Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001975 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001975
Unique NameTCONS_00001975
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1773

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001975 ID=TCONS_00001975|Name=TCONS_00001975|organism=Clytia hemisphaerica|type=transcript|length=1773bp
GAAAATAGTCAGGGAAGAGTTCAGAAGGCTTCCATTTTTGGTTCCTTCGT
TCTTATATCAAAAAAAGAAGGAAATCTTTTATCGGGCGAATTTTTTCTTC
TCAATTTTGCCCTTCTTCGTTTTTTCGTAcaattttgaagatattttaat
tTTCGTTTGGTATATGAAggaattttttgctcaaaacaaaaatggataaa
attgACAGCAAACAATTCGTCAATAAACTTgTATCAGGCATGTTTGAAAC
AAATTTAGACGAATCACACCTCCTGGGTTCGCATTTAGACCCGATGAGTA
AATATCTACCCAAACCAACTGGAGGTGTTAAAATGCCGACCGCGTTTTTA
AACAGTTTACACGCAGCCAATCCTGATCCCACACAATACGATCCTCATGA
TATCCTCGATCAAATTTCGGCTTCTTTACAACCGAATGGCGCTTCTGAAA
ATTCTTACGACCATGGTCCAACTTCAACAAACGCTACAAATTATTCAACA
TCACATTTGTTGTCACCTTCCTCGACCTCATTTTCGTCATCAACTTTCAG
TAATGGTAATTTCTCTACCTTCAATAATACCTTTGCTGCAGCTGCAGCCG
CTGCGGCCGCAGCAGCCGCCCAAGTCGGTCAAGAGAGCGAATGTACGCCG
CGTGAACTGGAATGGTTCGCCGAACGCTTCAAACAACGTCGTATCAAATT
AGGCGTCACACAGGCGGATGTCGGTGGTGCACTGGCACATTTAAAGTTAC
CAGGAGTTGGTAGTTTGAGTCAATCTACGATTTGTCGTTTCGAATCACTA
ACACTTAGCCATAATAACATGATGGCTTTAAAACCTGTTCTCTCTGCCTG
GTTAGATGAAGCAGAACGAGCAAACCGTATGAAAGCTAAAGACAGTGCCT
TTTTACCAAATGCTGATAAAAAACGCAAGCGTACGTCCATAGGGGCTGCT
GAAAAACGCTCTTTAGAGGCTTATTTTGCAATGCAGCCAAGACCATCAAG
TGATAAGATTGCAGCCATTGCAGAGAAATTAGACTTGTCCAAAAATGTTG
TACGTGTATGGTTTTGTAATCAAcgacaaaagaagaaaagaatgaaGTTT
TCAGttcattaaaattttgtttggtcgtgatgaaaaataaaaacactgac
GACATCTTTTTTGTAGATATATTTATGATCATCAACACACCTCGTCCCAT
CTAAAATTAAAAGGGCTTGGGAGAAATAAGTAAATATGTTTGATTTGCCT
CaagagtaaaaaaaagaaaatttgactaGGTTAGATATCATTTTTACAGG
GAGTTTTGTGTTCCTATCTTCTGACAGGTTTTTGCCCATTTTGAAACCAT
ATTTTGTGTGTGCATGTTTTTATAAATCTTCATCAAGTTCTACAGTAACT
TCTGGAGTCAtagttctttttcaaattttactacttctgtttattttatt
ttattgtatttgtatttttattttgtccttgtatattttggcttttttat
gccattttttgttttctttccttttttatttttccttttttttatcattt
cttcTTAAATTAATGTATATAGTTtataaatattataaaataaaatgccT
TTTGTATTATTTTGCACATTTTCGAGGTTCCTAAATGACCTCCTAAGTGA
CCtatgtattattattattgtttatTCGAATTTTGcgacaaagaaaattt
ctttttttatttatgatgtTTTGTCAAAGAAATCGTACTTTTTGATGaca
aaaagaaattacaaaagaaaaac
Run BLAST on NCBI

transcript from alignment at sc0000012:1098370..1101742-

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001975 ID=TCONS_00001975|Name=TCONS_00001975|organism=Clytia hemisphaerica|type=transcript|length=3373bp|location=Sequence derived from alignment at sc0000012:1098370..1101742- (Clytia hemisphaerica)
GAAAATAGTCAGGGAAGAGTTCAGAAGGCTTCCATTTTTGGTTCCTTCGT TCTTATATCAAAAAAAGAAGGAAATCTTTTATCGGGCGAATTTTTTCTTC TCAATTTTGCCCTTCTTCGTTTTTTCGTACAATTTTGAAGATATTTTAAT TTTCGTTTGGTATATGAAGGAATTTTTTGCTCAAAACAAAAATGGATAAA ATTGACAGCAAACAATTCGTCAATAAACTTGTAAGTCCCTTTTTAGGACC TTTTTTTTGTGGTAGTATTTCATGGCTATACTTAAAAAAAAAATCAGAAT TGGAGAGTTTAAAAAAAATGTTTTATAGTTTTGAAGAACGCTATGATAGA TGCATTCAAATCATTCAATAAAATATGGTCACAAAACTCTTCCTTCATCA ATTATTGATCCACTTCAATTGATTTGTTATGGACGCGAAAATGCCTGCTT TCAAATGGAAAAAAAAATCAATGATTCAATTTTGAATTGAAATTTTTTAT AAAATATTCGTTATTCATCTGTTTTTATGCGAAATATATAGCGGCGATAG AAAAGTGATAATTTATGTTAATTGCGTGTAATTAATTCTATTTCACGGCT TTATTCAGAAGAAGTGCTGTTTTCAAATTTCAAGTGTTTGTTATGTTTGG GTGTGTAGAAAACGCCTACTTTTAATTNCGTTGTTATAATAATTTTCTTG TCGAGGTTTAAAATTAAAGAGAGTGAGAGAGGAGAAGAAGAAGAAGGCTC ACTCACACAACATAAAAAAAAGAGAGAAAAAATAAATAAAGAAAGAAAGA GGGGGAGAAAAAAAAGTGAAGATAAAAGAAAAATTTGATCGCCTGGATCA GTTGAAAATAGTCAGGGAAGAGTTCAGAAGGCTTCCATTTTTGGTTCCTT CGTTCTTATATCAAAAAAAGAAGGAAATCTTTTATCGGGCGAATTTTTTC TTCTCAATTTTGCCCTTCTTCGTTTTTTCGTACAATTTTGAAGATATTTT AATTTTCGTTTGGTATATGAAGGAATTTTTTGCTCAAAACAAAAATGGAT AAAATTGACAGCAAACAATTCGTCAATAAACTTGTAAGTCCCTTTTTAGG ACCTTTTTTTTGTGGTAGTATTTCATGGCTATACTTAAAAAAAAAATCAG AATTGGAGAGTTTAAAAAAAATGTTTTATAGTTTTGAAGAACGCTATGAT AGATGCATTCAAATCATTCAATAAAATATGGTCACAAAACTCTTCCTTCA TCAATTATTGATCCACTTCAATTGATTTGTTATGGACGCGAAAATGCCTG CTTTCAAATGGAAAAAAAAATCAATGATTCAATTTTGAATTGACATTTTT TATAAAATATTCGTTATTCATCTGTTTTTATGCGAGATATATAGCGGCGA TAGAAAAGTGATAATTTATGTTAATTGCGTGTAATTAATTCTATTTCACG GCTTTATTCAGAATAAGTGCTGTTTTCAAATTTCAAGTGTTTGTTATGTT TGGGTGTGTAGAAAACGCCTACTTTTAATTATTATCATGCAGAATTATAG CGGCTCTTAAAATGGCCTTTGGCATATAGCTGTATATGAAAAATTTGAAG GGGTTGAAGGGACCAGCTCTTATTGAAGCTAGTTTACATAAACATCGGAA AGATTCTTTTTTAAAGTTAGTGTTTTGTGCTATTGTTTTCCGGGTATTAT GATGTTTGGTCGTCTTCCGATCGTGTAAATCGATGAATGAATCGATAATT TCAAAGGAGAACCGAAGAGTCATTCCCTGGCCACTTTGACATCGACATTA TGTAAATATCTTTTAATTTCTATTTTTCAGGTATCAGGCATGTTTGAAAC AAATTTAGACGAATCACACCTCCTGGGTTCGCATTTAGACCCGATGAGTA AATATCTACCCAAACCAACTGGAGGTGTTAAAATGCCGACCGCGTTTTTA AACAGTTTACACGCAGCCAATCCTGATCCCACACAATACGATCCTCATGA TATCCTCGATCAAATTTCGGCTTCTTTACAACCGAATGGCGCTTCTGAAA ATTCTTACGACCATGGTCCAACTTCAACAAACGCTACAAATTATTCAACA TCACATTTGTTGTCACCTTCCTCGACCTCATTTTCGTCATCAACTTTCAG TAATGGTAATTTCTCTACCTTCAATAATACCTTTGCTGCAGCTGCAGCCG CTGCGGCCGCAGCAGCCGCCCAAGTCGGTCAAGAGAGCGAATGTACGCCG CGTGAACTGGAATGGTTCGCCGAACGCTTCAAACAACGTCGTATCAAATT AGGCGTCACACAGGCGGATGTCGGTGGTGCACTGGCACATTTAAAGTTAC CAGGAGTTGGTAGTTTGAGTCAATCTACGATTTGTCGTTTCGAATCACTA ACACTTAGCCATAATAACATGATGGCTTTAAAACCTGTTCTCTCTGCCTG GTTAGATGAAGCAGAACGAGCAAACCGTATGAAAGCTAAAGACAGTGCCT TTTTACCAAATGCTGATAAAAAACGCAAGCGTACGTCCATAGGGGCTGCT GAAAAACGCTCTTTAGAGGCTTATTTTGCAATGCAGCCAAGACCATCAAG TGATAAGATTGCAGCCATTGCAGAGAAATTAGACTTGTCCAAAAATGTTG TACGTGTATGGTTTTGTAATCAACGACAAAAGAAGAAAAGAATGAAGTTT TCAGTTCATTAAAATTTTGTTTGGTCGTGATGAAAAATAAAAACACTGAC GACATCTTTTTTGTAGATATATTTATGATCATCAACACACCTCGTCCCAT CTAAAATTAAAAGGGCTTGGGAGAAATAAGTAAATATGTTTGATTTGCCT CAAGAGTAAAAAAAAGAAAATTTGACTAGGTTAGATATCATTTTTACAGG GAGTTTTGTGTTCCTATCTTCTGACAGGTTTTTGCCCATTTTGAAACCAT ATTTTGTGTGTGCATGTTTTTATAAATCTTCATCAAGTTCTACAGTAACT TCTGGAGTCATAGTTCTTTTTCAAATTTTACTACTTCTGTTTATTTTATT TTATTGTATTTGTATTTTTATTTTGTCCTTGTATATTTTGGCTTTTTTAT GCCATTTTTTGTTTTCTTTCCTTTTTTATTTTTCCTTTTTTTTATCATTT CTTCTTAAATTAATGTATATAGTTTATAAATATTATAAAATAAAATGCCT TTTGTATTATTTTGCACATTTTCGAGGTTCCTAAATGACCTCCTAAGTGA CCTATGTATTATTATTATTGTTTATTCGAATTTTGCGACAAAGAAAATTT CTTTTTTTATTTATGATGTTTTGTCAAAGAAATCGTACTTTTTGATGACA AAAAGAAATTACAAAAGAAAAAC
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_001017XLOC_001017Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001975-exon-sc0000012-1575043694:1101513..1101742TCONS_00001975-exon-sc0000012-1575043694:1101513..1101742Clytia hemisphaericaexon
TCONS_00001975-exon-sc0000012-1575043694:1098370..1099912TCONS_00001975-exon-sc0000012-1575043694:1098370..1099912Clytia hemisphaericaexon
TCONS_00001975-exon-sc0000012-1510915933:1101513..1101742TCONS_00001975-exon-sc0000012-1510915933:1101513..1101742Clytia hemisphaericaexon
TCONS_00001975-exon-sc0000012-1510915933:1098370..1099912TCONS_00001975-exon-sc0000012-1510915933:1098370..1099912Clytia hemisphaericaexon
TCONS_00001975-exon-sc0000012-1491911889:1101513..1101742TCONS_00001975-exon-sc0000012-1491911889:1101513..1101742Clytia hemisphaericaexon
TCONS_00001975-exon-sc0000012-1491911889:1098370..1099912TCONS_00001975-exon-sc0000012-1491911889:1098370..1099912Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000012supercontigsc0000012:1098370..1101742 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0 0.153649 2.32419e-06 6.04733e-06 3.99172 12.6542 7.62076 7.12371 4.98595 3.08911 0.00131022 7.7974 0.000495533 7.07821e-05 0.000135132 0.000209641 0.00079294 4.55274 3.14492 0.000301947 8.59673 12.5872 3.38717 6.15893 0.000406958 0.00059949 4.04967 4.15471 2.85783e-06 0
Blast
BLAST of TCONS_00001975 vs. Swiss-Prot (Human)
Match: PO4F3 (POU domain, class 4, transcription factor 3 OS=Homo sapiens GN=POU4F3 PE=1 SV=1)

HSP 1 Score: 256.529 bits (654), Expect = 3.910e-79
Identity = 124/155 (80.00%), Postives = 135/155 (87.10%), Query Frame = 3
Query:  639 ECTPRELEWFAERFKQRRIKLGVTQADVGGALAHLKLPGVGSLSQSTICRFESLTLSHNNMMALKPVLSAWLDEAERANRMKAKDSAFLPNADKKRKRTSIGAAEKRSLEAYFAMQPRPSSDKIAAIAEKLDLSKNVVRVWFCNQRQKKKRMKFS 1103
            E  PRELE FAERFKQRRIKLGVTQADVG ALA+LK+PGVGSLSQSTICRFESLTLSHNNM+ALKPVL AWL+EAE A R K         +++KRKRTSI A EKRSLEAYFA+QPRPSS+KIAAIAEKLDL KNVVRVWFCNQRQK+KRMK+S
Sbjct:  181 ESDPRELEAFAERFKQRRIKLGVTQADVGAALANLKIPGVGSLSQSTICRFESLTLSHNNMIALKPVLQAWLEEAEAAYREKNSKPELFNGSERKRKRTSIAAPEKRSLEAYFAIQPRPSSEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRMKYS 335          
The following BLAST results are available for this feature:
BLAST of TCONS_00001975 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
PO4F33.910e-7980.00POU domain, class 4, transcription factor 3 OS=Hom... [more]
back to top