Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001972 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001972
Unique NameTCONS_00001972
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length2870

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001972 ID=TCONS_00001972|Name=TCONS_00001972|organism=Clytia hemisphaerica|type=transcript|length=2870bp
attattttcaacttgatataaatattttgcagaaaaatatcaaaaatctt
tttgatggcGTTTTACTGGCGTTCATTTCACAAGATTCGAAAAGTATGAT
TCGTGTCGTCTCGATCATCAATTTGAAAACAAGTTGCggcaaatcaaaat
atttgtcGAAATCATAAACTTTACTGGTCCAAAAAGCCAAAAAGTTCAGC
ACATTTTATTCAACCTATTACAACTAAAAATCTTAATACATAAAACACTG
TAGTATGTCCAATAATTGGGAAACAGTCGTTAACAAGAAGAAAAGTCATG
TCACCAAAGCTGATGTGCGAAGAGTGAAGAAGAAATTTGTTGAGGGGGAG
GTtccaaaagttgaaaagaaagATCCTCTACAACTAGAGAAGACAGCGTA
TGAAGCAGGCTTCCGCAATGATGATGATTCGGACAAAGAAAATTATCCGT
CCAGAATTCCTTTTGAACAAAATGAGCAAAAACAATCACCAAGAAATGTT
ACAAGAAGGAAAGACAAACCCAAACCAAAACCAGCCCAAACAGTGAATCT
AGGCGAATTCATTAAAAAGgTTGACATTGATGGCCTCAAACTCACCATTC
AATCCATTCAAGAAAAATTCAATAATCATCCTTTGATTTGGTTGAAGGAA
GTTGCAGCTTGGCTCAAATCTCAAATCAAGGGACCTGCTGAGAAAACTGA
CCTAGCTTTTTTGAAACACGAAACAGATTTTCCGGTATCAGAGCTTGACA
AAGCAGTTCACAAACTTCTGGAGGACTTGATGAAAAAATGTGATAAGAAG
AATCTTGCAACATTTTATATTTCACTTATTGCTGGCATGGTCACTGATAT
TCAACAAGGAAATTCAACCTTAGCTGACCGAATCATGATTCAATTACTGT
GTCAACTTGAACCAACCGTCATAAAAGAAAATTGTAATGAAATTGTTGCC
GCTAAATCAAAAACAGCTGAAACCTACATTGCTGTCATGTGGGCTCTTGG
CCAACCTGTAGGCACACTTGAAAATCGACTATCTGTCTGGTGGTCGTCTA
TGTTTGCTGTGTTAGACAAGAAGAGACATGCTGTGGCGGCTGTCCACTAT
TTGAAAGAAATACTAAGcGAACTGGAAGATAAACCTATACAAAAACCAAT
GTTAGATACAGAATCGTTTCTTCAATTATATAATGTTATCTTTGGCAAGT
CACCTTTACAACACACATCAAGTTTGATTGACGAGTTGAAACCATTTGCT
TCTTTGATGAAGAGGATGCTATTAGCCGATAAACCTTGCAAAGAAAGGAA
GAACATTTTCATGCAACTTCTTGATGAACTTAAAAATATGGAAGAAGGAC
GAGAGAGAAATATGATTTGCGATGTATTGAGTGATTGTTTGGTGTCCAAC
CCAGATCTCTTGGAATGGTGGAGTGAAAACATCTTGGCTTATCTCCGACA
ATCAAGTGTTTTGCTGAAATATATCGAAGAAACAGATGTGGCTGAAAGGA
TGAGAAAAGGCCGCCGTCACAAAACATCAAGACCCATGGTCACTGCTGCA
CAAACTATGATCGGTAAAATGTTAAAAGTGAAAGATCGCTCACGTTTCGA
TAAAAAGccTGGTTTCCGTGAATGCCGCAAAATTTGTAACTATTTCATCA
ATGAAGAGATGGAACGTCGTCAACAAACATCTTCCGTctggaaacttttg
aaatacttcttcattttcaccACCATCTTCGTCGCTGTTGATCTTTACAC
CAATAAAGGATATCCAGGAAGTCGAACCaatgtatttttaaagaaatatg
gACTTGAAGAAAGACTAATGACTGGTTATAATTTTGCTGATCAGAAGAGA
ATGCAAGCCCAAAGCTTCATCACTACAAATGCACCGATTTATTACGCCAA
AGTTTCTCCCTATGTTGACCCTGTAATGGAAAAGACTGGTTACTACACTC
GAATCACGTGCGAAGCCATCTATAAACACAGCAAACCTGTACGCGACTTT
GCTAATACTCGTATCCCACCACTGCTCGAAAAGATCACGTATTTCTTGAA
ACGTCAATACGACATTATTTCATCTTACATATTGGGTCTGTACCAAACCT
ACGCACCAATTGTCCAAGAAAATGTCACCCANATTGAAACAACTTTATGT
ATATTTATTCATTTTAGATCACGTATTTCTTGAAACGTCAATACGACATT
ATTTCATCTTACATATTGGGTCTGTACCAAACCTACGCACCAATTGTCCA
AGAAAATGTCACCCAATTCTACAACTGGTTACAAGTCTCCATCCCCAAAG
CTTACAAGTTTATCTTGACAAATCTCATGGAACTCAAGAAGACCATCTAC
AATTTAAACCCTGCCATGTTCGATAAAGCTGCAATCGTTTTGAATGATGC
AATCGattacgtcatcaaaatggtaCCCATCGTTGTGGAGAGATGTATGG
CCACTTTGAATCTGGTGTTGGAATACATTCGAACTTATTTCGCTCAAGGA
CAAGGATGGATGCAACAACAATTCGGAAGggTTTCTCCTGCAGCGAAGTG
AATGGTTCAAATTGATgaagttttttaatgaatttgattATTCCCACATG
GCATCGGCACCACATTGAGAAGggataactttttaaaaatagttcatgtt
tttttttaataacaatAGAGCGCACGTATTTCTAGGCGGTTTTAGGGGTT
TAAAAATGTAGAATTTTCTATGGCATTGAAATTTTGCTcgaaaatttgtt
caaaattttaccTTAAAATACTAATAATTATtgaatcttaaaattttttg
atatttataaatttttgaagctgtgaaaaaaaaagatatttttcaaaata
atttgaaatatttttcgatT
Run BLAST on NCBI

transcript from alignment at sc0000012:1027087..1045747-

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001972 ID=TCONS_00001972|Name=TCONS_00001972|organism=Clytia hemisphaerica|type=transcript|length=18661bp|location=Sequence derived from alignment at sc0000012:1027087..1045747- (Clytia hemisphaerica)
ATTATTTTCAACTTGATATAAATATTTTGCAGAAAAATATCAAAAATCTT TTTGATGGCGTTTTACTGGCGTTCATTTCACAAGATTCGAAAAGTATGAT TCGTGTCGTCTCGATCATCAATTTGAAAACAAGTTGCGGCAAATCAAAAT ATTTGTCGAAATCATAAACTTTACTGGTCCAAAAAGCCAAAAAGTTCAGC ACATTTTATTCAACCTATTACAACTAAAAATCTTAATACATAAAACACTG TAGTATGTCCAATAATTGGGAAACAGTCGTTAACAAGAAGAAAAGTCATG TCACCAAAGCTGATGTGCGAAGAGTGAAGAAGAAATTTGTTGAGGGGGAG GTTCCAAAAGTTGAAAAGAAAGGTAAGATATTTTTCTTTTTCCCATGCAT AATTAGTGACTGACTTCGTTCAGTGGTGAGAGAGGAAAACATATTCTTCA ATCAGTGATTATGACCTTCCTACTTTTCCTACCGGTGGGACAAAAATCAG TTTTTTGAAGTTTGCAAAAAAAAAGCAGCCACATATAGAAGATCTTTCAG GACCCTGCCAACGCACCGGACTGTCCGGTGTATTTGTCCGGTGGCAAATA GTATCCTTTCACTACACCGGACGCAATAAGTCCGGTGTCAGTCAGGGAAT TTTGGACGCCAGACATTTATGAAACAAAAAATTAAGAAACACCGGACGCA CCGGACTGGTCATGTCCGGTGTTTTGATTGTCCGGTGAGAAAAAATATCC TTCTCTGACACTGGCAGTCTGGCACATCCTTGCAATTGCACAGGGTGTGC ATTTGCAACGGGTTTTCCAAACCCAGCGCAAGTGCGATAGGATGTCTCGG GCAAAACACGCTAATTTGACCTTTAAATAAAAAACGGCAAGAGAGGAAAA AAAACGGCAACTTCATTTCTTCTGTAAAATAATCTTCAAATATGTAAGAA AAAAATGACCCATTGAAAAAAAATTTCATCTATCCAGTTTTCTTTAATTT TAGATTTAATTTCATTTAGTTGAAGCGTTCGTTCTCAGATCGCGCGTATA TAAAGATGGCCGGAACATGGGCGATAATATTACGGAGGTACCCGAGCTCC ATCTTTCGTATTTCTCACTATCGACGATATGAAGTATATTTCTAGAAAAC CCGTACGAAAAAATAAGTGTAGGAAATATATAAACACTTTTTTCTAGAAG CAATTAAATCTCAACAAAGGAGTTTTAACACAAATTTCAGCCTCGTTAAA TTTAATGATCTACTTCACTTTCTTTATCAGTGAAATAACTAAGTAACAGG TAATAATGACGATTAAAATAAGAGGAGGCAATAGAAATCTAGGTTATATG CACACGACCTATGTATTTAGTTCTAGAAAAAGGCCACTGTCCCAGTGGAC TAAAAAGATATAGACCAATACTCCAATGTCCCTAACCCCGTAAAAGACGG AATAAGTGAGGGTGGTTAGAAAAAGTCACAAAACTTAATACCGTAAATCC TGATGATTTTGGCGACTTCGTGATGACTTCGTGATGACTTCGGACGACTT TACAGGGCTGTAATTTTTTCATAGATCAAATGAATTACTTTCATATGTTT TGCAGACACACCTGTCTCACAGCCCCGGTGGAACTTTTTCCCACAAGCGG GGAAAAGAAACTCTACTGAAATTCCAATTGGGATCGAAATTCTATTGTGC CAAGGTTAAAAAATCCAGCGGGAATGCTTTCGGAGTGCAATTTTTAAACA TTGAATTTTGAAAGGCAATGAAATCAAATTAATTTTCTCAGTGGGACTAA AATTATAGGATATTTTCCCACCGGTGACAAAATTTTTGTCGAATTTTCCA GTGGGGTTGGGATCCCAGCGAGAGGGAGGGAAAAATACACATAATACATC AGGGGTTTTTCCAAGCACTAAGCAATGCCTCCGTTTGTACTTGCAAATTG AGTTTTCATCAAAGGCGTAAGCCGTGAGCCCCCCAGTGGGTCCAGGGCTA GCCCTGGTGGGGGTTCAGGGGGCAAAGCCCCCTAAAGCTGAGCATAATTT GGCCTTAACTGGCACTTTAAAACGGTNATATAGAAGGAGGGTATAGTATA TAAAACTCAATTAAAAGAATCAACTGCAGCTGTGATAACTGAATAACTTT TACTACAAGTTTTATTCATTTTATTCCTTTTAATGGGCTTAAATAAGGGG AAGAAAGAGTGAGAAAGTATTTTATTATGGTGAAATTTGATCTTTTACTT CTTTTATGAAAATTTTCTTTCAAATTGAGTTTCTGAAACTCAATGTGAAT TGAGTTTAATGCCTCCGTCTAACGGAGGCATTTGAGTGCTTGGAAAAACC ACTGTACATCCCTGTCTCATAGGAGTGGTAATTTTTAAATTTCTTGTCTC TCTGTCTCACAACGAAAAGAAAAATACAAATTGCACCCCTGTCTCATGCG AGAGGGTTTTTGGCTCTCTACCTATCAGTCGGTGGTCTTCCAGATACGGG ACCTGATTTTGGTAATTTTATCCTCTAAACGTTCGACGAATTCCGCCATA CTGTTCGTAAGAGGTTGATGTATGACAGAAATTTTTCCCGACTCTTTAAA ACCCGACTTTTTCTTTCCCGATAAGGTATGATGCAACAGAATTTTATCAC TGATATGGGGATCCCAACAAGTGGCTTTCAGGTACCTAATAAACAACCTC CCCCCGCTTGTTAATTCTCAATTTTTTTTCAACCTCCGGACCTTATTAAA TTCATTAATTTTTGAAAAGAAGAGTTATTTTCTCTAAATAGCTAGGTTTT TTCACTCTATGGTATAGTTAACTTATTTTGGGGACATTTAGAAGAACAGT TTCCAACCTCCCCTTCCCCGATAATTAGGTCCCCCCCGTTTATTTAAAAT TTGAAGATTCTCCAATCATCTCGTTTGTTTATTCTACGACCACCCGACCA CCTGACAGTAGAGCAGATCATTAAGTTCTTCTATTGCTAGTTTATCCTTT TGAGATGATCGTCACATGATGGTGGTAAAACAATACAAAGTAAGTGCTTG TAGTGTTTGTTTGTTCTTATAAAAAAGTCTTCATGTCTTCTTTTGCTCCA TAACTTGATTCCAAAGAAGGCAGGGCCTAAAAATGAGATCAGAAAAACGA TTAATTAATATCTTTCTTTTAGTAAGAACTTTTCCATAATATGCTATCAA TCAATGAGAAGATCAAATATAAACAATTAAAGATGTTAAAGTTGAAAGCC AGAGTGTCCAGTATTCCCAAATGGACTTTCAGAGAAATTAATTACAGTAA TTAAAAATGAAAAACTCGAAAATGACATAGCAGTAACAGGAAAATTGTAA ATTCCAATACGCGATGTAGATTTTCAAGATAACATAAATTTTTTTTNAAC AGGAAAATTGTAAATTCCAATACGCGATGTAGATTTTCAAGATAACATAA TTTTTATTTCCAATCTCGCAAAAAAAATTTTCTTCACTTAAGTCCGGCTT ACGTTTTGTAGTATTTTCGCCGCGCGGTTTAATCTACTCATTACAAAGGC CTTGACAGGAAAAGGGTTCTTTTGATTCCAAGAATAGATATATAAAGCAT TTTTCCTTTTGGTATCCCTCATCTCCTTGTTTCTTCACCGGAGCAATACA AAAAATTATTTAAGAATAAGATTAATCCCCTGAAATCTTCATTTTTCGAA TTCTTCAATATCTTCACCCCTTGCAACTACAACTGGTTTTATTTACCCGA TGCATTTGCGAAGGGTATTACGTCACTTTCGTTTTCTACCCGTTGCATTT GCAACCGATCGCATTCGCGAATAACCCCGTGCAATTGCAAGGATGTGCCA GACTGACTGGACATCCGACTTCCTTAAGTCCGGTGTAGAAATTGTCCGGT GGTAAAAAAAATTCTCATTTTACACCGGACTTTCGTGTGTCCGGTGTTCG TTAAGTCCGGTGCGTCGGCAGGGTCCTGATCTTTCAAATTCCAGTATGTG AATAAAGCAGTAAAAAATACAACTTTTCCATTTTTCCTTTTTTTTGCAAA AGTTATAGAAATGAAAATAAAGGGATAATGATAATTGAATACTATTCACT GATGATCCGCGGCACTATCGTAAAGCTAGAATCGCTTTGCGTCTTTTGTG CTTGAGAATGTGATTGACAGATTAAAGTTTTTCACCCGCGCGGGAGCTGG CGGGCGTTCTGCGAGTGTTCTCGGCTCAATCCTTGGACCGAGCGCTAAAA TGGTAGACATAGCCGTGGCAGATCATTTCGATGGAAGTTGTTGGTAGTTT ACAAGGCTCTTGGCAGAGTATCGTTTGTTTGATTGTCAATGATGACAGTG CCGTTATTAATTTTGTTAGATCTGACAAATTGATGTTTGTAAGTGCATTT TATAGTTTTGATTCCCATCGAAAAACCATATTTTGGTTTTCATGTTATTA GATGCTGTTTTAGAGCTTTAGAACTAGCCTGTTTTTCGCTTTTAATTCGC CATGTTGAATGGGCCGGTTTTTGTTATAGTCAACCCCCCTCCCCCTGTGG ACGACATGGATTTTCCATAACAATTTAGTTCTGAAAAACTTCAAGATTTC CGTAACATTCAAGAATTTTTAAAGAAAAATCTTGGATTTTCCAATACAAC GAGAAATTAGAGCAAATTTTATGTGGATTTCTGAGAAAAAAATAGAACAG ATCATAAAATCAGATTTCCTGTAAAAATATCTGTTCTTATTTGCCAGCTG GAAATATTTCAATCCTAGAACAGATCATAAAAATTAGTTTTCTTGAAAAT ATCTGTTCTTACTTACCCGCTGGAAATATTTTCAATGTTAGAACAGATCC CTAATTTCCAGCTGGAAACCTTTAGAACAGAAAGAAAGGAGTGAGTGCTT ACGATGCAGAACTTATTAGAACAGATAACGAATTTCCAGCTGGAAAACTT ATAAAACAGATTAAATCGATGACCAAAGCGGGCAGCGGGGACAAGGTTTA GAACAGATAGTATTTTCCAAGCTGGACCAAAATTGGGAAGCATATATTTT AGGGAAAAGATCAGCCATAATTTTTGCTTAGAACTGATCAAAAATTTCCA GGTGGCAGATTTTTATGTAAGAGCAGATAAATAATTTCCAGTTAGACAAC TTTCCCGCTTTCTTAGAACAGATTGCTATTTCTAGCTGGAACATGCCTTT AGAACAGATATTTTGAAGAAACCCTTTGGTGGCTGCTTTCGATTCTAGTT CTATCTTAGTTATAACTAAGGGAAACTCAAACATAAAATCCCAAACAACA CCCCGGGAAAGGTGTATTTGAATGACTTCACAAGCGAAGTAGTGCATTCC TTTACATACGGAAAAACAGCCAATGAGGTAGCCAATTGCTGATTATAGGT GATTATGGGTGGTAATGGGTTATTATGGATGATTATGGATGATTATGTAA ATAGATATACCCTCAAGGGTGATAAAAGAGAAAGATCATATATTATTATT ATTATAATAATAAATCATATTCCGCGGAATAGCTATTCCGGCCTATTCCG GCTGGAACAGCTATTCCGGTTCCGGCATTCCGTCATTCAGCATTTTGTCT ATGGCCATTTTTTGTAACCTTTTCCAAAATTTCTTAGGATTTCAAAGTGA AAAAAAATTCCAAAAAACCCTGTTGTCCACAGGGGGTAATAGACCTTTTC TCTTTTCCATCCATCCGCCATACCGTAACTAACTCTGACACCCTTTTTAT CGGCTGAAATTGATAGAAAAGTGATGGCGCTTGAATGGCTAGAATAATTT AATATGCTGAACTGAGTCAATAGGTTATAGCGTTCTCCCACTCAAGATTT CAAGGATTCTGATAAAAATGAAACACCAGAATATTGATATTGTTGTAACA AATCCTGAACTAAAAGACTGATAAGTTTATTAAATAATCAATTGTTGAAA TTAATAATGCAAACATGTTATACTTTAGATCCTCTACAACTAGAGAAGAC AGCGTATGAAGCAGGCTTCCGCAATGATGATGATTCGGACAAAGAAAATT ATCCGTCCAGAATTCCTTTTGAACAAAATGAGCAAAAACAATCACCAAGA AATGTTACAAGAAGGAAAGACAAACCCAAACCAAAACCAGCCCAAACAGT GAATCTAGGCGAATTCATTAAAAAGGTATCTAATAAAATTAGTTTGCACA TTCTTCCCGCCCATGCTTTTTTATCAATTTTCTTTAATATAATGTTACAC ATCCATTTGAAAACTTTCCCTCCTGTATTATTGCTGGCACCTCCCGTTTA AACGTTATACAAGGCCGTTATACAACCTTATATAAGGCCCTTTTAACTTA CGCTCTTCTACCAAAATGATTTAACTGATATGTTTAAAACAGGAATGTTT ATTTTATTTTGTCATTATAGTATTAAAGTTTACCTCGGTTTCTTTTGATT TTAGGTTGACATTGATGGCCTCAAACTCACCATTCAATCCATTCAAGAAA AATTCAATAATCATCCTTTGGTAAAGTTTTTAACAATAAGTGAAAATTAT CATTCTTAATCTAAAGCAAAATCATTTTAAAGTTTACCAATTGCGTTCTG ATAGTTTTATCTTTGATAAAAAATTCAGTTGAAAGCAATCAAACTATAAA ACTTCATTCAAAACCAACACACTCTAGTAAAATAAAAAAATACAAATTTT AATAAACAATAATTTTTCTTGTTTGGTTTAGATTTGGTTGAAGGAAGTTG CAGCTTGGCTCAAATCTCAAATCAAGGGACCTGCTGAGAAAACTGACCTA GCTTTTTTGAAACACGAAACAGGTTAATTTGTATTGTGGTTTCCTCTTAT TTAATTTGACTTTTATAAAGTCAGGTCCATTTAGTTGTGATAAACAGGGA TTTTTTTTCTTTTTTTTCTTTTTCTGTTTACCCAGCATTGCCCTTTTCAA ATACCTATCAATGCTTTTAAAAGCACGTTGAGGCTGATTTTATCAGTTAG GAATGCAGCATTTGCTGAAATTGTTGAATTGATCCCCCATTACACAGATA CAGTTATTTTGATGTCTTTCCTTCCTGGTAGTCTTTTCAGGCTTTATTTA TACTCTTTGGGTCCAAACTGATTTGGGGAAATTCAAGTGTCAGGCCATCA TGATATTGGCCCTGGAAGATTTTGTGCTTTAATTAAATTGTAAGACTGTT TTTACTGTTTTTGTTCTGATGTTTTTATATAATAACACTTATTTCTTCTC CACTGAATAAAATGATTTCCATTATATATCTTTAGATTTTCCGGTATCAG AGCTTGACAAAGCAGTTCACAAACTTCTGGAGGACTTGATGAAAAAATGT GATAAGAAGAATCTTGCAACATTTTATATTTCACTTATTGCTGGCATGGT CACTGATATTCAACAAGGTAACAACAACAGGAGTTTCTGGTTTTTCTTGT GCACAGCAAGTGTTTTGGCCTAAATTAGAAAAAAAAATTTATGGCCACTT TCATACTATTGATTTTATACACTAGATCATTATCTGGTATTTTCAAAACA ATCAATCTTATGTAAAATTATTCTTTTGGTAGGAAATTCAACCTTAGCTG ACCGAATCATGATTCAATTACTGTGTCAACTTGAACCAACCGTCATAAAA GAAAATTGTAATGAAATTGTTGCCGCTAAATCAAAAACAGCTGAAACCTA CATTGCTGTCATGTGGGCTCTTGGCCAACCTGTAGGCACACTTGAAAATC GACTATCTGGTACTTTGTTTTATCACCTTCTATTTATTCTTTAAAGATAT TCTGTATCATATTTGTGTTGTGCTTATCACTCTAAAGGGTGTTTATAAAG GGACCAAATATTATTCAGGTTTTGATATTATCGATTATGTGTCTTTAACA AAGCTAGTTTGGTTGAAATGAAAAAAGCTTCCTTTGCTCCTCAATTGCAA ATGAGAAAGATACATTTTGTGTAATGCTCGTTTTCTTAGTTGAAATATGA TTTTACCATAATTTTGTTCTCTATAGTCTGGTGGTCGTCTATGTTTGCTG TGTTAGACAAGAAGAGACATGCTGTGGCGGCTGTCCACTATTTGAAAGAA ATACTAAGGTATTCCATGTACTTGTTTTTTGTTAAGATTATTCATTTCAA ATAAGTGGTCAAGTGNAATGTTCTTGTTTTTTGTTAAGATTATTCATTTC AAATAAGTGGTCAAGTGCCTGAAATCAATGTAAAAAAAAAATTTGACGAT GTTTGTTACACTTATTTGACTATTATTAATAAGCTACTAGAAATTCTGTC CTTTGAGGATTTAAGGTAAAGAATTGGAATTTTTAGACAACGACTTTTAG ACAACCTAATTTTATGAAAACAGTAGTAAAAATATTACCTTTACATCGTG TTTTTTTTACATATTGGTTATATTTCGCAAGGCTAGCTTAACGTTAACTA AAATGTCAACCAAATTGATTTTTTTAGCGAACTGGAAGATAAACCTATAC AAAAACCAATGTTAGATACAGAATCGTTTCTTCAATTATATAATGTTATC TTTGGCAAGTCACCTTTACAACACACATCAAGGTAAACTCTATATTCGTT TTGAAGTTGACTAAAGAATTCCCTTTTTATCAAAAAGTTGATTCTTTTAA AATCTGATTGTTTAACTTATGATATCTTTTCCCTGCAAATTTGTACATAA CACTGCTTAACCTTATTTTTATTGTCCATGGACAGTGGGAGACTAATTTA TGTATATGCGTCCTTTGCAGGACGTTCCACAATTGGTCATCCTTTTTAAA CTAGTTAAACATCTCTCGACATCTTATACACCTTTTCGATCGTAGTCTCC AATTGTGCGGTGCGGGCATTTTTTTGTCCGTTTTTACCACCTTAAAACCG TCCCAATGTTTTTTTTCGCACCTATAGACAATAGAAAAAGGTGTAAAGAA GGATTGGATCGAGTTTAGGGGGGGGGGTAATTAAATGATAAAGTGGCAAG CGCGACTATGGTCGAAAAGGTGTATTAGTTATCGCTCAAGTAACTTTTGT GTTCTTTTCCAATTTAGTTTGATTGACGAGTTGAAACCATTTGCTTCTTT GATGAAGGTGAGTTGGTTTATCACATTTCAAGACTTTCGTGAAGTCTTAA TTACCTTAGTTACCTCTTCATGTTTCAAAGTGGATGTCCTGGGTAAGAAC CTGGTAGTATTGATTATTACCCACATACATTTTAATTCAATGACTGCCAG AACATATAAATCGAACGGAATTGACTGAATGATTTATTTTTATTTATTTT ACATATATATCTGTCTTCAATTTATACAAATTATTTTTCCGCCTAAACTT AACCTTTCCACCCCGCTGTTTTTTATATTTTTACGCTGTCCCCCGCAACA TTTTTTGACAAAATGGATATGTTCGGTTATTTTGTCATAACTCAAGAACT AGAAATCTTTTGATAAAAAATTAGCTATCCCTGAAAAGCTAATTAAATTC CGCAGCTTTTAGGTTGGGTATCAATCCAAATAAAATACTCTAGCTAAAAT GGTAGCTCCACATTTACCAAAGTTTTTTTTTTTTGAGACAACTCACTTCT CTAAAATTTCTCTCTGAATTTCTTTTTACATTCTTTCAGAGGATGCTATT AGCCGATAAACCTTGCAAAGAAAGGAAGAACATTTTCATGCAACTTCTTG ATGAACTTAAAAATATGGAAGAAGGACGAGAGAGAAATATGGTAAGATTG TATTCCTTTTTTCACCCTCTTTGCCAAAGAAAACAAAGTATCCAATCTGG CAGCAANTATGGTAAGATTGTATTCCTTTTTCACCCTCTTTGCCAAAGAA AACAAAGTATCCAATCTGGCAGCAATGAAATTATAACCTGGTAGCCTTTC TTTCTTCAACTTTCATCGGGCTGACAGCAAATTTATACCCAGTCTTTTTT TTTTCCATTGAAAAACAAACAAAAAATCATGAAGAAGAAAGTGAGGGATT TATTTCAAAACTTGGACGTATTTTACGATTTGTGGATTGTTAATAATTTT ATTGTTTAGTGTTTTCACTTGACTAGTATTTTGTGATCAAATTATGAACC CATTTTCCTTTTCTATTTCAAAATTCAACCAAAAAATAAACTTTTCGTGA ATCAAAATTCTGCACCAGACATTATATGTAAGGCGAAAATAAAAAATGTA GTGTTTCTGAAGTGCGGGTGAAGGAAAAAAGCTCTCATGAAGCCGGCNAA CCAAAAAATGAACTTTTCGTGAATCAAAATTCTGCACCAGACATTATATG TAAGGCGAAAATAAAAAATGTAGTGTTTCTGAAGTGCGGGTGAAGGAAAA AAGCTCTCATGAAGCCGGCCGGAAAAAAAACATTTTTTTGCTACTTTTGA TAACTTACTCATTGAAATAGAGCTTTGAAGATAACTTTTGTGTACAACCA GTATGAAGTAAGCCCTGAATACTAATGTATCAACTACTAACGAACAAAAC TTGATTTACAAGCGGTCAAAGACGTTTGATAGCTGGAACGGTCAACTTAA TTTTCTTTATGATGAACCATACGATGAACCCATAGTCTGCGGCCAGGTCA GAAAAAAAAATATTTTCACCCGGCCGGTTTCCGGAAACACTACATTTTTT ATTGTCGCCTAATCGTGAAATAAATGAAATTAGATACCGGGTGCGCTACA AAAAAGTTTCTCTTTAAAACAAATTTTCCCGAAATCTAAAAATTAAAAAA AAAAAAATTCTATTTCATTGGAAAGAAGAAAGATAAACTTAAATTTTGAT GGTGGGTCATTTATTATATTCGGTTCATTAGATCGAAAGTTATGCACTAT TGAATAAAAAAGTCGCTTTCTGAAAGTGCTAAAAAACGTTAAAAAATCGA CCTATCAAATTAAACAGAAGCATAATTATTACATGATGCATAAGTAATTT CGTTTCAGTCATTAAAAATAATAATTAGCTGTGTAAATGACCATTTGTTG TATAAAGGAAGATTGAATTTTCAATAAAAGGCAGAAAATTCGTCGAAAAA AGCCAAAAAATCTGGTAAAAATCATAAAAATACATCAAATATAAGTTTCG AAGTACATCCAGCCTTACATAGACTTTATCCAGTCTAGAGCCAAAAATCT GGAGGAAAATTTCGTTCAAAGTAAATTGAAATGATTTTGATGAACGTTTC AAACCCTTTCGTTCCATCAGTTTCATAATTTATGTGTTTAATTACTGAAA AATGGTCTCAATCATGCCTCTTGCAATTGCCAATTTTAGAATTAAAATTT GATAGGTCAATTTTTATCGTTTTCGGGCACTTTCTGAAAGTAACTTTTTT ATTCGATTGAGCATAACTTTTGATCTAATGAATCGAATTTAATAAATGAC CCATAAAAATTTAAGTTTATCTATCTTCTTTCTGATGGAATAGGAATGGT TGTTTCTTAATTCTTAGATTTCGAGAAAATTAGTTTCAAAGAGAGAAACT CTTTTGTGGCGCACCCGGTAGAAAGTCAATTGGCGCGCAAGAAGCATGAA AAGAAGGTCGATTCAAACAAAGAAAGTGTAAAAAATTACTAAGCATCGTT CATTTTAACCCAACTTCCATTAACACATATTTTATTGGGTTTCAAGTTTG AATAAAAAGATTCTAAATGGATTTTTGGTTTATTGGAACATCTCATTTCC ATGCCCAAGAACATGCATTTTTTCAGTGGAAAAATATCCGCGATTCTCAA TTCATGGTACCCTTCAGAAGGATCAATGAGCATTCCATCTCTTAAAGTGT AATCATAGATATCGACATGCGTTCCAAATCTCATGAGACGACCCAAAGGT TCTATAAAACTACATTGGTCTTTATGACTGATTGTTTTTTGTCCATTGCA TAAGTACCGACCACGCCCTTCATATGGTTGTTGCCAATCACGCTGCAGAT ATAAATGATATTTACCATCATGGTTGTTGAAGTTCATATTCTTTTCCTGG ATTCTATCCAATTTCCAATGGTCTTTAGCACTAATCAAAACATCTAAATC AGCATCTAGCGGTACTAGATCTCCTGTCCGCCAAGCGCCCAGTAACGTTC CACATGTTAGCGAATAAGTGATGTTGTTCTTCTTAGCTATGCTGTCCCAT CTCTGTAATATATTTTTCAATTTCCAACGGTATTTATTCTTAGGACAAGT GTTATCTCCGTAATAAGAGTAGTTTTGGGACTCAAAAGTGTTTATCCACT CATCAACTTTTAGGGAGGGAACCACATAGTTTTGAAGTAGTAAATCTTTG TATTGGTGCTCTAAAAATTCTTTTGATAAAAGTCTACGTGCCAACGTCCT GGGCTCTAAGATTTGTTGAAAGTCTACTGATGATATAAAGTAAATAGCTA ATGCTCCGATGATTAAAATACAAGTTATTCTCTTGATAGTTCCCATTCGA AATCTTGTTTTGGAAATTTTTCACCTAGAGACAAACGAAATATGTATTAT GATAAATATGTATTTTGACATTTTTTCAAAATCAAGAATTTAAACTAAAA ACAAACTATAAGAAAGTGTTCTAATCTCAACTCAACACATAACAATCAAA AACCTTTTTGAACACTTAACTTTTGTTTGTAGCCCACAAAATAATAATAA TTATTACTATGTTGAATTTCAAGTCACCACCAAAAGGAATTAAAGGCTAA GACAATCTCACTCTTACTCAATCTTTATATACTATAACACAATATTCTGA TGCGGCTTTTGAAAACTTTTGCTAACTCACGATTTTGTTTTGTTTGATCC GAGATCTGTTTGTTCACTTGTTTTTCAGTGGTTGCTACGCTGAAACAAAA TCTTCATAATTGAGCATGATTTTTGACAGAGACGCTTTCCACGCAGTACA TATTGTGTAGAGGGGTTGAAGATCGTACACAAATTTCTAGGTCTCACTAC TATTCATTCGAGAACCAACCTCGCCTGAAAGCTGACTAGCCTAGTAGTAG TACAATAAGAAATTCAACTTGTTGTTCGAGCTCTTTAGAAGCAAAATGAA AAATTAGCATAACAGAATGGAAAATTGAAACTAAGAAGCCGTAGAGAATA CCGTGATCGCTCCTTTGAAAGATCTCCAAAAGTTTCACCTAATTTTTCAC CCCTACTCTCAAAGTCAAAATTTAAAGTGTTCACCTAGCATTCTTTGGCT CGAAAATCCGAACCCCTCTGCAAAATGGGGAAAATGCACAAACTAGACTA TGTACCATGCTTTCTGTTCAAAACTTCCTGAAGTTTACCATTCTCGCCCC TCCATTCAATGACTTACCGATCTCTCTTTTTATCTCTGGTTGATCACAGA ATTTGATTGTTTTAAAAAATTTAAATTTTCAAAAATTTGACTCAGACTTA AAGTAAGAACAGCGCCGAAAAACGGATTTCAGTAGTCAAGAATAATCACA AAAACCACCATAACCTTGCATGGAATAATGACCCTTGAATGTTTATCCCT TACTTGATCTCTTCTATCCCTTCAGATTTGCGATGTATTGAGTGATTGTT TGGTGTCCAACCCAGATCTCTTGGAATGGTGGAGTGAAAACATCTTGGCT TATCTCCGACAATCAAGGTACATTCTCGAATCCCAGAGTTTTCAATCATT CTTTTTTGAAATTAATGAGTTATTTTACAGATATCATTTAACCTTCTTTC ATTAAAATTTTTAATTTAAATTCAAATACAGAAAACTGCTGCTATTAACT GTAAAATAAAATTATGAGTACCTCTGAATAGTATAATGTTAGCGGTTCTA ACGTAATCAAACTAAATCTAAACCATGCATTTCAGAAAATACTTTGAACA AACTACTCGAGAATTTTTGTAAAACAGGTTGCCTTTTCTTTTTTTCTTAT CTTAGTGTTTTGCTGAAATATATCGAAGAAACAGATGTGGCTGAAAGGGT AAGAACGAAAAAAAGTTAAATATTTCTGTATGTATCAGTATATATAGTTC ATTTGAAACACATGTTCTGTTTGATTCGGTCTTGACTAGTCTTGACTTGA TTCGTTTGGACCGAGAAATAGCCTAAAGGATATTCAAGTTTTTATATGTC AAAAAAGATGTCAACTCTCTTTGTATCTTATTGTCAGGGAGGGTCCTTTT GCAACTTGTGACCTGGAAAAGGTCCATAAGCGTTTTATGGCCCTCCACCG CTTAATGACTTTTCGCTGTTTGTCTAAAAAGTAAAAAGGGGAAAAAAGAC CATCATTTTTCCAATCACAAAATCTTCGAGTTAGCAGGGGATTGGGTGAA AGTTTATCAGAGTCGAATGACGTTATGGTGTCTGAAAACATTGTATTTAC GTGATACAGATATTGTTCGATCCTGGTAAATAAGCCAATACCTTCATGTT GCTAGGCTACTAAGTGTTTGATTCTTTTAAGCTGAATTCAGAGATTCAAT TTATACAGTGGAGTCCCCATAACTCGAACAAGGATGGGGAACACAAATTT GTTCGTGTTTTTAAGGTAAACTGGTTTATAAGGCATTGTTAACTAAGGGA CCATAAAACTTGTTCGAGTTAAGAAGACATTCGAGTTATAGAGATTCGAG TTATAGAGATTCGAGTTAAAGAGATTCGAGTTAAAGAGACTCTACTTAAT TTATATTTTCTAGATGAGAAAAGGCCGCCGTCACAAAACATCAAGACCCA TGGTCACTGCTGCACAAACTATGATCGGTAAAATGTTAAAAGTGAAAGAT CGCTCACGTTTCGATAAAAAGGTGAGTAATTAAATCGCTGAAACTAGTAT GCTGAATTAGTCCGAAAAAGGCCATCATTTCCGCTAATTCGCATTCTCTT GGCTCTTGTTTATCATATATTGAAATTGCTGACAATTTTTCGGAAAATAC CTCATTTCGGAGGTCGTTTTTTTAGCATCTATTCAAAATTAGGTTCCTGC CATTTTCAGTGTACGTTTCTATTCTAAAGTTTTTGATATGCTTACTTTTC ATTTTTAGCCTGGTTTCCGTGAATGCCGCAAAATTTGTAACGTAAGCTAG CTCATTTTCTTTCGTACGATCTTTCTAGAGTAGATTCTCTTAACATGTGA TTTTTCTAGTGATGAGGGCGAAAAAGTGCCTACTTCGCAACATTAAAAAA GAACGACAAATTTCAAAAATAACGACAAATTTCGCCAACCACAACCCCGA CCGAAAGTGACCGTATCACCCCTTCGTATTCATTCCTCTTTGTGTTTTGC GTATAATAACTACTAAAAGTTTATAAAATGAAAATATACGCATGTGTTTT TACTTTGTTTTGAAAATGAAACAATAGATGCAAAGTAGACACTTTCTCTA TGTGTAATGGCTAGTGTCAGAAATCGTTAACTTCGATAAAATCTTAAGAA ATTATTACCTCTTAAAATCCAAATTGAAATTAATTCGCTTAGACCCGAGT CGTTTAAAATAAGCGTTATATAGTAACACCGTTATATATTATAATTGCCA TGGGTTAATGATTATTAGGTGGTATAATTCATACCATGCTAATGCCCTTC AGATTCTTCATCAGTTGTTTAACCATTATATACCAATCTTCTCAACAGTA TTTCATCAATGAAGAGATGGAACGTCGTCAACAAACATCTTCCGTCTGGA AACTTTTGAAATACTTCTTCATTTTCACCACCATCTTCGTCGCTGTTGAT CTTTACACCAATAAAGGATATCCAGGTAACGCAACTAAAACATGATAAAG ACTAAAGGATTTATTAAAGATTTGCGTGATTGCGTGAATTGAAGGTCCGC TGGGAGGGCCTCATTGGAGGTTTATTCGACTTGTTACGCCAAATTTATAT GACAAAATAAGAATAGTTTAATCATTTAGGACAATACTATAATAATATCT GAGTAAATTATTCAGCCAAACAACTAGATTGTCATTTTTCAATATTTCAA TTCTCCATCCCATCCAAATGGTCTATTTTTGTGACTTTTATAGGAAGTCG AACCAATGTATTTTTAAAGAAATATGGACTTGAAGAAAGACTAATGACTG GTTATAATTTTGCTGATCAGAAGAGAATGCAAGCCCAAAGGTAAATCCTT TTCTCCTTTTTCGTGACATCTAGGAATCCCTTTGTGCAGCCCAATTTCTT CTACATTTTTACGTTATTTTTTGAGTTGTGAAACCAAGGACTCGGGACCA TTAACTCTAAAATCTTACAAACCGTGATAAGTCGTTGACTTCATATATTC TTTGACAGTTTCTTTTTTCAAAGTGAAACCAGAATTTGAACCGAATATTA GTTTAAAAATAAATAAAGTACAAATATCGTAATTCTTTATAGCTTCATCA CTACAAATGCACCGATTTATTACGCCAAAGTTTCTCCCTATGTTGACCCT GTAATGGAAAAGACTGGTTACTACACTCGAATCACGTGCGAAGCCATCTA TAAACACAGCAAACCTGTACGCGACTTTGCTAATACTCGTATCCCACCAC TGCTCGAAAAGGTTTGTGCGGAATGGTTTGTGGCGGATTTCGTCCGTCGA GAATCATTGTTTTGTGTACCGATTATCATTTAAAATACAGCTTTTTTGTA ATCTCGAGCAACTTTCTGGTGCAATTCTTTTTACTTATATTATTCTGGTT TTTCATAAATGCTTGCAACGATAATCAGTTGACTTTTACTTTTACTTATT ACTGATTAACTCTGTTCTCCCCGTAACTCAGCTGAATGGTTTTTCTTATT TCTACCTTGCTCTTCTCTATTCTTCTTTTTGACAGTCAACCGTCAACCAT CTTGATTTCTCCTTACATTCGAATGATCATAATGTGTGGTTGAAACAACT TAATGTATATTTATTCATTTTAGATCACGTATTTCTTGAAACGTCAATAC GACATTATTTCATCTTACATATTGGGTCTGTACCAAACCTACGCACCAAT TGTCCAAGAAAATGTCACCCANATTGAAACAACTTTATGTATATTTATTC ATTTTAGATCACGTATTTCTTGAAACGTCAATACGACATTATTTCATCTT ACATATTGGGTCTGTACCAAACCTACGCACCAATTGTCCAAGAAAATGTC ACCCAATTCTACAACTGGTTACAAGTCTCCATCCCCAAAGCTTACAAGTT TATCTTGACAAATCTCATGGAACTCAAGAAGACCATCTACAATTTAAACC CTGCCATGTTCGATAAAGCTGCAATCGTTTTGAATGATGCAATCGATTAC GTCATCAAAATGGTACCCATCGTTGTGGAGAGATGTATGGCCACTTTGAA TCTGGTGTTGGAATACATTCGAACTTATTTCGCTCAAGGACAAGGATGGA TGCAACAACAATTCGGAAGGTAATACTTGAAAGAGCTTTTGCCGACTCAT CAGTAGATCTTGAAGAATAAAAGATGTATTGTTAGCATTTTGAAAGTAAA ACAAGCAAGGTAATGACTCAAAGTATTGAATGTTTTGCAGATCTCAATTC GATTTTGAAAGTGAGAGATTCTAATCATGAATAAGGTTTTGTAAGATTAA CCTAACATAGTTGCCATTATTTTAGCGCGTATTGTTGAGGGAATTAAATA ATGAGTTAACTCTTGTTAATTCAAATTCGAATGGGGAATTTGATTTGTTC GATTTACAGGGAGATTCGAAACAAGTTCGAATTATGGAAAGATTAGAAAA ATACGAGTTAGAATAAGCGAGAGTTTGCTGTGTACATAATAATCGTATTA AAGAGAGTTGACGACTCTTGACAGCTGACAATACCTCACAGGATAACATT GGCAAAAGTAAACTTAACCCCCATTTAAACGGGAACAAATTAAAAATTGT GACTTTCGACGATACGCGTGGAAAATTAGAGGGGCTGAGAATTTGAAATA TTTTAAAGTTCTATTGTTTACAAAGGTAAAAATTAGATGAAAGTTAATCG TTTTGAATTATTTGTATTAATAAATAGAGAATTTTCAAGTATAATTATTG CTGACTTTTTTAATTTTTTTTGACTCGCTTCAACTATAATAGTGCGCACG CATTAATTGGGCGCTCTATGGTCCTTCAAATATAGTAGATCAAGAGGTTT AAAAACGACTTAAAATTAGCGTTTTTTTCTTTGGTAGTTCAAAAGAAGCC AAGAAAACGTAAAGTTTGGCCTCCCATCCTTCCTGCGACGGTTTTGGGAA AATGTAAGATGTTCTTTTATTCTAGTTCTTAGATATTTAGACGTAGTACA TTAGAATATTTCAAAGAGTAAGGGGTGTTTTGTTAAAAAATGACGTAAAA GATTATTGTTTTCTTTTTAGGGTTTCTCCTGCAGCGAAGTGAATGGTTCA AATTGATGAAGTTTTTTAATGAATTTGATTATTCCCACATGGCATCGGCA CCACATTGAGAAGGGATAACTTTTTAAAAATAGTTCATGTTTTTTTTTAA TAACAATAGAGCGCACGTATTTCTAGGCGGTTTTAGGGGTTTAAAAATGT AGAATTTTCTATGGCATTGAAATTTTGCTCGAAAATTTGTTCAAAATTTT ACCTTAAAATACTAATAATTATTGAATCTTAAAATTTTTTGATATTTATA AATTTTTGAAGCTGTGAAAAAAAAAGATATTTTTCAAAATAATTTGAAAT ATTTTTCGATT
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_001015XLOC_001015Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001972-exon-sc0000012-1575043694:1045376..1045747TCONS_00001972-exon-sc0000012-1575043694:1045376..1045747Clytia hemisphaericaexon
TCONS_00001972-exon-sc0000012-1575043694:1039573..1039769TCONS_00001972-exon-sc0000012-1575043694:1039573..1039769Clytia hemisphaericaexon
TCONS_00001972-exon-sc0000012-1575043694:1039228..1039293TCONS_00001972-exon-sc0000012-1575043694:1039228..1039293Clytia hemisphaericaexon
TCONS_00001972-exon-sc0000012-1575043694:1038926..1039016TCONS_00001972-exon-sc0000012-1575043694:1038926..1039016Clytia hemisphaericaexon
TCONS_00001972-exon-sc0000012-1575043694:1038331..1038462TCONS_00001972-exon-sc0000012-1575043694:1038331..1038462Clytia hemisphaericaexon
TCONS_00001972-exon-sc0000012-1575043694:1037989..1038165TCONS_00001972-exon-sc0000012-1575043694:1037989..1038165Clytia hemisphaericaexon
TCONS_00001972-exon-sc0000012-1575043694:1037640..1037721TCONS_00001972-exon-sc0000012-1575043694:1037640..1037721Clytia hemisphaericaexon
TCONS_00001972-exon-sc0000012-1575043694:1037166..1037270TCONS_00001972-exon-sc0000012-1575043694:1037166..1037270Clytia hemisphaericaexon
TCONS_00001972-exon-sc0000012-1575043694:1036641..1036680TCONS_00001972-exon-sc0000012-1575043694:1036641..1036680Clytia hemisphaericaexon
TCONS_00001972-exon-sc0000012-1575043694:1036007..1036108TCONS_00001972-exon-sc0000012-1575043694:1036007..1036108Clytia hemisphaericaexon
TCONS_00001972-exon-sc0000012-1575043694:1032131..1032222TCONS_00001972-exon-sc0000012-1575043694:1032131..1032222Clytia hemisphaericaexon
TCONS_00001972-exon-sc0000012-1575043694:1031800..1031842TCONS_00001972-exon-sc0000012-1575043694:1031800..1031842Clytia hemisphaericaexon
TCONS_00001972-exon-sc0000012-1575043694:1030977..1031084TCONS_00001972-exon-sc0000012-1575043694:1030977..1031084Clytia hemisphaericaexon
TCONS_00001972-exon-sc0000012-1575043694:1030707..1030739TCONS_00001972-exon-sc0000012-1575043694:1030707..1030739Clytia hemisphaericaexon
TCONS_00001972-exon-sc0000012-1575043694:1030023..1030149TCONS_00001972-exon-sc0000012-1575043694:1030023..1030149Clytia hemisphaericaexon
TCONS_00001972-exon-sc0000012-1575043694:1029658..1029754TCONS_00001972-exon-sc0000012-1575043694:1029658..1029754Clytia hemisphaericaexon
TCONS_00001972-exon-sc0000012-1575043694:1029237..1029405TCONS_00001972-exon-sc0000012-1575043694:1029237..1029405Clytia hemisphaericaexon
TCONS_00001972-exon-sc0000012-1575043694:1028379..1028874TCONS_00001972-exon-sc0000012-1575043694:1028379..1028874Clytia hemisphaericaexon
TCONS_00001972-exon-sc0000012-1575043694:1027087..1027427TCONS_00001972-exon-sc0000012-1575043694:1027087..1027427Clytia hemisphaericaexon
TCONS_00001972-exon-sc0000012-1510915933:1045376..1045747TCONS_00001972-exon-sc0000012-1510915933:1045376..1045747Clytia hemisphaericaexon
TCONS_00001972-exon-sc0000012-1510915933:1039573..1039769TCONS_00001972-exon-sc0000012-1510915933:1039573..1039769Clytia hemisphaericaexon
TCONS_00001972-exon-sc0000012-1510915933:1039228..1039293TCONS_00001972-exon-sc0000012-1510915933:1039228..1039293Clytia hemisphaericaexon
TCONS_00001972-exon-sc0000012-1510915933:1038926..1039016TCONS_00001972-exon-sc0000012-1510915933:1038926..1039016Clytia hemisphaericaexon
TCONS_00001972-exon-sc0000012-1510915933:1038331..1038462TCONS_00001972-exon-sc0000012-1510915933:1038331..1038462Clytia hemisphaericaexon
TCONS_00001972-exon-sc0000012-1510915933:1037989..1038165TCONS_00001972-exon-sc0000012-1510915933:1037989..1038165Clytia hemisphaericaexon
TCONS_00001972-exon-sc0000012-1510915933:1037640..1037721TCONS_00001972-exon-sc0000012-1510915933:1037640..1037721Clytia hemisphaericaexon
TCONS_00001972-exon-sc0000012-1510915933:1037166..1037270TCONS_00001972-exon-sc0000012-1510915933:1037166..1037270Clytia hemisphaericaexon
TCONS_00001972-exon-sc0000012-1510915933:1036641..1036680TCONS_00001972-exon-sc0000012-1510915933:1036641..1036680Clytia hemisphaericaexon
TCONS_00001972-exon-sc0000012-1510915933:1036007..1036108TCONS_00001972-exon-sc0000012-1510915933:1036007..1036108Clytia hemisphaericaexon
TCONS_00001972-exon-sc0000012-1510915933:1032131..1032222TCONS_00001972-exon-sc0000012-1510915933:1032131..1032222Clytia hemisphaericaexon
TCONS_00001972-exon-sc0000012-1510915933:1031800..1031842TCONS_00001972-exon-sc0000012-1510915933:1031800..1031842Clytia hemisphaericaexon
TCONS_00001972-exon-sc0000012-1510915933:1030977..1031084TCONS_00001972-exon-sc0000012-1510915933:1030977..1031084Clytia hemisphaericaexon
TCONS_00001972-exon-sc0000012-1510915933:1030707..1030739TCONS_00001972-exon-sc0000012-1510915933:1030707..1030739Clytia hemisphaericaexon
TCONS_00001972-exon-sc0000012-1510915933:1030023..1030149TCONS_00001972-exon-sc0000012-1510915933:1030023..1030149Clytia hemisphaericaexon
TCONS_00001972-exon-sc0000012-1510915933:1029658..1029754TCONS_00001972-exon-sc0000012-1510915933:1029658..1029754Clytia hemisphaericaexon
TCONS_00001972-exon-sc0000012-1510915933:1029237..1029405TCONS_00001972-exon-sc0000012-1510915933:1029237..1029405Clytia hemisphaericaexon
TCONS_00001972-exon-sc0000012-1510915933:1028379..1028874TCONS_00001972-exon-sc0000012-1510915933:1028379..1028874Clytia hemisphaericaexon
TCONS_00001972-exon-sc0000012-1510915933:1027087..1027427TCONS_00001972-exon-sc0000012-1510915933:1027087..1027427Clytia hemisphaericaexon
TCONS_00001972-exon-sc0000012-1491911889:1045376..1045747TCONS_00001972-exon-sc0000012-1491911889:1045376..1045747Clytia hemisphaericaexon
TCONS_00001972-exon-sc0000012-1491911889:1039573..1039769TCONS_00001972-exon-sc0000012-1491911889:1039573..1039769Clytia hemisphaericaexon
TCONS_00001972-exon-sc0000012-1491911889:1039228..1039293TCONS_00001972-exon-sc0000012-1491911889:1039228..1039293Clytia hemisphaericaexon
TCONS_00001972-exon-sc0000012-1491911889:1038926..1039016TCONS_00001972-exon-sc0000012-1491911889:1038926..1039016Clytia hemisphaericaexon
TCONS_00001972-exon-sc0000012-1491911889:1038331..1038462TCONS_00001972-exon-sc0000012-1491911889:1038331..1038462Clytia hemisphaericaexon
TCONS_00001972-exon-sc0000012-1491911889:1037989..1038165TCONS_00001972-exon-sc0000012-1491911889:1037989..1038165Clytia hemisphaericaexon
TCONS_00001972-exon-sc0000012-1491911889:1037640..1037721TCONS_00001972-exon-sc0000012-1491911889:1037640..1037721Clytia hemisphaericaexon
TCONS_00001972-exon-sc0000012-1491911889:1037166..1037270TCONS_00001972-exon-sc0000012-1491911889:1037166..1037270Clytia hemisphaericaexon
TCONS_00001972-exon-sc0000012-1491911889:1036641..1036680TCONS_00001972-exon-sc0000012-1491911889:1036641..1036680Clytia hemisphaericaexon
TCONS_00001972-exon-sc0000012-1491911889:1036007..1036108TCONS_00001972-exon-sc0000012-1491911889:1036007..1036108Clytia hemisphaericaexon
TCONS_00001972-exon-sc0000012-1491911889:1032131..1032222TCONS_00001972-exon-sc0000012-1491911889:1032131..1032222Clytia hemisphaericaexon
TCONS_00001972-exon-sc0000012-1491911889:1031800..1031842TCONS_00001972-exon-sc0000012-1491911889:1031800..1031842Clytia hemisphaericaexon
TCONS_00001972-exon-sc0000012-1491911889:1030977..1031084TCONS_00001972-exon-sc0000012-1491911889:1030977..1031084Clytia hemisphaericaexon
TCONS_00001972-exon-sc0000012-1491911889:1030707..1030739TCONS_00001972-exon-sc0000012-1491911889:1030707..1030739Clytia hemisphaericaexon
TCONS_00001972-exon-sc0000012-1491911889:1030023..1030149TCONS_00001972-exon-sc0000012-1491911889:1030023..1030149Clytia hemisphaericaexon
TCONS_00001972-exon-sc0000012-1491911889:1029658..1029754TCONS_00001972-exon-sc0000012-1491911889:1029658..1029754Clytia hemisphaericaexon
TCONS_00001972-exon-sc0000012-1491911889:1029237..1029405TCONS_00001972-exon-sc0000012-1491911889:1029237..1029405Clytia hemisphaericaexon
TCONS_00001972-exon-sc0000012-1491911889:1028379..1028874TCONS_00001972-exon-sc0000012-1491911889:1028379..1028874Clytia hemisphaericaexon
TCONS_00001972-exon-sc0000012-1491911889:1027087..1027427TCONS_00001972-exon-sc0000012-1491911889:1027087..1027427Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000012supercontigsc0000012:1027087..1045747 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0 0.516364 0 0 0 0 0.68078 0 0.158227 0 0.167576 0.0979941 0 0 0 0 0.13658 0 0 0 0 0.264753 0 0 0 0 0 0 0 0.190346
Blast
BLAST of TCONS_00001972 vs. Swiss-Prot (Human)
Match: TM214 (Transmembrane protein 214 OS=Homo sapiens GN=TMEM214 PE=1 SV=2)

HSP 1 Score: 84.7297 bits (208), Expect = 1.100e-16
Identity = 117/548 (21.35%), Postives = 225/548 (41.06%), Query Frame = 3
Query:  378 LQLEKTAYEAGFRN--DDDSDKENYPSRIPFEQNEQKQSPRNVTRRKDKPKPKPAQTVNLGEFIKKVDIDGLKLTIQSIQEKFNNHPLIWLKEVAAWLKSQIKGPAEKTDLAFLKHETDFPVSELDKAVHKLLEDLMKKCDKKNLATFYISLIAGMVTDIQQ--GNSTLADRIMIQLLCQLEPTVIKENCN---EIVAAKSKTAETYIAVMWALGQP-VGTLENRLSVWWSSMFAVLDKKRHAVAAVHYLKEILSELEDKPIQKPMLDTESFLQLYNVIFGKSPLQH-TSSLIDELKPFASLMKRMLLADKPCKERKNIFMQLLDELKNMEEGRERNMICDVLSDCLVSNPDLLEWWSENILAYLRQSSVLLKYIEETDVAERMRKGRRHKTSRPMVTAAQTMIGKMLKVKDRSRFDKKPGFRECRKICNYFINEEMERRQQTSSVW-KLLKYFFIFTTIFVAVDLYTNKGYPGSRTNVFLKKYGL----EERLMTGYNFADQKRMQAQSFITTNAPIYYAKVSPYVDPVMEKTGYYTRITCEAIYKH 1979
            +Q   T YE GF N     + ++  P  +  ++   K+ P+ V    ++ + K  +  +L E +K +D+  L+  +   Q  F+ +P IWLK++A++L  +++ P  +  L+  +H  D+P S + + +  ++  L+ K    +L  F+   +  M+ ++ +  G S    RI IQ + Q +P +   N     E++ +        + +MWALGQ     L   L VW   M  VL  K  +  A+ YL  +L    +      M+  + F  L +  F   P    T SL ++L      +K +    KP       F   L           +  +   L++CL  +P     W +    +L QSS+           E++ K    K  + +    Q+     LK+ ++    K     +    C+      +++ Q     W +LL    +F   F+  DL ++  +  S T   L+  G     ++     Y+++    +Q  S++    P++ + +   V P ++    +T  T   +  H
Sbjct:   53 IQTTSTLYERGFENIMKRQNKEQVPPPAVEPKKPGNKKQPKKVATPPNQNQ-KQGRFRSLEEALKALDVADLQKELDKSQSVFSGNPSIWLKDLASYLNYKLQAPLSEPTLS--QHTHDYPYSLVSRELRGIIRGLLAKA-AGSLELFFDHCLFTMLQELDKTPGESLHGYRICIQAILQDKPKIATANLGKFLELLRSHQSRPAKCLTIMWALGQAGFANLTEGLKVWLGIMLPVLGIKSLSPFAITYLDRLLLMHPNLTKGFGMIGPKDFFPLLD--FAYMPNNSLTPSLQEQLCQLYPRLKVLAFGAKPDSTLHTYFPSFLSRATPSCPPEMKKELLSSLTECLTVDPLSASVWRQLYPKHLSQSSL--LLEHLLSSWEQIPK----KVQKSLQETIQS-----LKLTNQELLRKGSSNNQDVVTCDMACKGLLQQVQGPRLPWTRLLLLLLVFAVGFLCHDLRSHSSFQASLTGRLLRSSGFLPASQQACAKLYSYS----LQGYSWLGETLPLWGSHLLTVVRPSLQLAWAHTNATVSFLSAH 579          
The following BLAST results are available for this feature:
BLAST of TCONS_00001972 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
TM2141.100e-1621.35Transmembrane protein 214 OS=Homo sapiens GN=TMEM2... [more]
back to top