGAACGAGAAA
TCGAAAGAACAATACTTCCCATCACAATTGGGCACCGCTACAATGGCCTC
TTCTATGAAACCAGATGAAGCCATAATAGTTTATACAGAGTTGCAAAAAG
CACGCCGTAATTTTTGCCTGGAAAACGAACTTCATATCATATATCAGATG
CAAGTCGTACTATGAATCGTGCATTACTGGAGGTCATTGCTGGCGGAGTC
GCAGTGTCCCCACCTGACGTCGAGCTCTACGCAAAGAGTACTTATTTGAA
CACGTGTTTGGCCGTTCAAACGGGCCGTCACCCTGAAGAACTGATATGCA
CATCTATGAAGTTTCTACTGGAAAATGATTTCATCAAACTGCGCTTTGAG
AAAAATAAGGTGTGAACCTTCCAGCTCGCCGTGTCATCATTCGATCCCCT
ATGTTTCATGGAAAATTGATCGACGCCTTGGTGTATAAACAAATGGTGGG
GCGTGCTGGGCGGAAAGGCGTCGACACTCAAGGAGAAAGTATCTTGATAT
GTAAACCAAACGAGAAACAAAAATCACTTGCTATGATGACGTCACTCTTG
AAACCTGTCTATAGTTGTTTGTTAGAATCAATTTGAGGAAGCTGGCATCA
ATGTGGGTGGATTTATGGGAAACGAGACACCTCCTGGTGGATTAACCAAC
ATTGATATCGCTATATGCACCATTGAACGAGCAAACTCTCTGATCAACCG
CCTCATGGAGGAAGACAAGCTATCTCTACTTGGAAGTATTGTTATTGATG
AAATGCACATGATTGGTGACCCATCACGTGGTTATTTACTTGAACTCTTA
TTGACCAAGATTCGATTTTTAATGGCTAAGAATGCAACCAATGTTGGTGA
AAATAATGAGAGCAGCAGTAACCATGACAATGGGATACAAATCATAGGTA
TGAGTGCTACTTTACCGAATTTAGACATGATGGCGCGATGGTTGGATGCA
AGGTTCTACGTTACAGATTACAGACCAGTGCCTTTGGATGAATATTTGAA
AACCTCTAAGACTATTTACGATTGCGCAGATACTGTAGTACGGACTATTT
CACCTGAGGACACAATTAAAGGCGACGACGATGACGTTATCAATTTATGT
CTTGAAACAATGCGAGATACAAACTCTGTCTTGATTTTTTGTCCAACCAA
GAACTGGTGTGAAAAATTATCCATCAGCATTGCCAACTATCTCGCCAACA
ATGTTTTGAGTAAAGAATCTGATACAGAGAATATCTTTGATAAAGAAGGC
TTACAAGATGTGTTAAGTGAGCTGCAGCAAACACCAGCTGGTTTGGATCC
AAGTTTGGAGAAGGTGGTCAGCTCTGGTGTGTCTTACCATCACGCTGGAC
TGACCATGGATGAAAGGGATATCATTGAAGGAGCATTCCGAAGAGGTGTC
TTGAAGATTATTATCGCAACGTCTACGCTGTCATCCGCTAATTTGATCTA
TTCTGCTCCAACGAGTGCTGGTAAAACGTTAGTCGCTGAAATCCTCATGT
TGAAAAGAGTCCTGGAAACAGAGAAGAAAGCCATCTACATCTTACCCTTT
GTCAGTGTGGCGAGAGAGAAGATGTATTCACTAAGGAAGTCAGAAGACAT
TGATTTGGCATGTAAGTCTTCCAAAAACAAGAAAAGGTTATCGGCTGAGA
AGAAGAACTCTATGCCCTCTCCCGAGCTCAATTCAAGTCTCCAGTTATCA
CAATGGGGTCTTCCAGAAGTTATACTGGAGAATTATAAAGCTAAAGGAAT
CAATAAAATGTTTGAATGGCAAAAAGAATGCTTACTACAAGACCAAGTTT
TGGATGGTGATGGTGTCAACACCTCAAATCAAAATCAAAGAAAATGTTGC
TGGTAGTACTGCTAAAAAACAGGTATGATGACCGTGTTTTGTAAGAAACT
TGGCTGGTCATGTTTAGAAGTCTTACTGGAGCAATTTCAAAGTCGTTTGT
CATTTGGTGTTTGCCGGGACCTGTGTAATCTGGTTCGCATATCGTTACTG
AATCGTTTCACTGCTCGTTTATTCTATCAGAACGGATTTCAAACTGTGAG
TGCCATAGCCAATGCAAGTGAAAAAGAAATCTCTAAATTGCTTCGTGAAT
CGACACCGTTTTACAGTAACAAACTAAAAGGAAAGGATGCTGAAATGGTG
GGTAAATCAGTACCTAAATGTTTATGGTTGAGTGGGAAAGAAGGCTTGTC
GGAGCAGGAAGCTGGCAGATTGATCATTGACGAAGCCAAACGTATCCTTG
CAGCGGATGCACAAGCACTAGGCATTCCCATTGGGCAGTTAAATCTCTCA
TCCAAGAATTCGACAATCTCTAAATCTTCCTCCAGTTCATCAGGCAAGAA
AAGAAGATCCAGCCTCACTAAGAGTACTATAAAACGTAGGAATCGTAAAA
GAGCATCGGCTGAGAAAATCACTCCGTTGAGATCTTCGAAACGTTTATCT
CCCGAACAACGTAGTGGTGAAAGAGTTGATAGTAACTCAAAAGTTGGAAC
ACAACTAGCGTATGCTTTGCAGAAAAGCACGTCTCAATCGCCTAGTCCTG
TGTTACGAGAAATACAGAATCTTTCGACTCAGAATCTCAGTAGAAATTTA
TCTTTGGCTGATAATGACATGTCTCTATTTCAAGAAAATCAAGTCATTAA
CACTGCTCAAAAGATGGTTGAAAATTTGAGTAATGATTCGTTACTCTTTG
GCGAATCATTGCCAAACATACTAGGAAAAGAAAATCAATCTGATATTAAA
ATGACTACAGACATTTTGATTGAACAATTGAAAGATACAGTGCTCCACAA
CCAATTATCCGATAAATCCGAAACTCAAGACTCGTTATTCTTGATACCAA
ACCAAGACTTCAATAGCTTTTCAACTAAGAATCAAGACCAAACTATGTCA
GAGCAAACACCGAACCTTTCCGAAGATCGAATCCTGAACACTGGGAATTT
TTGTGATAAACTGCACACCCAAGATTCTTTGTTTTTGAATGATAAAATTC
CAAGCTTCTCAACCCACACAGTTAATAAAACCAGAGATATTGTTACCAAG
GACGAACCAGAATCTCGAACGATTGCAGAATGTGAACTCAACCACCAGGA
GCAACAGGGTTCTGTGAACAGTAAGAAAACCAAACGAAAGACAAGCGATT
ACTTGGAATCATCTGATTCGCTCTTACTCTTGTCTGACAGTGCTTTAAAA
CCGAAAGAAAAATCACCAATACTAATCGAGTCGCCGAAAACCGAACTAAG
TGTGACCACACCCTCGCCAAACCTTTCCTTGCGACTATCAACAACTGACG
AAGCACTGGACACTTTTCCTAAAATATTACCACCCATGAAATTACATTCC
CAATTCAATGACGCTTTAACCGGGGAAGCATCAACTTTGCAACGAAATTT
AACGTCAGTTACTTCACCGGAGGTTGATTTATTCGATCAGAACATTGAAA
GCAATGACAACAGTGGAGACCTATTCGAGAGTACTGAACTTTTCACTAAG
AATTCTACATCTCAAGCAACAGAGAGAGTCACTCCTCAAGAAACCAACCT
AAACGAAAGTGCATCTAATGAATTCCTAATTATCGATGTCGCATCCTCCA
AAACGTTATTCTTGACATTCATCCAAGAATGGAAAGCCAAATCATCCTTC
ACCGTTGCCTTCTCTTGTGAAACTCATAAACCCACCAGTCAAACAACTTC
ATCAAAGATCGGCCGTCCCTTGAGATCTGCCAGAGACGTTTCAACCACAT
CCAAACCATCTGCAATGTCGTCAACCAGCAATCGTTTACTATATACCAGA
GATGATTTACAGTTGACAGGACTTGCCATATGCTGGGGTAAAAAGGATTC
ATACTACATCAGTTTGCAGGAAGACGGTGTACGTCACAACGAATTGGACG
ATACTGCCTTACCTCCAGATGTCTGCCAGGAACTGCCTTTGCCAGTCCGT
TTAAAGAGTATCCAATCCGTCCTTAACCAGCATGCATCTTCGACTATCAT
GGGTTTTGACCTGAAGGAGCAGTTGAAGATCATATACGAGTTGTGTGATA
CTTTGTTGNTATCATTGGTTTTGACCTGAGTAACACCAACATCCATTTGT
GACCAATGGCCAGACTTAGATTGGTACACTTACTATAACATCTGGGAACG
CCTCTCTGCACAATGTAAGCACGTGGGCGAAATGATCGGTGTCAAAGAAT
CCTTTTTAGGACGTGCCATGCAGAACCGTGTCAGTTGTGTGACGGCCGAG
CAGAAGCGTGTCATGCGTATCCATCGCAGATTTTATGGTGCTTTGGTATT
AAATGACCTTTGTAATGAAGTCCCTATGTCAGACGTCAGCCGTAAATATA
AAGTCCATAAAGGTCTTTTGCAATCGTTACAAAACTCAGCCGCGACCTAC
GCAGGATGATGTGAACGAGAAATCGAAAGAACAATACTTCCCATCACAAT
TGGGCACCGCTACAATGGCCTCTTCTATGAAACCAGATGAAGCCATAATA
GTTTATACAGAGTTGCAAAAAGCACGCCGTAATTTTTGCCTGGAAAACGA
ACTTCATATCATATATCAGATGCAAGTCGTACTATGAATCGTGCATTACT
GGAGGTCATTGCTGGCGGAGTCGCAGTGTCCCCACCTGACGTCGAGCTCT
ACGCAAAGAGTACTTATTTGAACACGTGTTTGGCCGTTCAAACGGGCCGT
CACCCTGAAGAACTGATATGCACATCTATGAAGTTTCTACTGGAAAATGA
TTTCATCAAACTGCGCTTTGAGAAAAATAAGGTGTGAACCTTCCAGCTCG
CCGTGTCATCATTCGATCCCCTATGTTTCATGGAAAATTGATCGACGCCT
TGGTGTATAAACAAATGGTGGGGCGTGCTGGGCGGAAAGGCGTCGACACT
CAAGGAGAAAGTATCTTGATATGTAAACCAAACGAGAAACAAAAATCACT
TGCTATGATGACGTCACTCTTGAAACCTGTCTATAGTTGTTTGTTAGAAT
CAATTTGAGGAAGCTGGCATCAATGTGGGTGGATTTATGGGAAACGAGAC
ACCTCCTGGTGGATTAACCAACATTGATATCGCTATATGCACCATTGAAC
GAGCAAACTCTCTGATCAACCGCCTCATGGAGGAAGACAAGCTATCTCTA
CTTGGAAGTATTGTTATTGATGAAATGCACATGATTGGTGACCCATCACG
TGGTTATTTACTTGAACTCTTATTGACCAAGATTCGATTTTTAATGGCTA
AGAATGCAACCAATGTTGGTGAAAATAATGAGAGCAGCAGTAACCATGAC
AATGGGATACAAATCATAGGTATGAGTGCTACTTTACCGAATTTAGACAT
GATGGCGCGATGGTTGGATGCAAGGTTCTACGTTACAGATTACAGACCAG
TGCCTTTGGATGAATATTTGAAAACCTCTAAGACTATTTACGATTGCGCA
GATACTGTAGTACGGACTATTTCACCTGAGGACACAATTAAAGGCGACGA
CGATGACGTTATCAATTTATGTCTTGAAACAATGCGAGATACAAACTCTG
TCTTGATTTTTTGTCCAACCAAGAACTGGTGTGAAAAATTATCCATCAGC
ATTGCCAACTATCTCGCCAACAATGTTTTGAGTAAAGAATCTGATACAGA
GAATATCTTTGATAAAGAAGGCTTACAAGATGTGTTAAGTGAGCTGCAGC
AAACACCAGCTGGTTTGGATCCAAGTTTGGAGAAGGTGGTCAGCTCTGGT
GTGTCTTACCATCACGCTGGACTGACCATGGATGAAAGGGATATCATTGA
AGGAGCATTCCGAAGAGGTGTCTTGAAGATTATTATCGCAACGTCTACGC
TGTCATCCGCTAATTTGATCTATTCTGCTCCAACGAGTGCTGGTAAAACG
TTAGTCGCTGAAATCCTCATGTTGAAAAGAGTCCTGGAAACAGAGAAGAA
AGCCATCTACATCTTACCCTTTGTCAGTGTGGCGAGAGAGAAGATGTATT
CACTAAGGAAGTCAGAAGACATTGATTTGGCATGTAAGTCTTCCAAAAAC
AAGAAAAGGTTATCGGCTGAGAAGAAGAACTCTATGCCCTCTCCCGAGCT
CAATTCAAGTCTCCAGTTATCACAATGGGGTCTTCCAGAAGTTATACTGG
AGAATTATAAAGCTAAAGGAATCAATAAAATGTTTGAATGGCAAAAAGAA
TGCTTACTACAAGACCAAGTTTTGGATGGTGATGGTGTCAACACCTCAAA
TCAAAATCAAAGAAAATGTTGCTGGTAGTACTGCTAAAAAACAGGTATGA
TGACCGTGTTTTGTAAGAAACTTGGCTGGTCATGTTTAGAAGTCTTACTG
GAGCAATTTCAAAGTCGTTTGTCATTTGGTGTTTGCCGGGACCTGTGTAA
TCTGGTTCGCATATCGTTACTGAATCGTTTCACTGCTCGTTTATTCTATC
AGAACGGATTTCAAACTGTGAGTGCCATAGCCAATGCAAGTGAAAAAGAA
ATCTCTAAATTGCTTCGTGAATCGACACCGTTTTACAGTAACAAACTAAA
AGGAAAGGATGCTGAAATGGTGGGTAAATCAGTACCTAAATGTTTATGGT
TGAGTGGGAAAGAAGGCTTGTCGGAGCAGGAAGCTGGCAGATTGATCATT
GACGAAGCCAAACGTATCCTTGCAGCGGATGCACAAGCACTAGGCATTCC
CATTGGGCAGTTAAATCTCTCATCCAAGAATTCGACAATCTCTAAATCTT
CCTCCAGTTCATCAGGCAAGAAAAGAAGATCCAGCCTCACTAAGAGTACT
ATAAAACGTAGGAATCGTAAAAGAGCATCGGCTGAGAAAATCACTCCGTT
GAGATCTTCGAAACGTTTATCTCCCGAACAACGTAGTGGTGAAAGAGTTG
ATAGTAACTCAAAAGTTGGAACACAACTAGCGTATGCTTTGCAGAAAAGC
ACGTCTCAATCGCCTAGTCCTGTGTTACGAGAAATACAGAATCTTTCGAC
TCAGAATCTCAGTAGAAATTTATCTTTGGCTGATAATGACATGTCTCTAT
TTCAAGAAAATCAAGTCATTAACACTGCTCAAAAGATGGTTGAAAATTTG
AGTAATGATTCGTTACTCTTTGGCGAATCATTGCCAAACATACTAGGAAA
AGAAAATCAATCTGATATTAAAATGACTACAGACATTTTGATTGAACAAT
TGAAAGATACAGTGCTCCACAACCAATTATCCGATAAATCCGAAACTCAA
GACTCGTTATTCTTGATACCAAACCAAGACTTCAATAGCTTTTCAACTAA
GAATCAAGACCAAACTATGTCAGAGCAAACACCGAACCTTTCCGAAGATC
GAATCCTGAACACTGGGAATTTTTGTGATAAACTGCACACCCAAGATTCT
TTGTTTTTGAATGATAAAATTCCAAGCTTCTCAACCCACACAGTTAATAA
AACCAGAGATATTGTTACCAAGGACGAACCAGAATCTCGAACGATTGCAG
AATGTGAACTCAACCACCAGGAGCAACAGGGTTCTGTGAACAGTAAGAAA
ACCAAACGAAAGACAAGCGATTACTTGGAATCATCTGATTCGCTCTTACT
CTTGTCTGACAGTGCTTTAAAACCGAAAGAAAAATCACCAATACTAATCG
AGTCGCCGAAAACCGAACTAAGTGTGACCACACCCTCGCCAAACCTTTCC
TTGCGACTATCAACAACTGACGAAGCACTGGACACTTTTCCTAAAATATT
ACCACCCATGAAATTACATTCCCAATTCAATGACGCTTTAACCGGGGAAG
CATCAACTTTGCAACGAAATTTAACGTCAGTTACTTCACCGGAGGTTGAT
TTATTCGATCAGAACATTGAAAGCAATGACAACAGTGGAGACCTATTCGA
GAGTACTGAACTTTTCACTAAGAATTCTACATCTCAAGCAACAGAGAGAG
TCACTCCTCAAGAAACCAACCTAAACGAAAGTGCATCTAATGAATTCCTA
ATTATCGATGTCGCATCCTCCAAAACGTTATTCTTGACATTCATCCAAGA
ATGGAAAGCCAAATCATCCTTCACCGTTGCCTTCTCTTGTGAAACTCATA
AACCCACCAGTCAAACAACTTCATCAAAGATCGGCCGTCCCTTGAGATCT
GCCAGAGACGTTTCAACCACATCCAAACCATCTGCAATGTCGTCAACCAG
CAATCGTTTACTATATACCAGAGATGATTTACAGTTGACAGGACTTGCCA
TATGCTGGGGTAAAAAGGATTCATACTACATCAGTTTGCAGGAAGACGGT
GTACGTCACAACGAATTGGACGATACTGCCTTACCTCCAGATGTCTGCCA
GGAACTGCCTTTGCCAGTCCGTTTAAAGAGTATCCAATCCGTCCTTAACC
AGCATGCATCTTCGACTATCATGGGTTTTGACCTGAAGGAGCAGTTGAAG
ATCATATACGAGTTGTGTGATACTTTGTTGNTATCATTGGTTTTGACCTG
AGTAACACCAACATCCATTTGTGACCAATGGCCAGACTTAGATTGGTACA
CTTACTATAACATCTGGGAACGCCTCTCTGCACAATGTAAGCACGTGGGC
GAAATGATCGGTGTCAAAGAATCCTTTTTAGGACGTGCCATGCAGAACCG
TGTCAGTTGTGTGACGGCCGAGCAGAAGCGTGTCATGCGTATCCATCGCA
GATTTTATGGTGCTTTGGTATTAAATGACCTTTGTAATGAAGTCCCTATG
TCAGACGTCAGCCGTAAATATAAAGTCCATAAAGGTCTTTTGCAATCGTT
ACAAAACTCAGCCGCGACCTACGCAGGATGATGTGAACGAGAAATCGAAA
GAACAATACTTCCCATCACAATTGGGCACCGCTACAATGGCCTCTTCTAT
GAAACCAGATGAAGCCATAATAGTTTATACAGAGTTGCAAAAAGCACGCC
GTAATTTTTGCCTGGAAAACGAACTTCATATCATATATCAGATGCAAGTC
GTACTATGAATCGTGCATTACTGGAGGTCATTGCTGGCGGAGTCGCAGTG
TCCCCACCTGACGTCGAGCTCTACGCAAAGAGTACTTATTTGAACACGTG
TTTGGCCGTTCAAACGGGCCGTCACCCTGAAGAACTGATATGCACATCTA
TGAAGTTTCTACTGGAAAATGATTTCATCAAACTGCGCTTTGAGAAAAAT
AAGGTGTGAACCTTCCAGCTCGCCGTGTCATCATTCGATCCCCTATGTTT
CATGGAAAATTGATCGACGCCTTGGTGTATAAACAAATGGTGGGGCGTGC
TGGGCGGAAAGGCGTCGACACTCAAGGAGAAAGTATCTTGATATGTAAAC
CAAACGAGAAACAAAAATCACTTGCTATGATGACGTCACTCTTGAAACCT
GTCTATAGTTGTTTGTTAGAATCAATTTGAGGAAGCTGGCATCAATGTGG
GTGGATTTATGGGAAACGAGACACCTCCTGGTGGATTAACCAACATTGAT
ATCGCTATATGCACCATTGAACGAGCAAACTCTCTGATCAACCGCCTCAT
GGAGGAAGACAAGCTATCTCTACTTGGAAGTATTGTTATTGATGAAATGC
ACATGATTGGTGACCCATCACGTGGTTATTTACTTGAACTCTTATTGACC
AAGATTCGATTTTTAATGGCTAAGAATGCAACCAATGTTGGTGAAAATAA
TGAGAGCAGCAGTAACCATGACAATGGGATACAAATCATAGGTATGAGTG
CTACTTTACCGAATTTAGACATGATGGCGCGATGGTTGGATGCAAGGTTC
TACGTTACAGATTACAGACCAGTGCCTTTGGATGAATATTTGAAAACCTC
TAAGACTATTTACGATTGCGCAGATACTGTAGTACGGACTATTTCACCTG
AGGACACAATTAAAGGCGACGACGATGACGTTATCAATTTATGTCTTGAA
ACAATGCGAGATACAAACTCTGTCTTGATTTTTTGTCCAACCAAGAACTG
GTGTGAAAAATTATCCATCAGCATTGCCAACTATCTCGCCAACAATGTTT
TGAGTAAAGAATCTGATACAGAGAATATCTTTGATAAAGAAGGCTTACAA
GATGTGTTAAGTGAGCTGCAGCAAACACCAGCTGGTTTGGATCCAAGTTT
GGAGAAGGTGGTCAGCTCTGGTGTGTCTTACCATCACGCTGGACTGACCA
TGGATGAAAGGGATATCATTGAAGGAGCATTCCGAAGAGGTGTCTTGAAG
ATTATTATCGCAACGTCTACGCTGTCATCCGCTAATTTGATCTATTCTGC
TCCAACGAGTGCTGGTAAAACGTTAGTCGCTGAAATCCTCATGTTGAAAA
GAGTCCTGGAAACAGAGAAGAAAGCCATCTACATCTTACCCTTTGTCAGT
GTGGCGAGAGAGAAGATGTATTCACTAAGGAAGTCAGAAGACATTGATTT
GGCATGTAAGTCTTCCAAAAACAAGAAAAGGTTATCGGCTGAGAAGAAGA
ACTCTATGCCCTCTCCCGAGCTCAATTCAAGTCTCCAGTTATCACAATGG
GGTCTTCCAGAAGTTATACTGGAGAATTATAAAGCTAAAGGAATCAATAA
AATGTTTGAATGGCAAAAAGAATGCTTACTACAAGACCAAGTTTTGGATG
GTGATGGTGTCAACACCTCAAATCAAAATCAAAGAAAATGTTGCTGGTAG
TACTGCTAAAAAACAGGTATGATGACCGTGTTTTGTAAGAAACTTGGCTG
GTCATGTTTAGAAGTCTTACTGGAGCAATTTCAAAGTCGTTTGTCATTTG
GTGTTTGCCGGGACCTGTGTAATCTGGTTCGCATATCGTTACTGAATCGT
TTCACTGCTCGTTTATTCTATCAGAACGGATTTCAAACTGTGAGTGCCAT
AGCCAATGCAAGTGAAAAAGAAATCTCTAAATTGCTTCGTGAATCGACAC
CGTTTTACAGTAACAAACTAAAAGGAAAGGATGCTGAAATGGTGGGTAAA
TCAGTACCTAAATGTTTATGGTTGAGTGGGAAAGAAGGCTTGTCGGAGCA
GGAAGCTGGCAGATTGATCATTGACGAAGCCAAACGTATCCTTGCAGCGG
ATGCACAAGCACTAGGCATTCCCATTGGGCAGTTAAATCTCTCATCCAAG
AATTCGACAATCTCTAAATCTTCCTCCAGTTCATCAGGCAAGAAAAGAAG
ATCCAGCCTCACTAAGAGTACTATAAAACGTAGGAATCGTAAAAGAGCAT
CGGCTGAGAAAATCACTCCGTTGAGATCTTCGAAACGTTTATCTCCCGAA
CAACGTAGTGGTGAAAGAGTTGATAGTAACTCAAAAGTTGGAACACAACT
AGCGTATGCTTTGCAGAAAAGCACGTCTCAATCGCCTAGTCCTGTGTTAC
GAGAAATACAGAATCTTTCGACTCAGAATCTCAGTAGAAATTTATCTTTG
GCTGATAATGACATGTCTCTATTTCAAGAAAATCAAGTCATTAACACTGC
TCAAAAGATGGTTGAAAATTTGAGTAATGATTCGTTACTCTTTGGCGAAT
CATTGCCAAACATACTAGGAAAAGAAAATCAATCTGATATTAAAATGACT
ACAGACATTTTGATTGAACAATTGAAAGATACAGTGCTCCACAACCAATT
ATCCGATAAATCCGAAACTCAAGACTCGTTATTCTTGATACCAAACCAAG
ACTTCAATAGCTTTTCAACTAAGAATCAAGACCAAACTATGTCAGAGCAA
ACACCGAACCTTTCCGAAGATCGAATCCTGAACACTGGGAATTTTTGTGA
TAAACTGCACACCCAAGATTCTTTGTTTTTGAATGATAAAATTCCAAGCT
TCTCAACCCACACAGTTAATAAAACCAGAGATATTGTTACCAAGGACGAA
CCAGAATCTCGAACGATTGCAGAATGTGAACTCAACCACCAGGAGCAACA
GGGTTCTGTGAACAGTAAGAAAACCAAACGAAAGACAAGCGATTACTTGG
AATCATCTGATTCGCTCTTACTCTTGTCTGACAGTGCTTTAAAACCGAAA
GAAAAATCACCAATACTAATCGAGTCGCCGAAAACCGAACTAAGTGTGAC
CACACCCTCGCCAAACCTTTCCTTGCGACTATCAACAACTGACGAAGCAC
TGGACACTTTTCCTAAAATATTACCACCCATGAAATTACATTCCCAATTC
AATGACGCTTTAACCGGGGAAGCATCAACTTTGCAACGAAATTTAACGTC
AGTTACTTCACCGGAGGTTGATTTATTCGATCAGAACATTGAAAGCAATG
ACAACAGTGGAGACCTATTCGAGAGTACTGAACTTTTCACTAAGAATTCT
ACATCTCAAGCAACAGAGAGAGTCACTCCTCAAGAAACCAACCTAAACGA
AAGTGCATCTAATGAATTCCTAATTATCGATGTCGCATCCTCCAAAACGT
TATTCTTGACATTCATCCAAGAATGGAAAGCCAAATCATCCTTCACCGTT
GCCTTCTCTTGTGAAACTCATAAACCCACCAGTCAAACAACTTCATCAAA
GATCGGCCGTCCCTTGAGATCTGCCAGAGACGTTTCAACCACATCCAAAC
CATCTGCAATGTCGTCAACCAGCAATCGTTTACTATATACCAGAGATGAT
TTACAGTTGACAGGACTTGCCATATGCTGGGGTAAAAAGGATTCATACTA
CATCAGTTTGCAGGAAGACGGTGTACGTCACAACGAATTGGACGATACTG
CCTTACCTCCAGATGTCTGCCAGGAACTGCCTTTGCCAGTCCGTTTAAAG
AGTATCCAATCCGTCCTTAACCAGCATGCATCTTCGACTATCATGGGTTT
TGACCTGAAGGAGCAGTTGAAGATCATATACGAGTTGTGTGATACTTTGT
TGNTATCATTGGTTTTGACCTGAGTAACACCAACATCCATTTGTGACCAA
TGGCCAGACTTAGATTGGTACACTTACTATAACATCTGGGAACGCCTCTC
TGCACAATGTAAGCACGTGGGCGAAATGATCGGTGTCAAAGAATCCTTTT
TAGGACGTGCCATGCAGAACCGTGTCAGTTGTGTGACGGCCGAGCAGAAG
CGTGTCATGCGTATCCATCGCAGATTTTATGGTGCTTTGGTATTAAATGA
CCTTTGTAATGAAGTCCCTATGTCAGACGTCAGCCGTAAATATAAAGTCC
ATAAAGGTCTTTTGCAATCGTTACAAAACTCAGCCGCGACCTACGCAGGA
TGATGTGAACGAGAAATCGAAAGAACAATACTTCCCATCACAATTGGGCA
CCGCTACAATGGCCTCTTCTATGAAACCAGATGAAGCCATAATAGTTTAT
ACAGAGTTGCAAAAAGCACGCCGTAATTTTTGCCTGGAAAACGAACTTCA
TATCATATATCAGATGCAAGTCGTACTATGAATCGTGCATTACTGGAGGT
CATTGCTGGCGGAGTCGCAGTGTCCCCACCTGACGTCGAGCTCTACGCAA
AGAGTACTTATTTGAACACGTGTTTGGCCGTTCAAACGGGCCGTCACCCT
GAAGAACTGATATGCACATCTATGAAGTTTCTACTGGAAAATGATTTCAT
CAAACTGCGCTTTGAGAAAAATAAGGTGTGAACCTTCCAGCTCGCCGTGT
CATCATTCGATCCCCTATGTTTCATGGAAAATTGATCGACGCCTTGGTGT
ATAAACAAATGGTGGGGCGTGCTGGGCGGAAAGGCGTCGACACTCAAGGA
GAAAGTATCTTGATATGTAAACCAAACGAGAAACAAAAATCACTTGCTAT
GATGACGTCACTCTTGAAACCTGTCTATAGTTGTTTGTTAGAATCAATTT
GAGGAAGCTGGCATCAATGTGGGTGGATTTATGGGAAACGAGACACCTCC
TGGTGGATTAACCAACATTGATATCGCTATATGCACCATTGAACGAGCAA
ACTCTCTGATCAACCGCCTCATGGAGGAAGACAAGCTATCTCTACTTGGA
AGTATTGTTATTGATGAAATGCACATGATTGGTGACCCATCACGTGGTTA
TTTACTTGAACTCTTATTGACCAAGATTCGATTTTTAATGGCTAAGAATG
CAACCAATGTTGGTGAAAATAATGAGAGCAGCAGTAACCATGACAATGGG
ATACAAATCATAGGTATGAGTGCTACTTTACCGAATTTAGACATGATGGC
GCGATGGTTGGATGCAAGGTTCTACGTTACAGATTACAGACCAGTGCCTT
TGGATGAATATTTGAAAACCTCTAAGACTATTTACGATTGCGCAGATACT
GTAGTACGGACTATTTCACCTGAGGACACAATTAAAGGCGACGACGATGA
CGTTATCAATTTATGTCTTGAAACAATGCGAGATACAAACTCTGTCTTGA
TTTTTTGTCCAACCAAGAACTGGTGTGAAAAATTATCCATCAGCATTGCC
AACTATCTCGCCAACAATGTTTTGAGTAAAGAATCTGATACAGAGAATAT
CTTTGATAAAGAAGGCTTACAAGATGTGTTAAGTGAGCTGCAGCAAACAC
CAGCTGGTTTGGATCCAAGTTTGGAGAAGGTGGTCAGCTCTGGTGTGTCT
TACCATCACGCTGGACTGACCATGGATGAAAGGGATATCATTGAAGGAGC
ATTCCGAAGAGGTGTCTTGAAGATTATTATCGCAACGTCTACGCTGTCAT
CCGCTAATTTGATCTATTCTGCTCCAACGAGTGCTGGTAAAACGTTAGTC
GCTGAAATCCTCATGTTGAAAAGAGTCCTGGAAACAGAGAAGAAAGCCAT
CTACATCTTACCCTTTGTCAGTGTGGCGAGAGAGAAGATGTATTCACTAA
GGAAGTCAGAAGACATTGATTTGGCATGTAAGTCTTCCAAAAACAAGAAA
AGGTTATCGGCTGAGAAGAAGAACTCTATGCCCTCTCCCGAGCTCAATTC
AAGTCTCCAGTTATCACAATGGGGTCTTCCAGAAGTTATACTGGAGAATT
ATAAAGCTAAAGGAATCAATAAAATGTTTGAATGGCAAAAAGAATGCTTA
CTACAAGACCAAGTTTTGGATGGTGATGGTGTCAACACCTCAAATCAAAA
TCAAAGAAAATGTTGCTGGTAGTACTGCTAAAAAACAGGTATGATGACCG
TGTTTTGTAAGAAACTTGGCTGGTCATGTTTAGAAGTCTTACTGGAGCAA
TTTCAAAGTCGTTTGTCATTTGGTGTTTGCCGGGACCTGTGTAATCTGGT
TCGCATATCGTTACTGAATCGTTTCACTGCTCGTTTATTCTATCAGAACG
GATTTCAAACTGTGAGTGCCATAGCCAATGCAAGTGAAAAAGAAATCTCT
AAATTGCTTCGTGAATCGACACCGTTTTACAGTAACAAACTAAAAGGAAA
GGATGCTGAAATGGTGGGTAAATCAGTACCTAAATGTTTATGGTTGAGTG
GGAAAGAAGGCTTGTCGGAGCAGGAAGCTGGCAGATTGATCATTGACGAA
GCCAAACGTATCCTTGCAGCGGATGCACAAGCACTAGGCATTCCCATTGG
GCAGTTAAATCTCTCATCCAAGAATTCGACAATCTCTAAATCTTCCTCCA
GTTCATCAGGCAAGAAAAGAAGATCCAGCCTCACTAAGAGTACTATAAAA
CGTAGGAATCGTAAAAGAGCATCGGCTGAGAAAATCACTCCGTTGAGATC
TTCGAAACGTTTATCTCCCGAACAACGTAGTGGTGAAAGAGTTGATAGTA
ACTCAAAAGTTGGAACACAACTAGCGTATGCTTTGCAGAAAAGCACGTCT
CAATCGCCTAGTCCTGTGTTACGAGAAATACAGAATCTTTCGACTCAGAA
TCTCAGTAGAAATTTATCTTTGGCTGATAATGACATGTCTCTATTTCAAG
AAAATCAAGTCATTAACACTGCTCAAAAGATGGTTGAAAATTTGAGTAAT
GATTCGTTACTCTTTGGCGAATCATTGCCAAACATACTAGGAAAAGAAAA
TCAATCTGATATTAAAATGACTACAGACATTTTGATTGAACAATTGAAAG
ATACAGTGCTCCACAACCAATTATCCGATAAATCCGAAACTCAAGACTCG
TTATTCTTGATACCAAACCAAGACTTCAATAGCTTTTCAACTAAGAATCA
AGACCAAACTATGTCAGAGCAAACACCGAACCTTTCCGAAGATCGAATCC
TGAACACTGGGAATTTTTGTGATAAACTGCACACCCAAGATTCTTTGTTT
TTGAATGATAAAATTCCAAGCTTCTCAACCCACACAGTTAATAAAACCAG
AGATATTGTTACCAAGGACGAACCAGAATCTCGAACGATTGCAGAATGTG
AACTCAACCACCAGGAGCAACAGGGTTCTGTGAACAGTAAGAAAACCAAA
CGAAAGACAAGCGATTACTTGGAATCATCTGATTCGCTCTTACTCTTGTC
TGACAGTGCTTTAAAACCGAAAGAAAAATCACCAATACTAATCGAGTCGC
CGAAAACCGAACTAAGTGTGACCACACCCTCGCCAAACCTTTCCTTGCGA
CTATCAACAACTGACGAAGCACTGGACACTTTTCCTAAAATATTACCACC
CATGAAATTACATTCCCAATTCAATGACGCTTTAACCGGGGAAGCATCAA
CTTTGCAACGAAATTTAACGTCAGTTACTTCACCGGAGGTTGATTTATTC
GATCAGAACATTGAAAGCAATGACAACAGTGGAGACCTATTCGAGAGTAC
TGAACTTTTCACTAAGAATTCTACATCTCAAGCAACAGAGAGAGTCACTC
CTCAAGAAACCAACCTAAACGAAAGTGCATCTAATGAATTCCTAATTATC
GATGTCGCATCCTCCAAAACGTTATTCTTGACATTCATCCAAGAATGGAA
AGCCAAATCATCCTTCACCGTTGCCTTCTCTTGTGAAACTCATAAACCCA
CCAGTCAAACAACTTCATCAAAGATCGGCCGTCCCTTGAGATCTGCCAGA
GACGTTTCAACCACATCCAAACCATCTGCAATGTCGTCAACCAGCAATCG
TTTACTATATACCAGAGATGATTTACAGTTGACAGGACTTGCCATATGCT
GGGGTAAAAAGGATTCATACTACATCAGTTTGCAGGAAGACGGTGTACGT
CACAACGAATTGGACGATACTGCCTTACCTCCAGATGTCTGCCAGGAACT
GCCTTTGCCAGTCCGTTTAAAGAGTATCCAATCCGTCCTTAACCAGCATG
CATCTTCGACTATCATGGGTTTTGACCTGAAGGAGCAGTTGAAGATCATA
TACGAGTTGTGTGATACTTTGTTGNTATCATTGGTTTTGACCTGAGTAAC
ACCAACATCCATTTGTGACCAATGGCCAGACTTAGATTGGTACACTTACT
ATAACATCTGGGAACGCCTCTCTGCACAATGTAAGCACGTGGGCGAAATG
ATCGGTGTCAAAGAATCCTTTTTAGGACGTGCCATGCAGAACCGTGTCAG
TTGTGTGACGGCCGAGCAGAAGCGTGTCATGCGTATCCATCGCAGATTTT
ATGGTGCTTTGGTATTAAATGACCTTTGTAATGAAGTCCCTATGTCAGAC
GTCAGCCGTAAATATAAAGTCCATAAAGGTCTTTTGCAATCGTTACAAAA
CTCAGCCGCGACCTACGCAGGATGATGTGAACGAGAAATCGAAAGAACAA
TACTTCCCATCACAATTGGGCACCGCTACAATGGCCTCTTCTATGAAACC
AGATGAAGCCATAATAGTTTATACAGAGTTGCAAAAAGCACGCCGTAATT
TTTGCCTGGAAAACGAACTTCATATCATATATCAGATGCAAGTCGTACTA
TGAATCGTGCATTACTGGAGGTCATTGCTGGCGGAGTCGCAGTGTCCCCA
CCTGACGTCGAGCTCTACGCAAAGAGTACTTATTTGAACACGTGTTTGGC
CGTTCAAACGGGCCGTCACCCTGAAGAACTGATATGCACATCTATGAAGT
TTCTACTGGAAAATGATTTCATCAAACTGCGCTTTGAGAAAAATAAGGTG
TGAACCTTCCAGCTCGCCGTGTCATCATTCGATCCCCTATGTTTCATGGA
AAATTGATCGACGCCTTGGTGTATAAACAAATGGTGGGGCGTGCTGGGCG
GAAAGGCGTCGACACTCAAGGAGAAAGTATCTTGATATGTAAACCAAACG
AGAAACAAAAATCACTTGCTATGATGACGTCACTCTTGAAACCTGTCTAT
AGTTGTTTGTTAGAATCAATTTGAGGAAGCTGGCATCAATGTGGGTGGAT
TTATGGGAAACGAGACACCTCCTGGTGGATTAACCAACATTGATATCGCT
ATATGCACCATTGAACGAGCAAACTCTCTGATCAACCGCCTCATGGAGGA
AGACAAGCTATCTCTACTTGGAAGTATTGTTATTGATGAAATGCACATGA
TTGGTGACCCATCACGTGGTTATTTACTTGAACTCTTATTGACCAAGATT
CGATTTTTAATGGCTAAGAATGCAACCAATGTTGGTGAAAATAATGAGAG
CAGCAGTAACCATGACAATGGGATACAAATCATAGGTATGAGTGCTACTT
TACCGAATTTAGACATGATGGCGCGATGGTTGGATGCAAGGTTCTACGTT
ACAGATTACAGACCAGTGCCTTTGGATGAATATTTGAAAACCTCTAAGAC
TATTTACGATTGCGCAGATACTGTAGTACGGACTATTTCACCTGAGGACA
CAATTAAAGGCGACGACGATGACGTTATCAATTTATGTCTTGAAACAATG
CGAGATACAAACTCTGTCTTGATTTTTTGTCCAACCAAGAACTGGTGTGA
AAAATTATCCATCAGCATTGCCAACTATCTCGCCAACAATGTTTTGAGTA
AAGAATCTGATACAGAGAATATCTTTGATAAAGAAGGCTTACAAGATGTG
TTAAGTGAGCTGCAGCAAACACCAGCTGGTTTGGATCCAAGTTTGGAGAA
GGTGGTCAGCTCTGGTGTGTCTTACCATCACGCTGGACTGACCATGGATG
AAAGGGATATCATTGAAGGAGCATTCCGAAGAGGTGTCTTGAAGATTATT
ATCGCAACGTCTACGCTGTCATCCGCTAATTTGATCTATTCTGCTCCAAC
GAGTGCTGGTAAAACGTTAGTCGCTGAAATCCTCATGTTGAAAAGAGTCC
TGGAAACAGAGAAGAAAGCCATCTACATCTTACCCTTTGTCAGTGTGGCG
AGAGAGAAGATGTATTCACTAAGGAAGTCAGAAGACATTGATTTGGCATG
TAAGTCTTCCAAAAACAAGAAAAGGTTATCGGCTGAGAAGAAGAACTCTA
TGCCCTCTCCCGAGCTCAATTCAAGTCTCCAGTTATCACAATGGGGTCTT
CCAGAAGTTATACTGGAGAATTATAAAGCTAAAGGAATCAATAAAATGTT
TGAATGGCAAAAAGAATGCTTACTACAAGACCAAGTTTTGGATGGTGATG
GTGTCAACACCTCAAATCAAAATCAAAGAAAATGTTGCTGGTAGTACTGC
TAAAAAACAGGTATGATGACCGTGTTTTGTAAGAAACTTGGCTGGTCATG
TTTAGAAGTCTTACTGGAGCAATTTCAAAGTCGTTTGTCATTTGGTGTTT
GCCGGGACCTGTGTAATCTGGTTCGCATATCGTTACTGAATCGTTTCACT
GCTCGTTTATTCTATCAGAACGGATTTCAAACTGTGAGTGCCATAGCCAA
TGCAAGTGAAAAAGAAATCTCTAAATTGCTTCGTGAATCGACACCGTTTT
ACAGTAACAAACTAAAAGGAAAGGATGCTGAAATGGTGGGTAAATCAGTA
CCTAAATGTTTATGGTTGAGTGGGAAAGAAGGCTTGTCGGAGCAGGAAGC
TGGCAGATTGATCATTGACGAAGCCAAACGTATCCTTGCAGCGGATGCAC
AAGCACTAGGCATTCCCATTGGGCAGTTAAATCTCTCATCCAAGAATTCG
ACAATCTCTAAATCTTCCTCCAGTTCATCAGGCAAGAAAAGAAGATCCAG
CCTCACTAAGAGTACTATAAAACGTAGGAATCGTAAAAGAGCATCGGCTG
AGAAAATCACTCCGTTGAGATCTTCGAAACGTTTATCTCCCGAACAACGT
AGTGGTGAAAGAGTTGATAGTAACTCAAAAGTTGGAACACAACTAGCGTA
TGCTTTGCAGAAAAGCACGTCTCAATCGCCTAGTCCTGTGTTACGAGAAA
TACAGAATCTTTCGACTCAGAATCTCAGTAGAAATTTATCTTTGGCTGAT
AATGACATGTCTCTATTTCAAGAAAATCAAGTCATTAACACTGCTCAAAA
GATGGTTGAAAATTTGAGTAATGATTCGTTACTCTTTGGCGAATCATTGC
CAAACATACTAGGAAAAGAAAATCAATCTGATATTAAAATGACTACAGAC
ATTTTGATTGAACAATTGAAAGATACAGTGCTCCACAACCAATTATCCGA
TAAATCCGAAACTCAAGACTCGTTATTCTTGATACCAAACCAAGACTTCA
ATAGCTTTTCAACTAAGAATCAAGACCAAACTATGTCAGAGCAAACACCG
AACCTTTCCGAAGATCGAATCCTGAACACTGGGAATTTTTGTGATAAACT
GCACACCCAAGATTCTTTGTTTTTGAATGATAAAATTCCAAGCTTCTCAA
CCCACACAGTTAATAAAACCAGAGATATTGTTACCAAGGACGAACCAGAA
TCTCGAACGATTGCAGAATGTGAACTCAACCACCAGGAGCAACAGGGTTC
TGTGAACAGTAAGAAAACCAAACGAAAGACAAGCGATTACTTGGAATCAT
CTGATTCGCTCTTACTCTTGTCTGACAGTGCTTTAAAACCGAAAGAAAAA
TCACCAATACTAATCGAGTCGCCGAAAACCGAACTAAGTGTGACCACACC
CTCGCCAAACCTTTCCTTGCGACTATCAACAACTGACGAAGCACTGGACA
CTTTTCCTAAAATATTACCACCCATGAAATTACATTCCCAATTCAATGAC
GCTTTAACCGGGGAAGCATCAACTTTGCAACGAAATTTAACGTCAGTTAC
TTCACCGGAGGTTGATTTATTCGATCAGAACATTGAAAGCAATGACAACA
GTGGAGACCTATTCGAGAGTACTGAACTTTTCACTAAGAATTCTACATCT
CAAGCAACAGAGAGAGTCACTCCTCAAGAAACCAACCTAAACGAAAGTGC
ATCTAATGAATTCCTAATTATCGATGTCGCATCCTCCAAAACGTTATTCT
TGACATTCATCCAAGAATGGAAAGCCAAATCATCCTTCACCGTTGCCTTC
TCTTGTGAAACTCATAAACCCACCAGTCAAACAACTTCATCAAAGATCGG
CCGTCCCTTGAGATCTGCCAGAGACGTTTCAACCACATCCAAACCATCTG
CAATGTCGTCAACCAGCAATCGTTTACTATATACCAGAGATGATTTACAG
TTGACAGGACTTGCCATATGCTGGGGTAAAAAGGATTCATACTACATCAG
TTTGCAGGAAGACGGTGTACGTCACAACGAATTGGACGATACTGCCTTAC
CTCCAGATGTCTGCCAGGAACTGCCTTTGCCAGTCCGTTTAAAGAGTATC
CAATCCGTCCTTAACCAGCATGCATCTTCGACTATCATGGGTTTTGACCT
GAAGGAGCAGTTGAAGATCATATACGAGTTGTGTGATACTTTGTTGNTAT
CATTGGTTTTGACCTGAGTAACACCAACATCCATTTGTGACCAATGGCCA
GACTTAGATTGGTACACTTACTATAACATCTGGGAACGCCTCTCTGCACA
ATGTAAGCACGTGGGCGAAATGATCGGTGTCAAAGAATCCTTTTTAGGAC
GTGCCATGCAGAACCGTGTCAGTTGTGTGACGGCCGAGCAGAAGCGTGTC
ATGCGTATCCATCGCAGATTTTATGGTGCTTTGGTATTAAATGACCTTTG
TAATGAAGTCCCTATGTCAGACGTCAGCCGTAAATATAAAGTCCATAAAG
GTCTTTTGCAATCGTTACAAAACTCAGCCGCGACCTACGCAGGATGATGT
GAACGAGAAATCGAAAGAACAATACTTCCCATCACAATTGGGCACCGCTA
CAATGGCCTCTTCTATGAAACCAGATGAAGCCATAATAGTTTATACAGAG
TTGCAAAAAGCACGCCGTAATTTTTGCCTGGAAAACGAACTTCATATCAT
ATATCAGATGCAAGTCGTACTATGAATCGTGCATTACTGGAGGTCATTGC
TGGCGGAGTCGCAGTGTCCCCACCTGACGTCGAGCTCTACGCAAAGAGTA
CTTATTTGAACACGTGTTTGGCCGTTCAAACGGGCCGTCACCCTGAAGAA
CTGATATGCACATCTATGAAGTTTCTACTGGAAAATGATTTCATCAAACT
GCGCTTTGAGAAAAATAAGGTGTGAACCTTCCAGCTCGCCGTGTCATCAT
TCGATCCCCTATGTTTCATGGAAAATTGATCGACGCCTTGGTGTATAAAC
AAATGGTGGGGCGTGCTGGGCGGAAAGGCGTCGACACTCAAGGAGAAAGT
ATCTTGATATGTAAACCAAACGAGAAACAAAAATCACTTGCTATGATGAC
GTCACTCTTGAAACCTGTCTATAGTTGTTTGTTAGAATCAATTTGAGGAA
GCTGGCATCAATGTGGGTGGATTTATGGGAAACGAGACACCTCCTGGTGG
ATTAACCAACATTGATATCGCTATATGCACCATTGAACGAGCAAACTCTC
TGATCAACCGCCTCATGGAGGAAGACAAGCTATCTCTACTTGGAAGTATT
GTTATTGATGAAATGCACATGATTGGTGACCCATCACGTGGTTATTTACT
TGAACTCTTATTGACCAAGATTCGATTTTTAATGGCTAAGAATGCAACCA
ATGTTGGTGAAAATAATGAGAGCAGCAGTAACCATGACAATGGGATACAA
ATCATAGGTATGAGTGCTACTTTACCGAATTTAGACATGATGGCGCGATG
GTTGGATGCAAGGTTCTACGTTACAGATTACAGACCAGTGCCTTTGGATG
AATATTTGAAAACCTCTAAGACTATTTACGATTGCGCAGATACTGTAGTA
CGGACTATTTCACCTGAGGACACAATTAAAGGCGACGACGATGACGTTAT
CAATTTATGTCTTGAAACAATGCGAGATACAAACTCTGTCTTGATTTTTT
GTCCAACCAAGAACTGGTGTGAAAAATTATCCATCAGCATTGCCAACTAT
CTCGCCAACAATGTTTTGAGTAAAGAATCTGATACAGAGAATATCTTTGA
TAAAGAAGGCTTACAAGATGTGTTAAGTGAGCTGCAGCAAACACCAGCTG
GTTTGGATCCAAGTTTGGAGAAGGTGGTCAGCTCTGGTGTGTCTTACCAT
CACGCTGGACTGACCATGGATGAAAGGGATATCATTGAAGGAGCATTCCG
AAGAGGTGTCTTGAAGATTATTATCGCAACGTCTACGCTGTCATCCGCTA
ATTTGATCTATTCTGCTCCAACGAGTGCTGGTAAAACGTTAGTCGCTGAA
ATCCTCATGTTGAAAAGAGTCCTGGAAACAGAGAAGAAAGCCATCTACAT
CTTACCCTTTGTCAGTGTGGCGAGAGAGAAGATGTATTCACTAAGGAAGT
CAGAAGACATTGATTTGGCATGTAAGTCTTCCAAAAACAAGAAAAGGTTA
TCGGCTGAGAAGAAGAACTCTATGCCCTCTCCCGAGCTCAATTCAAGTCT
CCAGTTATCACAATGGGGTCTTCCAGAAGTTATACTGGAGAATTATAAAG
CTAAAGGAATCAATAAAATGTTTGAATGGCAAAAAGAATGCTTACTACAA
GACCAAGTTTTGGATGGTGATGGTGTCAACACCTCAAATCAAAATCAAAG
AAAATGTTGCTGGTAGTACTGCTAAAAAACAGGTATGATGACCGTGTTTT
GTAAGAAACTTGGCTGGTCATGTTTAGAAGTCTTACTGGAGCAATTTCAA
AGTCGTTTGTCATTTGGTGTTTGCCGGGACCTGTGTAATCTGGTTCGCAT
ATCGTTACTGAATCGTTTCACTGCTCGTTTATTCTATCAGAACGGATTTC
AAACTGTGAGTGCCATAGCCAATGCAAGTGAAAAAGAAATCTCTAAATTG
CTTCGTGAATCGACACCGTTTTACAGTAACAAACTAAAAGGAAAGGATGC
TGAAATGGTGGGTAAATCAGTACCTAAATGTTTATGGTTGAGTGGGAAAG
AAGGCTTGTCGGAGCAGGAAGCTGGCAGATTGATCATTGACGAAGCCAAA
CGTATCCTTGCAGCGGATGCACAAGCACTAGGCATTCCCATTGGGCAGTT
AAATCTCTCATCCAAGAATTCGACAATCTCTAAATCTTCCTCCAGTTCAT
CAGGCAAGAAAAGAAGATCCAGCCTCACTAAGAGTACTATAAAACGTAGG
AATCGTAAAAGAGCATCGGCTGAGAAAATCACTCCGTTGAGATCTTCGAA
ACGTTTATCTCCCGAACAACGTAGTGGTGAAAGAGTTGATAGTAACTCAA
AAGTTGGAACACAACTAGCGTATGCTTTGCAGAAAAGCACGTCTCAATCG
CCTAGTCCTGTGTTACGAGAAATACAGAATCTTTCGACTCAGAATCTCAG
TAGAAATTTATCTTTGGCTGATAATGACATGTCTCTATTTCAAGAAAATC
AAGTCATTAACACTGCTCAAAAGATGGTTGAAAATTTGAGTAATGATTCG
TTACTCTTTGGCGAATCATTGCCAAACATACTAGGAAAAGAAAATCAATC
TGATATTAAAATGACTACAGACATTTTGATTGAACAATTGAAAGATACAG
TGCTCCACAACCAATTATCCGATAAATCCGAAACTCAAGACTCGTTATTC
TTGATACCAAACCAAGACTTCAATAGCTTTTCAACTAAGAATCAAGACCA
AACTATGTCAGAGCAAACACCGAACCTTTCCGAAGATCGAATCCTGAACA
CTGGGAATTTTTGTGATAAACTGCACACCCAAGATTCTTTGTTTTTGAAT
GATAAAATTCCAAGCTTCTCAACCCACACAGTTAATAAAACCAGAGATAT
TGTTACCAAGGACGAACCAGAATCTCGAACGATTGCAGAATGTGAACTCA
ACCACCAGGAGCAACAGGGTTCTGTGAACAGTAAGAAAACCAAACGAAAG
ACAAGCGATTACTTGGAATCATCTGATTCGCTCTTACTCTTGTCTGACAG
TGCTTTAAAACCGAAAGAAAAATCACCAATACTAATCGAGTCGCCGAAAA
CCGAACTAAGTGTGACCACACCCTCGCCAAACCTTTCCTTGCGACTATCA
ACAACTGACGAAGCACTGGACACTTTTCCTAAAATATTACCACCCATGAA
ATTACATTCCCAATTCAATGACGCTTTAACCGGGGAAGCATCAACTTTGC
AACGAAATTTAACGTCAGTTACTTCACCGGAGGTTGATTTATTCGATCAG
AACATTGAAAGCAATGACAACAGTGGAGACCTATTCGAGAGTACTGAACT
TTTCACTAAGAATTCTACATCTCAAGCAACAGAGAGAGTCACTCCTCAAG
AAACCAACCTAAACGAAAGTGCATCTAATGAATTCCTAATTATCGATGTC
GCATCCTCCAAAACGTTATTCTTGACATTCATCCAAGAATGGAAAGCCAA
ATCATCCTTCACCGTTGCCTTCTCTTGTGAAACTCATAAACCCACCAGTC
AAACAACTTCATCAAAGATCGGCCGTCCCTTGAGATCTGCCAGAGACGTT
TCAACCACATCCAAACCATCTGCAATGTCGTCAACCAGCAATCGTTTACT
ATATACCAGAGATGATTTACAGTTGACAGGACTTGCCATATGCTGGGGTA
AAAAGGATTCATACTACATCAGTTTGCAGGAAGACGGTGTACGTCACAAC
GAATTGGACGATACTGCCTTACCTCCAGATGTCTGCCAGGAACTGCCTTT
GCCAGTCCGTTTAAAGAGTATCCAATCCGTCCTTAACCAGCATGCATCTT
CGACTATCATGGGTTTTGACCTGAAGGAGCAGTTGAAGATCATATACGAG
TTGTGTGATACTTTGTTGNTATCATTGGTTTTGACCTGAGTAACACCAAC
ATCCATTTGTGACCAATGGCCAGACTTAGATTGGTACACTTACTATAACA
TCTGGGAACGCCTCTCTGCACAATGTAAGCACGTGGGCGAAATGATCGGT
GTCAAAGAATCCTTTTTAGGACGTGCCATGCAGAACCGTGTCAGTTGTGT
GACGGCCGAGCAGAAGCGTGTCATGCGTATCCATCGCAGATTTTATGGTG
CTTTGGTATTAAATGACCTTTGTAATGAAGTCCCTATGTCAGACGTCAGC
CGTAAATATAAAGTCCATAAAGGTCTTTTGCAATCGTTACAAAACTCAGC
CGCGACCTACGCAGGATGATGTGAACGAGAAATCGAAAGAACAATACTTC
CCATCACAATTGGGCACCGCTACAATGGCCTCTTCTATGAAACCAGATGA
AGCCATAATAGTTTATACAGAGTTGCAAAAAGCACGCCGTAATTTTTGCC
TGGAAAACGAACTTCATATCATATATCAGATGCAAGTCGTACTATGAATC
GTGCATTACTGGAGGTCATTGCTGGCGGAGTCGCAGTGTCCCCACCTGAC
GTCGAGCTCTACGCAAAGAGTACTTATTTGAACACGTGTTTGGCCGTTCA
AACGGGCCGTCACCCTGAAGAACTGATATGCACATCTATGAAGTTTCTAC
TGGAAAATGATTTCATCAAACTGCGCTTTGAGAAAAATAAGGTGTGAACC
TTCCAGCTCGCCGTGTCATCATTCGATCCCCTATGTTTCATGGAAAATTG
ATCGACGCCTTGGTGTATAAACAAATGGTGGGGCGTGCTGGGCGGAAAGG
CGTCGACACTCAAGGAGAAAGTATCTTGATATGTAAACCAAACGAGAAAC
AAAAATCACTTGCTATGATGACGTCACTCTTGAAACCTGTCTATAGTTGT
TTGTTAGAATCAATTTGAGGAAGCTGGCATCAATGTGGGTGGATTTATGG
GAAACGAGACACCTCCTGGTGGATTAACCAACATTGATATCGCTATATGC
ACCATTGAACGAGCAAACTCTCTGATCAACCGCCTCATGGAGGAAGACAA
GCTATCTCTACTTGGAAGTATTGTTATTGATGAAATGCACATGATTGGTG
ACCCATCACGTGGTTATTTACTTGAACTCTTATTGACCAAGATTCGATTT
TTAATGGCTAAGAATGCAACCAATGTTGGTGAAAATAATGAGAGCAGCAG
TAACCATGACAATGGGATACAAATCATAGGTATGAGTGCTACTTTACCGA
ATTTAGACATGATGGCGCGATGGTTGGATGCAAGGTTCTACGTTACAGAT
TACAGACCAGTGCCTTTGGATGAATATTTGAAAACCTCTAAGACTATTTA
CGATTGCGCAGATACTGTAGTACGGACTATTTCACCTGAGGACACAATTA
AAGGCGACGACGATGACGTTATCAATTTATGTCTTGAAACAATGCGAGAT
ACAAACTCTGTCTTGATTTTTTGTCCAACCAAGAACTGGTGTGAAAAATT
ATCCATCAGCATTGCCAACTATCTCGCCAACAATGTTTTGAGTAAAGAAT
CTGATACAGAGAATATCTTTGATAAAGAAGGCTTACAAGATGTGTTAAGT
GAGCTGCAGCAAACACCAGCTGGTTTGGATCCAAGTTTGGAGAAGGTGGT
CAGCTCTGGTGTGTCTTACCATCACGCTGGACTGACCATGGATGAAAGGG
ATATCATTGAAGGAGCATTCCGAAGAGGTGTCTTGAAGATTATTATCGCA
ACGTCTACGCTGTCATCCGCTAATTTGATCTATTCTGCTCCAACGAGTGC
TGGTAAAACGTTAGTCGCTGAAATCCTCATGTTGAAAAGAGTCCTGGAAA
CAGAGAAGAAAGCCATCTACATCTTACCCTTTGTCAGTGTGGCGAGAGAG
AAGATGTATTCACTAAGGAAGTCAGAAGACATTGATTTGGCATGTAAGTC
TTCCAAAAACAAGAAAAGGTTATCGGCTGAGAAGAAGAACTCTATGCCCT
CTCCCGAGCTCAATTCAAGTCTCCAGTTATCACAATGGGGTCTTCCAGAA
GTTATACTGGAGAATTATAAAGCTAAAGGAATCAATAAAATGTTTGAATG
GCAAAAAGAATGCTTACTACAAGACCAAGTTTTGGATGGTGATGGTGTCA
ACACCTCAAATCAAAATCAAAGAAAATGTTGCTGGTAGTACTGCTAAAAA
ACAGGTATGATGACCGTGTTTTGTAAGAAACTTGGCTGGTCATGTTTAGA
AGTCTTACTGGAGCAATTTCAAAGTCGTTTGTCATTTGGTGTTTGCCGGG
ACCTGTGTAATCTGGTTCGCATATCGTTACTGAATCGTTTCACTGCTCGT
TTATTCTATCAGAACGGATTTCAAACTGTGAGTGCCATAGCCAATGCAAG
TGAAAAAGAAATCTCTAAATTGCTTCGTGAATCGACACCGTTTTACAGTA
ACAAACTAAAAGGAAAGGATGCTGAAATGGTGGGTAAATCAGTACCTAAA
TGTTTATGGTTGAGTGGGAAAGAAGGCTTGTCGGAGCAGGAAGCTGGCAG
ATTGATCATTGACGAAGCCAAACGTATCCTTGCAGCGGATGCACAAGCAC
TAGGCATTCCCATTGGGCAGTTAAATCTCTCATCCAAGAATTCGACAATC
TCTAAATCTTCCTCCAGTTCATCAGGCAAGAAAAGAAGATCCAGCCTCAC
TAAGAGTACTATAAAACGTAGGAATCGTAAAAGAGCATCGGCTGAGAAAA
TCACTCCGTTGAGATCTTCGAAACGTTTATCTCCCGAACAACGTAGTGGT
GAAAGAGTTGATAGTAACTCAAAAGTTGGAACACAACTAGCGTATGCTTT
GCAGAAAAGCACGTCTCAATCGCCTAGTCCTGTGTTACGAGAAATACAGA
ATCTTTCGACTCAGAATCTCAGTAGAAATTTATCTTTGGCTGATAATGAC
ATGTCTCTATTTCAAGAAAATCAAGTCATTAACACTGCTCAAAAGATGGT
TGAAAATTTGAGTAATGATTCGTTACTCTTTGGCGAATCATTGCCAAACA
TACTAGGAAAAGAAAATCAATCTGATATTAAAATGACTACAGACATTTTG
ATTGAACAATTGAAAGATACAGTGCTCCACAACCAATTATCCGATAAATC
CGAAACTCAAGACTCGTTATTCTTGATACCAAACCAAGACTTCAATAGCT
TTTCAACTAAGAATCAAGACCAAACTATGTCAGAGCAAACACCGAACCTT
TCCGAAGATCGAATCCTGAACACTGGGAATTTTTGTGATAAACTGCACAC
CCAAGATTCTTTGTTTTTGAATGATAAAATTCCAAGCTTCTCAACCCACA
CAGTTAATAAAACCAGAGATATTGTTACCAAGGACGAACCAGAATCTCGA
ACGATTGCAGAATGTGAACTCAACCACCAGGAGCAACAGGGTTCTGTGAA
CAGTAAGAAAACCAAACGAAAGACAAGCGATTACTTGGAATCATCTGATT
CGCTCTTACTCTTGTCTGACAGTGCTTTAAAACCGAAAGAAAAATCACCA
ATACTAATCGAGTCGCCGAAAACCGAACTAAGTGTGACCACACCCTCGCC
AAACCTTTCCTTGCGACTATCAACAACTGACGAAGCACTGGACACTTTTC
CTAAAATATTACCACCCATGAAATTACATTCCCAATTCAATGACGCTTTA
ACCGGGGAAGCATCAACTTTGCAACGAAATTTAACGTCAGTTACTTCACC
GGAGGTTGATTTATTCGATCAGAACATTGAAAGCAATGACAACAGTGGAG
ACCTATTCGAGAGTACTGAACTTTTCACTAAGAATTCTACATCTCAAGCA
ACAGAGAGAGTCACTCCTCAAGAAACCAACCTAAACGAAAGTGCATCTAA
TGAATTCCTAATTATCGATGTCGCATCCTCCAAAACGTTATTCTTGACAT
TCATCCAAGAATGGAAAGCCAAATCATCCTTCACCGTTGCCTTCTCTTGT
GAAACTCATAAACCCACCAGTCAAACAACTTCATCAAAGATCGGCCGTCC
CTTGAGATCTGCCAGAGACGTTTCAACCACATCCAAACCATCTGCAATGT
CGTCAACCAGCAATCGTTTACTATATACCAGAGATGATTTACAGTTGACA
GGACTTGCCATATGCTGGGGTAAAAAGGATTCATACTACATCAGTTTGCA
GGAAGACGGTGTACGTCACAACGAATTGGACGATACTGCCTTACCTCCAG
ATGTCTGCCAGGAACTGCCTTTGCCAGTCCGTTTAAAGAGTATCCAATCC
GTCCTTAACCAGCATGCATCTTCGACTATCATGGGTTTTGACCTGAAGGA
GCAGTTGAAGATCATATACGAGTTGTGTGATACTTTGTTGNTATCATTGG
TTTTGACCTGAGTAACACCAACATCCATTTGTGACCAATGGCCAGACTTA
GATTGGTACACTTACTATAACATCTGGGAACGCCTCTCTGCACAATGTAA
GCACGTGGGCGAAATGATCGGTGTCAAAGAATCCTTTTTAGGACGTGCCA
TGCAGAACCGTGTCAGTTGTGTGACGGCCGAGCAGAAGCGTGTCATGCGT
ATCCATCGCAGATTTTATGGTGCTTTGGTATTAAATGACCTTTGTAATGA
AGTCCCTATGTCAGACGTCAGCCGTAAATATAAAGTCCATAAAGGTCTTT
TGCAATCGTTACAAAACTCAGCCGCGACCTACGCAGGATGATGTGAACGA
GAAATCGAAAGAACAATACTTCCCATCACAATTGGGCACCGCTACAATGG
CCTCTTCTATGAAACCAGATGAAGCCATAATAGTTTATACAGAGTTGCAA
AAAGCACGCCGTAATTTTTGCCTGGAAAACGAACTTCATATCATATATCA
GATGCAAGTCGTACTATGAATCGTGCATTACTGGAGGTCATTGCTGGCGG
AGTCGCAGTGTCCCCACCTGACGTCGAGCTCTACGCAAAGAGTACTTATT
TGAACACGTGTTTGGCCGTTCAAACGGGCCGTCACCCTGAAGAACTGATA
TGCACATCTATGAAGTTTCTACTGGAAAATGATTTCATCAAACTGCGCTT
TGAGAAAAATAAGGTGTGAACCTTCCAGCTCGCCGTGTCATCATTCGATC
CCCTATGTTTCATGGAAAATTGATCGACGCCTTGGTGTATAAACAAATGG
TGGGGCGTGCTGGGCGGAAAGGCGTCGACACTCAAGGAGAAAGTATCTTG
ATATGTAAACCAAACGAGAAACAAAAATCACTTGCTATGATGACGTCACT
CTTGAAACCTGTCTATAGTTGTTTGTTAGAATCAATTTGAGGAAGCTGGC
ATCAATGTGGGTGGATTTATGGGAAACGAGACACCTCCTGGTGGATTAAC
CAACATTGATATCGCTATATGCACCATTGAACGAGCAAACTCTCTGATCA
ACCGCCTCATGGAGGAAGACAAGCTATCTCTACTTGGAAGTATTGTTATT
GATGAAATGCACATGATTGGTGACCCATCACGTGGTTATTTACTTGAACT
CTTATTGACCAAGATTCGATTTTTAATGGCTAAGAATGCAACCAATGTTG
GTGAAAATAATGAGAGCAGCAGTAACCATGACAATGGGATACAAATCATA
GGTATGAGTGCTACTTTACCGAATTTAGACATGATGGCGCGATGGTTGGA
TGCAAGGTTCTACGTTACAGATTACAGACCAGTGCCTTTGGATGAATATT
TGAAAACCTCTAAGACTATTTACGATTGCGCAGATACTGTAGTACGGACT
ATTTCACCTGAGGACACAATTAAAGGCGACGACGATGACGTTATCAATTT
ATGTCTTGAAACAATGCGAGATACAAACTCTGTCTTGATTTTTTGTCCAA
CCAAGAACTGGTGTGAAAAATTATCCATCAGCATTGCCAACTATCTCGCC
AACAATGTTTTGAGTAAAGAATCTGATACAGAGAATATCTTTGATAAAGA
AGGCTTACAAGATGTGTTAAGTGAGCTGCAGCAAACACCAGCTGGTTTGG
ATCCAAGTTTGGAGAAGGTGGTCAGCTCTGGTGTGTCTTACCATCACGCT
GGACTGACCATGGATGAAAGGGATATCATTGAAGGAGCATTCCGAAGAGG
TGTCTTGAAGATTATTATCGCAACGTCTACGCTGTCATCCGCTAATTTGA
TCTATTCTGCTCCAACGAGTGCTGGTAAAACGTTAGTCGCTGAAATCCTC
ATGTTGAAAAGAGTCCTGGAAACAGAGAAGAAAGCCATCTACATCTTACC
CTTTGTCAGTGTGGCGAGAGAGAAGATGTATTCACTAAGGAAGTCAGAAG
ACATTGATTTGGCATGTAAGTCTTCCAAAAACAAGAAAAGGTTATCGGCT
GAGAAGAAGAACTCTATGCCCTCTCCCGAGCTCAATTCAAGTCTCCAGTT
ATCACAATGGGGTCTTCCAGAAGTTATACTGGAGAATTATAAAGCTAAAG
GAATCAATAAAATGTTTGAATGGCAAAAAGAATGCTTACTACAAGACCAA
GTTTTGGATGGTGATGGTGTCAACACCTCAAATCAAAATCAAAGAAAATG
TTGCTGGTAGTACTGCTAAAAAACAGGTATGATGACCGTGTTTTGTAAGA
AACTTGGCTGGTCATGTTTAGAAGTCTTACTGGAGCAATTTCAAAGTCGT
TTGTCATTTGGTGTTTGCCGGGACCTGTGTAATCTGGTTCGCATATCGTT
ACTGAATCGTTTCACTGCTCGTTTATTCTATCAGAACGGATTTCAAACTG
TGAGTGCCATAGCCAATGCAAGTGAAAAAGAAATCTCTAAATTGCTTCGT
GAATCGACACCGTTTTACAGTAACAAACTAAAAGGAAAGGATGCTGAAAT
GGTGGGTAAATCAGTACCTAAATGTTTATGGTTGAGTGGGAAAGAAGGCT
TGTCGGAGCAGGAAGCTGGCAGATTGATCATTGACGAAGCCAAACGTATC
CTTGCAGCGGATGCACAAGCACTAGGCATTCCCATTGGGCAGTTAAATCT
CTCATCCAAGAATTCGACAATCTCTAAATCTTCCTCCAGTTCATCAGGCA
AGAAAAGAAGATCCAGCCTCACTAAGAGTACTATAAAACGTAGGAATCGT
AAAAGAGCATCGGCTGAGAAAATCACTCCGTTGAGATCTTCGAAACGTTT
ATCTCCCGAACAACGTAGTGGTGAAAGAGTTGATAGTAACTCAAAAGTTG
GAACACAACTAGCGTATGCTTTGCAGAAAAGCACGTCTCAATCGCCTAGT
CCTGTGTTACGAGAAATACAGAATCTTTCGACTCAGAATCTCAGTAGAAA
TTTATCTTTGGCTGATAATGACATGTCTCTATTTCAAGAAAATCAAGTCA
TTAACACTGCTCAAAAGATGGTTGAAAATTTGAGTAATGATTCGTTACTC
TTTGGCGAATCATTGCCAAACATACTAGGAAAAGAAAATCAATCTGATAT
TAAAATGACTACAGACATTTTGATTGAACAATTGAAAGATACAGTGCTCC
ACAACCAATTATCCGATAAATCCGAAACTCAAGACTCGTTATTCTTGATA
CCAAACCAAGACTTCAATAGCTTTTCAACTAAGAATCAAGACCAAACTAT
GTCAGAGCAAACACCGAACCTTTCCGAAGATCGAATCCTGAACACTGGGA
ATTTTTGTGATAAACTGCACACCCAAGATTCTTTGTTTTTGAATGATAAA
ATTCCAAGCTTCTCAACCCACACAGTTAATAAAACCAGAGATATTGTTAC
CAAGGACGAACCAGAATCTCGAACGATTGCAGAATGTGAACTCAACCACC
AGGAGCAACAGGGTTCTGTGAACAGTAAGAAAACCAAACGAAAGACAAGC
GATTACTTGGAATCATCTGATTCGCTCTTACTCTTGTCTGACAGTGCTTT
AAAACCGAAAGAAAAATCACCAATACTAATCGAGTCGCCGAAAACCGAAC
TAAGTGTGACCACACCCTCGCCAAACCTTTCCTTGCGACTATCAACAACT
GACGAAGCACTGGACACTTTTCCTAAAATATTACCACCCATGAAATTACA
TTCCCAATTCAATGACGCTTTAACCGGGGAAGCATCAACTTTGCAACGAA
ATTTAACGTCAGTTACTTCACCGGAGGTTGATTTATTCGATCAGAACATT
GAAAGCAATGACAACAGTGGAGACCTATTCGAGAGTACTGAACTTTTCAC
TAAGAATTCTACATCTCAAGCAACAGAGAGAGTCACTCCTCAAGAAACCA
ACCTAAACGAAAGTGCATCTAATGAATTCCTAATTATCGATGTCGCATCC
TCCAAAACGTTATTCTTGACATTCATCCAAGAATGGAAAGCCAAATCATC
CTTCACCGTTGCCTTCTCTTGTGAAACTCATAAACCCACCAGTCAAACAA
CTTCATCAAAGATCGGCCGTCCCTTGAGATCTGCCAGAGACGTTTCAACC
ACATCCAAACCATCTGCAATGTCGTCAACCAGCAATCGTTTACTATATAC
CAGAGATGATTTACAGTTGACAGGACTTGCCATATGCTGGGGTAAAAAGG
ATTCATACTACATCAGTTTGCAGGAAGACGGTGTACGTCACAACGAATTG
GACGATACTGCCTTACCTCCAGATGTCTGCCAGGAACTGCCTTTGCCAGT
CCGTTTAAAGAGTATCCAATCCGTCCTTAACCAGCATGCATCTTCGACTA
TCATGGGTTTTGACCTGAAGGAGCAGTTGAAGATCATATACGAGTTGTGT
GATACTTTGTTGNTATCATTGGTTTTGACCTGAGTAACACCAACATCCAT
TTGTGACCAATGGCCAGACTTAGATTGGTACACTTACTATAACATCTGGG
AACGCCTCTCTGCACAATGTAAGCACGTGGGCGAAATGATCGGTGTCAAA
GAATCCTTTTTAGGACGTGCCATGCAGAACCGTGTCAGTTGTGTGACGGC
CGAGCAGAAGCGTGTCATGCGTATCCATCGCAGATTTTATGGTGCTTTGG
TATTAAATGACCTTTGTAATGAAGTCCCTATGTCAGACGTCAGCCGTAAA
TATAAAGTCCATAAAGGTCTTTTGCAATCGTTACAAAACTCAGCCGCGAC
CTACGCAGGATGATGTGAACGAGAAATCGAAAGAACAATACTTCCCATCA
CAATTGGGCACCGCTACAATGGCCTCTTCTATGAAACCAGATGAAGCCAT
AATAGTTTATACAGAGTTGCAAAAAGCACGCCGTAATTTTTGCCTGGAAA
ACGAACTTCATATCATATATCAGATGCAAGTCGTACTATGAATCGTGCAT
TACTGGAGGTCATTGCTGGCGGAGTCGCAGTGTCCCCACCTGACGTCGAG
CTCTACGCAAAGAGTACTTATTTGAACACGTGTTTGGCCGTTCAAACGGG
CCGTCACCCTGAAGAACTGATATGCACATCTATGAAGTTTCTACTGGAAA
ATGATTTCATCAAACTGCGCTTTGAGAAAAATAAGGTGTGAACCTTCCAG
CTCGCCGTGTCATCATTCGATCCCCTATGTTTCATGGAAAATTGATCGAC
GCCTTGGTGTATAAACAAATGGTGGGGCGTGCTGGGCGGAAAGGCGTCGA
CACTCAAGGAGAAAGTATCTTGATATGTAAACCAAACGAGAAACAAAAAT
CACTTGCTATGATGACGTCACTCTTGAAACCTGTCTATAGTTGTTTGTTA
GAATCAATTTGAGGAAGCTGGCATCAATGTGGGTGGATTTATGGGAAACG
AGACACCTCCTGGTGGATTAACCAACATTGATATCGCTATATGCACCATT
GAACGAGCAAACTCTCTGATCAACCGCCTCATGGAGGAAGACAAGCTATC
TCTACTTGGAAGTATTGTTATTGATGAAATGCACATGATTGGTGACCCAT
CACGTGGTTATTTACTTGAACTCTTATTGACCAAGATTCGATTTTTAATG
GCTAAGAATGCAACCAATGTTGGTGAAAATAATGAGAGCAGCAGTAACCA
TGACAATGGGATACAAATCATAGGTATGAGTGCTACTTTACCGAATTTAG
ACATGATGGCGCGATGGTTGGATGCAAGGTTCTACGTTACAGATTACAGA
CCAGTGCCTTTGGATGAATATTTGAAAACCTCTAAGACTATTTACGATTG
CGCAGATACTGTAGTACGGACTATTTCACCTGAGGACACAATTAAAGGCG
ACGACGATGACGTTATCAATTTATGTCTTGAAACAATGCGAGATACAAAC
TCTGTCTTGATTTTTTGTCCAACCAAGAACTGGTGTGAAAAATTATCCAT
CAGCATTGCCAACTATCTCGCCAACAATGTTTTGAGTAAAGAATCTGATA
CAGAGAATATCTTTGATAAAGAAGGCTTACAAGATGTGTTAAGTGAGCTG
CAGCAAACACCAGCTGGTTTGGATCCAAGTTTGGAGAAGGTGGTCAGCTC
TGGTGTGTCTTACCATCACGCTGGACTGACCATGGATGAAAGGGATATCA
TTGAAGGAGCATTCCGAAGAGGTGTCTTGAAGATTATTATCGCAACGTCT
ACGCTGTCATCCGCTAATTTGATCTATTCTGCTCCAACGAGTGCTGGTAA
AACGTTAGTCGCTGAAATCCTCATGTTGAAAAGAGTCCTGGAAACAGAGA
AGAAAGCCATCTACATCTTACCCTTTGTCAGTGTGGCGAGAGAGAAGATG
TATTCACTAAGGAAGTCAGAAGACATTGATTTGGCATGTAAGTCTTCCAA
AAACAAGAAAAGGTTATCGGCTGAGAAGAAGAACTCTATGCCCTCTCCCG
AGCTCAATTCAAGTCTCCAGTTATCACAATGGGGTCTTCCAGAAGTTATA
CTGGAGAATTATAAAGCTAAAGGAATCAATAAAATGTTTGAATGGCAAAA
AGAATGCTTACTACAAGACCAAGTTTTGGATGGTGATGGTGTCAACACCT
CAAATCAAAATCAAAGAAAATGTTGCTGGTAGTACTGCTAAAAAACAG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_001020XLOC_001020Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001979-exon-sc0000012-1575043694:1162582..1162938TCONS_00001979-exon-sc0000012-1575043694:1162582..1162938Clytia hemisphaericaexon
TCONS_00001979-exon-sc0000012-1575043694:1161959..1162181TCONS_00001979-exon-sc0000012-1575043694:1161959..1162181Clytia hemisphaericaexon
TCONS_00001979-exon-sc0000012-1575043694:1161408..1161556TCONS_00001979-exon-sc0000012-1575043694:1161408..1161556Clytia hemisphaericaexon
TCONS_00001979-exon-sc0000012-1575043694:1160127..1160988TCONS_00001979-exon-sc0000012-1575043694:1160127..1160988Clytia hemisphaericaexon
TCONS_00001979-exon-sc0000012-1575043694:1146700..1146915TCONS_00001979-exon-sc0000012-1575043694:1146700..1146915Clytia hemisphaericaexon
TCONS_00001979-exon-sc0000012-1575043694:1146276..1146487TCONS_00001979-exon-sc0000012-1575043694:1146276..1146487Clytia hemisphaericaexon
TCONS_00001979-exon-sc0000012-1575043694:1145646..1145810TCONS_00001979-exon-sc0000012-1575043694:1145646..1145810Clytia hemisphaericaexon
TCONS_00001979-exon-sc0000012-1575043694:1141326..1141650TCONS_00001979-exon-sc0000012-1575043694:1141326..1141650Clytia hemisphaericaexon
TCONS_00001979-exon-sc0000012-1575043694:1138503..1140877TCONS_00001979-exon-sc0000012-1575043694:1138503..1140877Clytia hemisphaericaexon
TCONS_00001979-exon-sc0000012-1575043694:1133484..1133644TCONS_00001979-exon-sc0000012-1575043694:1133484..1133644Clytia hemisphaericaexon
TCONS_00001979-exon-sc0000012-1575043694:1126727..1128547TCONS_00001979-exon-sc0000012-1575043694:1126727..1128547Clytia hemisphaericaexon
TCONS_00001979-exon-sc0000012-1510915933:1162582..1162938TCONS_00001979-exon-sc0000012-1510915933:1162582..1162938Clytia hemisphaericaexon
TCONS_00001979-exon-sc0000012-1510915933:1161959..1162181TCONS_00001979-exon-sc0000012-1510915933:1161959..1162181Clytia hemisphaericaexon
TCONS_00001979-exon-sc0000012-1510915933:1161408..1161556TCONS_00001979-exon-sc0000012-1510915933:1161408..1161556Clytia hemisphaericaexon
TCONS_00001979-exon-sc0000012-1510915933:1160127..1160988TCONS_00001979-exon-sc0000012-1510915933:1160127..1160988Clytia hemisphaericaexon
TCONS_00001979-exon-sc0000012-1510915933:1146700..1146915TCONS_00001979-exon-sc0000012-1510915933:1146700..1146915Clytia hemisphaericaexon
TCONS_00001979-exon-sc0000012-1510915933:1146276..1146487TCONS_00001979-exon-sc0000012-1510915933:1146276..1146487Clytia hemisphaericaexon
TCONS_00001979-exon-sc0000012-1510915933:1145646..1145810TCONS_00001979-exon-sc0000012-1510915933:1145646..1145810Clytia hemisphaericaexon
TCONS_00001979-exon-sc0000012-1510915933:1141326..1141650TCONS_00001979-exon-sc0000012-1510915933:1141326..1141650Clytia hemisphaericaexon
TCONS_00001979-exon-sc0000012-1510915933:1138503..1140877TCONS_00001979-exon-sc0000012-1510915933:1138503..1140877Clytia hemisphaericaexon
TCONS_00001979-exon-sc0000012-1510915933:1133484..1133644TCONS_00001979-exon-sc0000012-1510915933:1133484..1133644Clytia hemisphaericaexon
TCONS_00001979-exon-sc0000012-1510915933:1126727..1128547TCONS_00001979-exon-sc0000012-1510915933:1126727..1128547Clytia hemisphaericaexon
TCONS_00001979-exon-sc0000012-1491911889:1162582..1162938TCONS_00001979-exon-sc0000012-1491911889:1162582..1162938Clytia hemisphaericaexon
TCONS_00001979-exon-sc0000012-1491911889:1161959..1162181TCONS_00001979-exon-sc0000012-1491911889:1161959..1162181Clytia hemisphaericaexon
TCONS_00001979-exon-sc0000012-1491911889:1161408..1161556TCONS_00001979-exon-sc0000012-1491911889:1161408..1161556Clytia hemisphaericaexon
TCONS_00001979-exon-sc0000012-1491911889:1160127..1160988TCONS_00001979-exon-sc0000012-1491911889:1160127..1160988Clytia hemisphaericaexon
TCONS_00001979-exon-sc0000012-1491911889:1146700..1146915TCONS_00001979-exon-sc0000012-1491911889:1146700..1146915Clytia hemisphaericaexon
TCONS_00001979-exon-sc0000012-1491911889:1146276..1146487TCONS_00001979-exon-sc0000012-1491911889:1146276..1146487Clytia hemisphaericaexon
TCONS_00001979-exon-sc0000012-1491911889:1145646..1145810TCONS_00001979-exon-sc0000012-1491911889:1145646..1145810Clytia hemisphaericaexon
TCONS_00001979-exon-sc0000012-1491911889:1141326..1141650TCONS_00001979-exon-sc0000012-1491911889:1141326..1141650Clytia hemisphaericaexon
TCONS_00001979-exon-sc0000012-1491911889:1138503..1140877TCONS_00001979-exon-sc0000012-1491911889:1138503..1140877Clytia hemisphaericaexon
TCONS_00001979-exon-sc0000012-1491911889:1133484..1133644TCONS_00001979-exon-sc0000012-1491911889:1133484..1133644Clytia hemisphaericaexon
TCONS_00001979-exon-sc0000012-1491911889:1126727..1128547TCONS_00001979-exon-sc0000012-1491911889:1126727..1128547Clytia hemisphaericaexon
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001979-proteinTCONS_00001979-proteinClytia hemisphaericapolypeptide
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000012supercontigsc0000012:1126727..1162938 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
9.20516 8.193 9.81273 7.81079 25.8195 18.3885 20.9797 22.3872 9.3463 10.5367 9.13241 7.6913 4.69137 5.16146 3.99388 4.02514 7.66936 6.85292 3.07358 4.59987 5.88211 6.10532 8.17571 8.65972 13.7845 12.2848 2.42728 1.49746 8.00468 7.92039
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR014001Helicase_ATP-bd
IPR001650Helicase_C
IPR011545DEAD/DEAH_box_helicase_dom
IPR014014RNA_helicase_DEAD_Q_motif
IPR027417P-loop_NTPase
Vocabulary: Molecular Function
TermDefinition
GO:0003676nucleic acid binding
GO:0005524ATP binding
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
molecular_function GO:0005524 ATP binding
molecular_function GO:0003676 nucleic acid binding
Blast
BLAST of TCONS_00001979 vs. Swiss-Prot (Human)
Match: DPOLQ (DNA polymerase theta OS=Homo sapiens GN=POLQ PE=1 SV=2)

HSP 1 Score: 840.877 bits (2171), Expect = 0.000e+0
Identity = 413/858 (48.14%), Postives = 600/858 (69.93%), Query Frame = 1
Query:  400 KKRLSAEKKNSMPSPELNSSLQLSQWGLPEVILENYKAKGINKMFEWQKECLLQDQVLDGANLIYSAPTSAGKTLVAEILMLKRVLETEKKAIYILPFVSVAREKMYSLRNQFEEAGINVGGFMGNETPPGGLTNIDIAICTIERANSLINRLMEEDKLSLLGSIVIDEMHMIGDPSRGYLLELLLTKIRFLMAKNATNVGENNESSSNHDNGIQIIGMSATLPNLDMMARWLDARFYVTDYRPVPLDEYLKTSKTIYDCADTVVRTISPEDTIKGDDDDVINLCLETMRDTNSVLIFCPTKNWCEKLSISIA------NYLANNVLSKESDTENIFDKEGLQDVLSELQQTPAGLDPSLEKVVSSGVSYHHAGLTMDERDIIEGAFRRGVLKIIIATSTLSSGVNLPARRVIIRSPMFHGKLIDALVYKQMVGRAGRKGVDTQGESILICKPNEKQKSLAMMTSLLKPVYSCLL-----DASRTMNRALLEVIAGGVAVSPPDVELYAKSTYLNTCL-----AVQTGRHPEEL--ICTSMKFLLENDFIKLRFEKNKDDVNEKSKEQYFPSQLGTATMASSMKPDEAIIVYTELQKARRNFCLENELHIIYQVTPTSICDQWPDLDWYTYYNIWERLSAQCKHVGEMIGVKESFLGRAMQNRVSCVTAEQKRVMRIHRRFYGALVLNDLCNEVPMSDVSRKYKVHKGLLQSLQNSAATYAGMMTVFCKKLGWSCLEVLLEQFQSRLSFGVCRDLCNLVRISLLNRFTARLFYQNGFQTVSAIANASEKEISKLLRESTPFYSNK--LKGKDAEMVGKSVPKCLWLSGKEGLSEQEAGRLIIDEAKRILAADAQALGI 2913
            K   + E K ++P  E +  L L+ WGLP+ +LE Y + G+ KMFEWQ ECLL  QVL+G NL+YSAPTSAGKTLVAE+L+LKRVLE  KKA++ILPFVSVA+EK Y L++ F+E GI V G+MG+ +P    +++DIA+CTIERAN LINRL+EE+K+ LLG +V+DE+HM+GD  RGYLLELLLTKI ++  K+A+      + +S+  N +QI+GMSATLPNL+++A WL+A  Y TD+RPVPL E +K   +IYD +  +VR   P   +KGD+D V++LC ET+ D +SVL+FCP+K WCEKL+  IA      ++ A  ++        I +++ L +V+ +L++ P+GLD  L+K V  GV++HHAGLT +ERDIIEGAFR+G+++++ ATSTLSSGVNLPARRVIIR+P+F G+ +D L YKQMVGRAGRKGVDT GESILICK +EK K +A++   LKPV SCL      + + +M RA+LE+I GGVA +  D+  YA  T+L   +      +Q  +   +L  I   + +LLEN+FI     ++ +  +    + Y P+ LG+AT++SS+ P + + ++ +LQ+A + F LEN+LHI+Y VTP  + + W  +DWY ++ +WE+L    K V E++GV+E FL R ++ +V   T  Q R M IH+RF+ +LVL DL +EVP+ ++++KY  ++G +QSLQ SAA YAGM+TVF  +LGW  +E+LL QFQ RL+FG+ R+LC+LVR+SLLN   AR+ Y +GF TV+ +A A+  E+  +L+ + PF S +  +  ++  +  +   + +W++G++GL+E+EA  LI++EA+ IL  D   +G+
Sbjct:   50 KAAAAGECKPTVPDYERDK-LLLANWGLPKAVLEKYHSFGVKKMFEWQAECLLLGQVLEGKNLVYSAPTSAGKTLVAELLILKRVLEMRKKALFILPFVSVAKEKKYYLQSLFQEVGIKVDGYMGSTSPSRHFSSLDIAVCTIERANGLINRLIEENKMDLLGMVVVDELHMLGDSHRGYLLELLLTKICYITRKSASC---QADLASSLSNAVQIVGMSATLPNLELVASWLNAELYHTDFRPVPLLESVKVGNSIYDSSMKLVREFEPMLQVKGDEDHVVSLCYETICDNHSVLLFCPSKKWCEKLADIIAREFYNLHHQAEGLVKPSECPPVILEQKELLEVMDQLRRLPSGLDSVLQKTVPWGVAFHHAGLTFEERDIIEGAFRQGLIRVLAATSTLSSGVNLPARRVIIRTPIFGGRPLDILTYKQMVGRAGRKGVDTVGESILICKNSEKSKGIALLQGSLKPVRSCLQRREGEEVTGSMIRAILEIIVGGVASTSQDMHTYAACTFLAASMKEGKQGIQRNQESVQLGAIEACVMWLLENEFI-----QSTEASDGTEGKVYHPTHLGSATLSSSLSPADTLDIFADLQRAMKGFVLENDLHILYLVTP--MFEDWTTIDWYRFFCLWEKLPTSMKRVAELVGVEEGFLARCVKGKVVARTERQHRQMAIHKRFFTSLVLLDLISEVPLREINQKYGCNRGQIQSLQQSAAVYAGMITVFSNRLGWHNMELLLSQFQKRLTFGIQRELCDLVRVSLLNAQRARVLYASGFHTVADLARANIVEVEVILKNAVPFKSARKAVDEEEEAVEERRNMRTIWVTGRKGLTEREAAALIVEEARMILQQDLVEMGV 896          

HSP 2 Score: 468.774 bits (1205), Expect = 2.397e-133
Identity = 272/634 (42.90%), Postives = 380/634 (59.94%), Query Frame = 3
Query: 4698 IIGFDLKEQLKIIYELCDTLLPKAVLKDPKVAHWLLEPSQREKNLFGITKQWLDEDHVSLTEGLSGGVGTRGFGMVPKPGCSGRVRACVESVLVNQLMSTLHQKLTQENLLAPFLEIEMPSLRTLSIIEINGIGFCDQACXXXXXXXXXXXXXXXXQCYQLAKRTFSLTSPDDVGRVLFIELALPCLTE------------------NGRATRTKGKVKHFRTSKDVLEKLVTYHRLPKLILEWRRINSTLTKIVYPVQRKKLKLPEYSMYRIYTESQFHTSTGRVTFTEPNIQNVPKEFDIKV-----------------------------SVNEPSMKRTVD--AESPGVVKAVSMRGAFVPFEGGVFVSADYSQLELRIMAHLSGDVKLIKAINESKDVFKSIAAEIYRIDADEVMPSQRQQAKQVCYGILYGIGSKSLAEQLETNVEEAAMYVENFKRKFKGVNSFIKKTIDSCRKLGYVSSMAGRKRYLPAISSSDSHARSQAERQSVNTAVQGSAADLVKKAMNNISDKL-------REHFSRLCLKRNXXXXXXXXXXXX----PAKGAFLVLQIHDELLYEVNRKDVDLVLQIIRNGMENAYKLLVKTPVKMHIGNSWGQLKDVE 6419
            ++ +D  +  KI+   C   L ++  +DPKVA WLL+P  +E  L  I   +L  + + L EG+    G +  G+      SGR RA VES+L+   M+ L+  L +ENL   F ++EMPS   L+++E+NGIGF    CE  K +M+ KL ++E Q YQLA  +FS TS DD+  VLF+EL LP   E                  NGR  R     + F TSKDVL KL   H LP LILEWRRI + +TK+V+P+QR+K   P   M RIY  SQ HT+TGR+TFTEPNIQNVP++F+IK+                             SVN P  +  ++  A   G+  ++SMR AFVPF GG  ++ADYSQLELRI+AHLS D +LI+ +N   DVF+SIAAE   I+ + V    RQQAKQ+CYGI+YG+G+KSL EQ+     +AA Y+++FK ++ G+N F+ +T+ +C++ G+V ++ GR+RYLP I  ++ + ++ AERQ++NT VQGSAAD+VK A  NI  +L       + H  R  + ++ +   S          P +G F +LQ+HDELLYEV  +DV  V QI++N ME+A KL VK  VK+ IG SWG+LKD +
Sbjct: 1962 VVIYDFIQSYKILLLSCGISLEQSY-EDPKVACWLLDPDSQEPTLHSIVTSFLPHE-LPLLEGMETSQGIQSLGLNAGSEHSGRYRASVESILIFNSMNQLNSLLQKENLQDVFRKVEMPSQYCLALLELNGIGFSTAECESQKHIMQAKLDAIETQAYQLAGHSFSFTSSDDIAEVLFLELKLPPNREMKNQGSKKTLGSTRRGIDNGRKLRLG---RQFSTSKDVLNKLKALHPLPGLILEWRRITNAITKVVFPLQREKCLNPFLGMERIYPVSQSHTATGRITFTEPNIQNVPRDFEIKMPTLVGESPPSQAVGKGLLPMGRGKYKKGFSVN-PRCQAQMEERAADRGMPFSISMRHAFVPFPGGSILAADYSQLELRILAHLSHDRRLIQVLNTGADVFRSIAAEWKMIEPESVGDDLRQQAKQICYGIIYGMGAKSLGEQMGIKENDAACYIDSFKSRYTGINQFMTETVKNCKRDGFVQTILGRRRYLPGIKDNNPYRKAHAERQAINTIVQGSAADIVKIATVNIQKQLETFHSTFKSHGHREGMLQSDQTGLSRKRKLQGMFCPIRGGFFILQLHDELLYEVAEEDVVQVAQIVKNEMESAVKLSVKLKVKVKIGASWGELKDFD 2589          

HSP 3 Score: 90.8929 bits (224), Expect = 9.228e-18
Identity = 50/159 (31.45%), Postives = 88/159 (55.35%), Query Frame = 1
Query: 4216 IIDVASSKTLFLTFIQEWKAKSSFTVAFSCETHKPTSQTTSSKIGRPLRSARDVSTTSKPSAMSSTSNRL-LYTRDDLQLTGLAICWGKKDSYYISLQEDGVRHNELDDTALPPDVCQELPLPVRLKSIQSVLNQHASS--TIMGFDLKEQLKIIYELC 4683
            IIDVAS + LF TFI+EW+ K  F+++ +CE  +  + + ++ IG   + A      S P  +    +   +   DD  + GLA+CWG +D+YY SLQ++  +H+E+  + +PP +   L L  R+  +QS L + +    +++ +D  +  KI+   C
Sbjct: 1827 IIDVASDQNLFQTFIKEWRCKKRFSISLACEKIRSLTSSKTATIGSRFKQA------SSPQEIPIRDDGFPIKGCDDTLVVGLAVCWGGRDAYYFSLQKEQ-KHSEISASLVPPSLDPSLTLKDRMWYLQSCLRKESDKECSVVIYDFIQSYKILLLSC 1978          
The following BLAST results are available for this feature:
BLAST of TCONS_00001979 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
DPOLQ2.397e-13348.14DNA polymerase theta OS=Homo sapiens GN=POLQ PE=1 ... [more]
back to top