Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001946 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001946
Unique NameTCONS_00001946
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length3224

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001946 ID=TCONS_00001946|Name=TCONS_00001946|organism=Clytia hemisphaerica|type=transcript|length=3224bp
TACCGatgGGTTCATAACGCAAAGAGGATAAAGGCTCTTAGAGAAAGTCA
AAAATTAATTCAACTGAAGAACGCTCATAACCAGACATGCAGCAATGAGG
TTAAAGAGACATTGCTTTATATCAACAATGTCCTTGTCACAGACAAAAGC
AAGAATATAACTATGAAAGAGAAACAAGATGTGCTGAAACTTCACCTGTT
GAAAGAGAAAGGCAAGGGTTTGGGAATACAACTGACCAAAAACACTGACA
CCAAGAAAAAAGGAATATTCATCAGCCATTTATTGGAAGACAGCGTTGCT
GAACATGATGGACGCCTACAAATTGGGGATGAGATATTATTTATCAATGG
CCAATCACTATTAACGCTTGGCCACAAAGAAGCTGTTCAATTACTGCATA
GTGCTTCAAATCCTGTTCAATTAGTAATCAGCAGAAAGCTTGTCAGTGAA
AAACGTCAATCGTCAAGAAAACCTTCTAAGTCGGATGTTTCGCCAGAACT
TttcgaaaacaacaacaatattttcattgGAGATGTAGAATCACCAAGGT
TGTATACACCAACATCTGAACACCACACCAAAGAAATTATCCTCATCAAT
GGTCGTGATGGAAAGAAACTCGGTTTTTCAATGGCTGGTGGGGCTGAATA
TGGTAGCCCTCTTGTCGTCAAGAATATTCTAGCTGGGGGTATCGCGTCAC
TTGATGGGCGACTTCGAATAGGTGACCACTTGCTGAAAGTGAACGACATT
CCTTTAGATAACTTCAAGTATAATGAAGCAGTTTCTCTGTTCAAATCATT
GAAGCAGGGTCAAATCAAGCTTTTAGTCAAGACGATTAGAACACGACGTT
CAAGCAACAGCAGTAACGACAGTACACCAAGAGATCTAATCGATGGTGCC
AACATTGATGTCGTCATCAAGAAAGTTCCTGGTAAAGGATTAGGTGTGGG
ATTCGGGCAATCGAGTCGAAGTGGAATTTTCATCAAGTATTTAGCTAAAG
GCTCGCTTGCAGCAAGAAAGAGCCTGTTACAACTAAAAGACCAGGTTGTT
GCTTTGAATGGAATCGGAACTCGTGACACATCACTAGATGACTTCCATAA
AATTATTCATAATATTCAACCCGGTGATGTCCGCTTATCCGTTATCCGAC
ACCATAGGGATTCATCCGGACGTGGGAGTATGACTCCGGAAACATCCCGG
TCACGCTCTGAGACGGGTTCATCTGTTTCAAGTGGTGTTTCAACAGTTGG
GAGTGGTAACGATTTGGCAGGATTGATGTCACCGGCTGTCCCTTTGAACA
AACAGAAACAGGTGTACAAACGTGAGCGATTACGTTCAGCAATCCTTCTC
AATGAATCTGATGATGACGACGATTATGAAGATGAGGCAATGATAGCGTT
GTATCAAAAACGTTTAAAAGCTAAAGCTGAAAaagctgagtcagcaaaaa
cgAAAGACGGTTGGTTGATGAAACATGACGTTATCAATTCAGATGAAGAC
GGGGGTTACCATGGTAATGAAGAGGATGCGGTGATGAATATTGAGATGAA
ACAACATTCACCGAATCAGAAAACTATGGGTAATAAGAAACCTTCAAAGG
AGGAAGGAGTATATCCAGGTGTCGACGCTGATGGATTGTTGAAAGTCATA
ATTGAACGAGATAAAACAGGTTCACTTGGTCTAAGtatcaaaatgaagaa
aaacaatAAGACGCAGGGAGCACATGAAGGTGTCTACGCCAAAAATGTGG
CGGTGGGTGGGTCCGCCGATCGAGGTGGCGTCAAGAGCGGAGATCAAATC
ATCCAAGTCAACAAAACCAAAATGGAAGATTTGACGTATGGAGGCGTCAT
TGCATTCTTTAAGAAGATACCGAaaaaaaccactttcgttttgcGTAGGC
CCTCTTCTGAAGACACAAGATTATCGACACCAAGTTCTACTCCACAAAAG
AAAACGAACTCTACTTCATCCTTATCTGTTCCCAATCTCATTGATGATGA
CGACATGAACGCCCAATCACAAAACACTCCCATCTTACGAAACAGTATTC
TTGAATCTTCATTCCGCCATTCAAGAACGCCATCTTTCCGCCGAACCAAC
TCTCAACAACAGGGTGGCGTTACCAGGGCGTCAACATTCAAAATTATCGG
CAAGATTGGCGGAATCGGTGTTCCGTTACCAGAATCGTCGGATGTTCCGG
AAGGCTACAATGTTCATTTATTGGAGGTCTCTTTAACGAAGGGAGAAAAC
CTTGGCCTTAGTTTGGTACCGGCTACAAGTAAACTCAAGAGCTACTTGCA
GaTTCGCCAGATTCAACTGACCAGCCCATGCGTAGATTTGTTATTACGTA
ACGATGCCATCTTCTCTGTCAACGGTATTTCATTCAAACACATCAATCAC
GCGCAAGCTCTTCAAATTCTCAAACAATGTGAACACCTTGTCAAGTTGGT
CATCCTTCGTGAAAAAGATACGACAGCCGAAACAAAGAACGATCACGTGA
CACCACCACGTCATATAGAGAAGAAAGTCAGATTGAAATCACCGAAAACG
AACGATGCTTTACCAGGCACGATTGTTAACGAGCTGAAAAGTCATCTCAT
TCGACCAACTTTACATAGGCGTACAACAGAGAACTCGAGTCTCGTATCAA
TACCACAACTTACAGGGAATGGCCATAAATCGTCTCCTGTTTTGAATCAA
CGAAAAGCCTCAGTTAAGAAAAATCTTGCTGTCCCAAACCGCAGTGATGA
GGATAGTTCATCTCTGTCATCCAATCCTAACACGCCATCCAGTCTTCCTA
AATGCTATGCAGTCAATGAGCGAACCAATGTGGGTGCATTCATggttaaa
aaagagaaaacataCAAAGTGCTGGGACTCGATGTGATGATGGACGAGCT
TGGGTTATGTCACGTGACCGAAATCTCTAAACACGGCATGTTCGCTAATG
ATAATCGAATACGGGTTGGTGACAATTTACTTGCTATCAACAAAGAATCT
CTATCAGGGAAACCTATCTCGTTCGTTCGCAACGCCATCNGTTACCAGAA
TCGTCGGATGTTCCGGAAGGCTACAATGTTCATTTATTGGAAGTCTCTTT
AACGAAGGGAGAAAACCTTGGCCTTAGTTTGGTACCGGCAACAAGTAAAC
TCAAGAGCTACTTGCAGGTATTTGGTTGGATTCATAATCTCTCGCTTCAC
ATACTAATACAGAGGAGTCTCTAC
Run BLAST on NCBI

transcript from alignment at sc0000012:600217..614342-

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001946 ID=TCONS_00001946|Name=TCONS_00001946|organism=Clytia hemisphaerica|type=transcript|length=14126bp|location=Sequence derived from alignment at sc0000012:600217..614342- (Clytia hemisphaerica)
TACCGGTGAGTTTTGTTCTCTGTTTTGATTGTCCGGTGGGAAAAAATATC CTTCTCCGACACCGGACATCCGACTTCCTTAAGTCCGGTGTAGAAATTGT CCGGCGGTAAAAAAAATTCTCTTTTACACCGGATTTTCGCGTTTCCGGTG TTCGTTAAGTCCGGTGCGTCGGCAGGGTCCTCAGTTAGGCCACCATTTCA CCGAACCTCCAAAGTCATTTGATTCGAGTTAATGAACGGGGTATTAAAAA GTACACGATTTCTCTTCACACCGAGTAGGCTTTTAAATCGAAATATAAAA AAAATACGTAGTGGAAACACATGCCGAATGTCTGGAACGAAAAGAAGACC AAATTAGTGGCAAAATGATGGAGCGTTTGACATCACTCGAGCGGCAAGTT ACAAACTCGTTATTTGTTAGGTGGTTAGGCAGTGGGCTTTCTCTAATTCT CTAAGCGTGCCCGGTCATTTTTAATGATAATGAAACAAAAAAGTTAAAAA GGGTGCGCTATCAGTGAAAGTTATCGTGACAGGTTATGACAGAAAGTATG ATTGATCAAAACAAATTTGTTGTCAAAGTGATTTAACAGTAAGTGAAAAT ACANTATGACAGAAAGTATGATTGATCAAAACAAATTTGTTGTCAAAGAG ATTTAACAGTAAGTGAAAATACAGGCCAGAATATCAAGAGTCCCATGTTT CGACCAATTGTCCCAAGTCAGAGCAGTTGGCGGTATATACGCCATAGACA GTGTAGCTGTAGGAATTTTTCTTACGTTCTTCCTTCACAAAATATTGATT ACTCTCGTTTTCCGCTTAAGCGCTCGAGAAAAAAATGATTAGCTAGCAAG TTTTTTTGTGATTGTGGCCTTAGCTATTTTTGACAAAAACAACAAAGAAA AAATTTTGTTTCATGCCTGGGTAGTAGCTGTAGCATACCAGTTAGTCACA CTATGAAATCAAGCTTTCAGAAAAAACAACACATAGTGTGCAAGGGGGTT CCAGGTCCCACCTGAAAATTCAGGTCCCACCTTATCCTAAAATTCCCACC TTCAGCCCAGACTCCCAGATCCCAGCTAAAAACAAAAAAAATATACTAAT TTTCGAGGAACAAAACAAAATTTCTTTACCGTAACATGAAGATGCAATAT ATTACATATGTTTAACTTTCCATTTGCCTATGACCTACATTAGGGGTAGA AACCAATCAAGTAGTCAGACGGCTTAGAAGTAAGTGTGAGTCGTTAGATA TAAGTTTGGCATGAAATTATGCNNACAATATTAGTATAAATAAGTGAGGA TCGCCTACAACCATAACTGCAGGGAGGGAGGGAGGTAAAATATTTCATCC TGTCAGCTTTCAGTTAGAGCGTCAAGGGAGATGTGATGGCCATTTGAACA TGACGTCACATGGCTATTAGCAAAGTAGACTCAGTTGGTGGAGGGCGGCC ACCCAGCCATTCGAATACTGTATATAGCGCTTATCAAATAAAAGTTAAAC CNGCGGTATATACGCCATAGACAGTGTAGCTGTAGGATTTTTTCTTACGT TCTTCCTTCACAAAATATTGATTACTCTTGTCTTCCGCTTAAGCGCTCGA GAAAAAAATGATTAGCTAGCAAGTTTTTTTGTGATTGTAGCCTCAGCTAT TTTTGACAAAAACAACAAAGATGCTAAATTTTGTTTCATGCCTGGGTAGT AGCCGTAGCATACCAGTTAGTCACACTATGAAATCAAGCTTTCAGAAAAA ACAACATCAGTCATCTATTTAAGGATGTATATAATTGCAACAACAAGTAT GAGAGTTACCTGAATCAATTTCAAGTTCCCAAGACAATTAAAACTTGAAA ACTTAAAATGAGACAAAAAGACTGATTGCGTACTTGCAGCAGCCAGAATA TCAACCAACCAAATTTTGCCATTCAATTCCCGAGACAGCACTTCGCTTAT AAGGAGGTTAATAAAATCTGAAGGAGAGTAACAGAGTAACAAAGGAGAAA ATAGTAATTACGGTATTTTCTCCTTTGTTACGAGTGATTAATCGTTAATT GCACAACAAAACATACGATTCCGAGGTAATCGTCAGTAAATAATCNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNAGTCATTTTGCACGGCTGACGATTAA TTTAATAATAATGACATCTAAATGTTATTGAAAGGCTTCTAAATTTTCTT AATTAGTATTTGAATCATCTTGATTAAGTTCTAATTATTTTAATCACTTT CCCCATTATATTGTAAATTTCAATGGATTGAAGCTTTTCCAAACACTTTT TAAAGAAGCTTTCAGGGTTTTTATCAATTATAAGTTATTCAATTCAAAAA TAAGTTTAGCCAGAAGTTTTCTGGAAAAGATGATGAGGTAGTTTTATTTT TTAAATATTTTTCAAACTGAGAAGTTTATCAGAGCTTTATTAAATTCAAC ATTTGCTTCAAAAGTGACTTCATTATACTAGCTATTTAAAAGAACCATTT GTGGTATTTTTTATAGTTTATATCCAAGTTTTTATTGCCTTGAATTTTTT GTTTTAGATGGGTTCATAACGCAAAGAGGATAAAGGCTCTTAGAGAAAGT CAAAAATTAATTCAACTGAAGAACGCTCATAACCAGACATGCAGCAATGA GGTTAAAGAGACATTGCTTTATATCAACAATGTCCTTGTCACAGACAAAA GCAAGAATATAACTATGAAAGAGGTAAGCTCAAAAACATTTTGCATTTTG CCTGTTTTTGCATTAAAAAAATCTTTGTTATCAAAAAGAAATTATAGCCT CAGAATACTCTTTCAAATATCAAATGAAGACAAGAAATCTTTTTTGAATT AAATGGTTGAAATATGTAGGTTAAAAATGGTCACAATATTGATAGAAAAT GGTCACAATATATTCATGAAAAATCAGTAAAAACTGAAAAATTCTAACTG AAGAGTAAATTGAATTGCAAAAAAAACAAGCCTTTTTATTCATTTGAAAG AATTCTCACTTGGATAGTGGTCATCTCTGTTTTGTCTTTTCTAACTAAGA ATAATAAAAATATTTACTGGTTAGATTTTGTGTAATTTAAATGCTGCTGG TCAGGGTCACTCTTTCTAAGTCTGAAAATATCTAACAGGGTCGCAAAATT CACTTAATTTTTAAAAGTTGGATCTGACAAGATTGACTTTTGGCCTTTTT CACTTTTCAGGACAGTTTTAGTATGTTATCTCTTTTGTGAGGTAATTAAA GCACCCATTATTTTCCAAAGGTTAATGGACTGTGGCATTTTTCAAAATTA AGGCCAGACCAATTTGATTAGTTGTTTTACGGACCCGACCGGCCCTAAAG TGAATTTTCTCGAGTTCTATGAATTTTTAAAAGATCAATCCTTTTGCATT GGAAAGAGGAAAGATAAACTTAAATTTTGAGGGGTCATTTGTCAAATTTA GTCAACTGGATCAAAAGTTAAGCTAAGCCAAAATGAATAAAAAATTATTT TTTTTGTAATTGCTCAAAAACGTTGAAAAGCAACCTATCAAATTGTTATA GAAGCATAATTGCATGGATCATGATTTTCATTGTTGAAGCAATAAAAACC TAATGGAAGTATCTTTTTATGAAAAACGAAGTAAGATTTTAGTGAAACAA AGAAATTTTTTCTGAAAAACTGAAAAATTTGATAATTTCAACCGATATTT GACTTCAATAGCTACACTGATAAAATCAGCCCTACTTTTGACTTTAGGGG TCCTTAAGCCAAAACTTGAAGCTAATTCAATAGAAAATAATTTGAAATGA CCCAAATGAAAATTTTTAGTCCTTTAAACATTATTTCAAGCATGTTTTGT TTTCATGTCCACTTTAAACTCTTTATTCCTGCAAAAAAGTAATAATTAGG TTATAAAATTGAAAGGTTGATTTTCAACGTTTTTGAGCCTTTTCAATTGC CTTTTCCTTTGAAATTTTTATTCATTTCAGCATAATTTTTGATCTAGTTG ACCAAATTTGATAAAATCTTCAAAATTTAAAAACCCTTTAATTTAATTTA AAGAGCAGAACTTTTTTCTGGGACACCCGGTATATACATACATTTGTTTT CAGAAACAAGATGTGCTGAAACTTCACCTGTTGAAAGAGAAAGGCAAGGG TTTGGGAATACAACTGACCAAAAACACTGACACCAAGAAAAAAGGAATAT TCATCAGCCATTTATTGGAAGACAGCGTTGCTGAACAGTAAGATGATTTT AATTTAGGATTCGATTTTCAAAAGATTTTCCAAAAATTTAGACAAAACGA AACAAATATGTACAATGATACTTATTATAAACAGCAGTTCTGGAAAATTT GATGATTATTGGTGTAGGACGGAATATAGAACATTTATTGCAATATGAAA AGCTCTTTTATTTTACGTTTCACTATCCGAAAAAATAATGAACAGAATAG AAAGAATGCGTGATTTGCTCGACAAAGCATGTATCATTTTTCATGATATG ATAATGTAAGCTTTAAATCNATTTGCTCGACAAAGCATGTATCATTTTTC ATGATATGATAGTGTAAGCTTTCAATTCTTTCAATCTTAGTGATGGACGC CTACAAATTGGGGATGAGATATTATTTATCAATGGCCAATCACTATTAAC GCTTGGCCACAAAGAAGCTGTTCAATTACTGCATAGTGCTTCAAATCCTG TTCAATTAGTAATCAGCAGAAAGGTATATAAATTTTAAATAACAAGTTAG TTCCCAAAATGTTAGATTTACATTGAATGCACGCTTTGGAAAAAAGATAA AACTATAATTTTTTCAGCTATCAGCTTTTGGAACCTGTAATTTTGTAATT ATTTGATTTCGGCGTGTGGTAGGAATTTTAAAGGTATAGCTTTTAGTTCT AGTATTTTAATGGATTTTGTGATTTTTGATTAGATGATTTATTTTCTGAT CATTTTACAGAAGAATTGTACCTATTTTAAGATTCAAAATTAAGTCTCGC CATTTCCAACTTAACAGAAACATCACAGCACTTTCATCTAAGCTTTTAAA GAGCCGTTGCTACGGGTGAACAACCCGTTGCTAAGGAGTTTTCAGGCATG AAATCTTAGTAAACTAGACTCACTTCTAGGGCTTATTCTGACTCAAAGAG ACTAGGGGCCATGAATTTCTTTTCAGATTCAGATATGGAAAGGGGAAGGG TAATAGCACCTAATTCTTCAAAAAAAAATTTGTCAAAGTGAGGGCTGCAG CCATTATAGGCCGAGAAAGTGGGAACATTTTGGACTTTAAAAAATTTCAA AATGGCGGCAGAGGCCCATTGTTGGCCCATGAATTTTTTTTGTGCAAATG AAAGTAAGCTCGTAAAAGTTTATCAGAAAATCTTAACTGGTACATGTAGA AGTGAGGCCCATGTAAGATATTTGGTCTCAAAAAGGGCAGAAATTTGGCC AAAATGTCGTTTCGGACTATGATTTCTAGACACAGAGGAATATTTAGAAC CTCGTTTTTTATTCTTTGTGTAGAAGTTATCCCATATTACCAAGAAATGG AGAAATGGGGACCTCTTTATGCTCAAAATGGGCTAAAAATCATTTCAAAG AGGCTCGTCTTCCATTTTGCGGACCCAAAAATAGCTAAAAAGGCCGAAAT TTCAAGAAGCCATATCTCAGCAACCGGAAGGAATTTTTCGAAAAAATTTT CAGTGGATGTTTTTTTCATTATTCTGAGCAAAATATCCAAAAATGAGGAA AATCATCACTTCCTCAATTTGCCTGGATCTCTCAGAAAATGGNGAGCAAA ATATCCAAAAATGAGGAAAATCATCACTTCCTCACTTTGCCCGGATCTCT CAGAAAATGGCTCTTAAAAAATCATTTTCTAACAAAGCTTTAATCTTACA TGTTAAACAGACTGATGACTCAAATCACTTTTGAAATAAGAGCTTCACCT GCTTTCATTACTCTACTTTTAGCTTGTCAGTGAAAAACGTCAATCGTCAA GAAAACCTTCTAAGTCGGTGAGAATTATTTTTTGGTGATAAAAAAAGAAG ATCACAATTGTTTTATTAAATGCACAGACTAACATGTTTTATGATTGTCA AGAGTCAATCTCTCCTAAATTTTTTTTAAATGGCAGACTTTTCACAGTCT TCATTTTCCTTGGAAAAGCAGCAAAAGTTTGAAAATATTTATAATCGAAC ATCAAAGCTTTGCAACTTTAGCCGGGTCAAAGAATTTTATTTTCTAAGAA TCAAGAAATTTATCTGATCTTCCTTACAAAAAGTTTGAAAAAAGGCAGCT TCTTCTTCATAAATAAAGCCTTCTCCTGTGAAAGCTAATTTTCTTTTTGT GCATCAGGATGTTTCGCCAGAACTTTTCGAAAACAACAACAATATTTTCA TTGGAGATGTAGAATCACCAAGGTTGTATACACCAACATCTGAACACCAC ACCAAAGAAATTATCCTCATCAATGGTCGTGATGGAAAGAAACTCGGTTT TTCAATGGCTGGTGGGGCTGAATATGGTAGCCCTCTTGTCGTCAAGAATA TTCTAGCTGGGGGTATCGCGTCACTTGATGGGCGACTTCGAATAGGTCAG TGTCTTCTTAGTTTGTTCACGAGGCTGTTTGGCTATTTTGATGTTTACTT GCTCCAATCTAAGAATTCGACAATTCGATCTGATTTATAGTCAAGACTTT TGGCGTCCAAGAGTTCTAAATTACTGGTGTGTATATGCCGTTATAAATAA ATCTAAGTTTGAAATGCCTCTGGGTCTGTTTTGTAAACTTTTATGATCAA AATTCTCATTTTGCTTAATAAATCTCTTTTTAATCTTTTCACCTCGAGAG ATATTTATGTAGCGGCTGATATTCTTGACTACAAAGGGGTAATTGTACCG TCTCCAATCATTTGATATTGCAGGATCTCTGTCATTCACAATAATGTGCC TGGTGTATTTCCATGTGTTTTCAGGTGACCACTTGCTGAAAGTGAACGAC ATTCCTTTAGATAACTTCAAGTATAATGAAGCAGTTTCTCTGTTCAAAGT AAGTCGAGTAACAATTGATTCAATTCCCTCTTATTCCTTTCAACTGAGAG AGAAAAGCCAGAAAAATAGACAAGTAAAAGATTGCAAAATTGTTAGATGC CTTGCAGAGCTAAGGCACAGATTTATGTGAAACCTGGAGTGCTAGATGGC GTGCTTTAAGCTTTTCCAAGCAGAAAAAGTAAACATTACACAAAATATTA TTGCTATTGCTTTTGAAAATCCACGAGGCTTTTTGATTTGTCAAGCGCTG AAATTCCATTGTAATATCTCGTAACCTCGGTAGGACTTTTCAGCCAAAGC ACGCCACCTAGCCGTCAGGGCCTTATCTGTGATGTAAGGTCGCTTTCACA TATAAAAAAAAATTTATGCGAAAAATTTAAATCGTTCAAAAATAAGTGAT TCTATCGGCCAATAGTATAGACTAAACGTCGTCATCTTTAGGCTTATCGT TTCAAATCGTCTCGAAACGGAACGTGGCGGCTGTCAAATTATTAAATATA ATCTAAGACTTGACACTACCACTTACAATATTTACAAATTTCCTTTACTT AAACCAGTCATTGAAGCAGGGTCAAATCAAGCTTTTAGTCAAGACGATTA GAACACGACGTTCAAGCAACAGCAGTAACGACAGTACACCAAGAGATCTA ATCGATGGTGCCAACATTGATGTCGTCATCAAGAAAGGTATAACTATAAA GGTTAAAAGATTTTTAAAGGTTTATGCTCTCGAATTTATTGAGCCAATAA TTAACTTTTCAGTCACTTTGAAAAGTGTTGTCTTACAAGTCGTACTTTAA CGCTGGATTGTTATTATCACTTTAAGTGCAAGACTCACCTTTTTTTATTG ATATATTTCACTTGAAAATGTCGTATGATATTTTGTCATCCTAACAGTTT TATGATTCCTAAATTTAATGTTTCTGTATCATTTTTTTTCGGTTCTGATT GGGTGTTAATTGCCTGTTGAATTCCAACCTTGTCTTGCTTATTTCTTCTA GTTCCTGGTAAAGGATTAGGTGTGGGATTCGGGCAATCGAGTCGAAGTGG AATTTTCATCAAGTATTTAGCTAAAGGCTCGCTTGCAGCAAGAAAGAGCC TGTTACAGTAAGTGAAAGTTTTATTTTAGAATATTTTTTTATTTCATAAT TCTTATAGTAGGGGTCCAAGCCTCGGGTCCCGTGACATCTTTTTTACGAC CTAGCCATTTTTAATCTATTCCAAAGAACAGTATATTACAAGATATTTTT GAGAGGAAGGACGCGGATTAGGCCCGGGAGAACTTTTTATGACCAAAATA GTGACTTCAAAGGCAAAACTGCGAGGGAAATTGGTACCATCTGAAAGAGC ATGAAATTCTGAGCAGAAAAATATATTACAACTCTCTGACTAAAACACGC AAAGAAATACAGCCGCTTGAAGTTTAAAAACATACCGACACCAGTACGAT CAAGATAAGATTTGACGTCAAATCACAGTAGAGCTGACAGTTAGTTGGTC TTAAAGTAAAAAAGATGTCACGGAACCCCAGGCTTGGCCCCCTACTATTA TAAAACTAAATAACTGACTCTCTGATTTTTACCTGCTGAACTATGCGTTA TGTGTTTGACAAAATGAGACCTGGTCCGATAATTTATAGCTTGTGAAGCC GCTTCGTAAACTTTGTATATACTTTTTTATATCAATCAACATTTTAACTT TCCCCTTTTACAGACTAAAAGACCAGGTTGTTGCTTTGAATGGAATCGGA ACTCGTGACACATCACTAGATGACTTCCATAAAATTATTCATAATATTCA ACCCGGTGATGTCCGCTTATCCGTTATCCGACACCATAGGGATTCATCCG GACGTGGGAGTATGACTCCGGAAACATCCCGGTCACGCTCTGAGACGGGT TCATCTGTTTCAAGTGGTGTTTCAACAGTTGGGAGTGGTAACGATTTGGC AGGATTGATGTCACCGGCTGTCCCTTTGAACAAACAGAAACGTATGGATT TTACTACTCTTCTTACTTTCTATTGAATACGATAAACAATTTTGAAGACT GATTCTTCTCTTGAAGCTTTCTTCATTTTTATAACTTTACCGTCTGTAGA CGGAAATCCGTCCAGTTAAGAGGCAGATACACCATTTCCGTCTTCTCAGT AAGAGAGTTTTTAGTTCGACCACTCTAATCCTCAGATTTCCACCCTTTTT AAAAAAATCTAGAAACATTAAATGTTGACCCGGTAGAGATTCTTGTCGCC TAGCTCAACAACTCAAGCTGAAGCTTTGACTGAAGCTTTCTAAGTTAAAT TACCATGTGGCCTTCACTATTTTTTGTCCTTCAAGAAGTGATCTTTGTTG ATGTTAATATATTATGTGAGGTAAGAAGACTTCACACAACAAGTATTTCT TTACAGCTTCTATACTCTTGAAACAATTCTAACAGGTTTGGTCATTGTGC AAGTCTAAATATCTTGTCAGCTGATTAGTTTTCTTTTAGAGAGTAGTCAT CTTTTTATTACAAGATACATTTTCTGTGAAAAAAAAATTTCAGAAAGATT TTGTTGGTCTTTGAGGTTGAAATTGTTTTAAAAGAAACAAATCATATTAT AGTCTCACCGAGAAAGAAAAGTCTTGAACTTTTCTTCAGCAAAGTATAAT AAAGTCAAAAACCAAAATTTTTTCTTTCTTGTTTTCTGTTTTCAATCTTC TATAATTTTATTGTCACTGTCATTTCCGTTTTTCATGAATTTATCAACGC AAGCGTTTCAGTGTTTATTTCATAACATAGAATAGTTCTGTTGGAACATT TAGAGCTTCTGTTAAGAATCTGGAAATTTTTAGCGAAATGTATTTTAAGA AATGATTACAAAGAAGCATTTTTCTCAACCGTTTTTCTTCTATTTTTTTT TAACTGTGTTATATCAATAAATTTTGTCGTGTATCAATTAAGGTTCCACG GAAATTGAAACAGAAAATTATTTTGAACACTGGCACTGAAAAAAATCATG AAGCTTTGAAATACGCGAAATTTTTTGTCATCTGTTGGTTGAAATGCAAA AAGGTTAGCTACAGACTACATTGTAAATTCTTGTTTATCGTTTCATGTTA CAGAGGTGTACAAACGTGAGCGATTACGTTCAGCAATCCTTCTCAATGAA TCTGATGATGACGACGATTATGAAGATGAGGTTTGTTTATTTTCCTACTG TAGTTTTTTTATTGATCCCATTTCAGTCAGGTCTAAGGTCTGGTTTAGAC GGTCCACTTTTCGCCCTTCCCTTCTTTAATTGTGAATTAAAGTGGGCAAA AAAGTGACTGTCTAAGTCAGCGCATGATCTTCTTTTGACGTGAATGCAAT GACATCTTTCAATCTTTTCGCGCGTCTAAACTGAGCTAAGACTGAGCTTA AGTCTGCCAGGGAACTAATATTCATCAGACTCCCATTCGATATCGATATG GTGTATTTGAATCAACTTTGCTTAGGCCACTACACCGAACTTGGACAGTC TTAACAGCATTAGATATCGATATTGTTTTTAGTTTAGCAATGTTTGAATG GTCTAACTCTAAAGGTGTTGAGGCAACCACACTGGGGTTTCTTGTTCAAG TTTCTTCTCTTTCTTGCAAAGGTAGCCGAGTTAGCAGGTAGTGGACATTT GGGATCTATTAATTTCTCTTCTGAAATAATTCGTGGTTCTTTCATATCCT AGGCAATGATAGCGTTGTATCAAAAACGTTTAAAAGCTAAAGCTGAAAAA GCTGAGTCAGCAAAAACGAAAGACGGTTGGTTGATGAAACATGACGTTAT CAATTCAGATGAAGACGGGGGTTACCATGGTAATGAAGAGGATGCGGTGA TGAATATTGAGATGAAACAACATTCACCGAATCAGAAAACTATGGGTAAT AAGAAACCTTCAAAGGAGGAAGGAGTATATCCAGGTGTCGACGCTGATGG ATTGTTGAAAGTCATAATTGAACGAGATAAAACAGGTGAACATTTTTGTG GTACATACAGTTACTCGATGTGGATGAAAACTGGTTTAACGTATACTTGG TTTGAAACACTGATCTCTAACTACTTGGCTGGACCGGGTTTGCTTTCCAT ATAAGAGGAAGCGTGTCCAGTCTTAGAGCTGACTAGTCCGACATTTTGTT TTCAATTCTGGTCTTCAAGAGCGCGATTCGAATGTTTTTAAAGACGAATG TTCGAAAATCTAAGGTAAATTAGAAAACAAAATATTCTTTTCTGACCCAA GTTAACAGTTTTTCTCGAAGACTCCGATAGAATTAATGGTCAGATTTATG TATTCACTTTCTCATTACAGGTTCACTTGGTCTAAGTATCAAAATGAAGA AAAACAATAAGACGCAGGGAGCACATGAAGGTGTCTACGCCAAAAATGTG GCGGTGGGTGGGTCCGCCGATCGAGGTGGCGTCAAGAGCGGAGATCAAAT CATCCAAGTCAACAAAACCAAAATGGAAGATTTGACGTATGGAGGCGTCA TTGCATTCTTTAAGAAGATACCGAAAAAAACCACTTTCGTTTTGCGTAGG CCCTCTTCTGAAGACACAAGATTATGTGAGTATATTTGATCGTTTTTACT TTATATGAAGCAAACGATTGCCAGGATATGATTTGCTAGCTACGAGGGTA GAAAATATAGAAAGTTAATGATAGCTCGAACTCTTTGAATAAATATAAAT ATTTGAAAGTAAAGTTGCCTCATTACAAGTCGAATGTTCACATGGTATGG CTTAGGTATTAAATTTGATGGGTAAGGGAAGTGTTTTTTCGCGTGTGCAT TATGGAAAGTCTTTTTTGGTTGCAATTTTTTCTTAAATAACTCTAATCTT ACCCAATATTCTAGCGACACCAAGTTCTACTCCACAAAAGAAAACGAACT CTACTTCATCCTTATCTGTTCCCAATCTCATTGATGATGACGACATGAAC GCCCAATCACAAAACACTCCCATCTTACGAAACAGTATTCTTGAATCTTC ATTCCGCCATTCAAGAACGCCATCTTTCCGCCGAACCAACTCTCAACAAC AGGGTGGCGTTACCAGGGCGTCAACATTCAAAATTATCGGCAAGATTGGC GGAATCGGTGTTCCGTTACCAGAATCGTCGGATGTTCCGGAAGGCTACAA TGTTCATTTATTGGAGGTCTCTTTAACGAAGGGAGAAAACCTTGGCCTTA GTTTGGTACCGGCTACAAGTAAACTCAAGAGCTACTTGCAGGTATTTGTT TGAATTCATAGTCTCTCGCTTCACATACTAATACAGAGGAGTCTCTACAA CTCGAATATTTCATTAACTCGACAATTTTTCTGGTCTTTTCAGTGTTGGA GTTATAAGAGGCTCCACTGTATTTCGTTTTGATCCATGATCTGCTTTAAA TAATAATATAATCGAATTTCGATATTCACAAAATTAACTATCGCAAGCCT CACTCTTTTCTTTATGCTGTAGCCAAGGTAACCGGTTATGATGCTCTGCA TTAGAATACAGTATAGTAGACACTACTACTCTTTTTGCGGAAATTATGTA AAAAGTAAAAAAATGGAGTAACACAGGCAAGTACAAGAGATCTGTGACTA CTTTCTTCAGAGTTTTATTTTTTCTTTAGTATTGCTTTAACCGGATTCGA ACTTCTTTTTCTTCTTTAAGATTCGCCAGATTCAACTGACCAGCCCATGC GTAGATTTGTTATTACGTAACGATGCCATCTTCTCTGTCAACGGTATTTC ATTCAAACACATCAATCACGCGCAAGCTCTTCAAATTCTCAAACAATGTG AACACCTTGTCAAGTTGGTCATCCTTCGTGAAAAAGATACGACAGCCGAA ACAAAGAACGATCACGTGACACCACCACGTCATATAGAGAAGAAAGTCAG ATTGAAATCACCGAAAACGAACGATGCTTTACCAGGCACGATTGTTAACG AGCTGAAAAGTCATCTCATTCGACCAACTTTACATAGGCGTACAACAGAG AACTCGAGTCTCGTATCAATACCACAACTTACAGGGAATGGCCATAAATC GTCTCCTGTTTTGAATCAACGAAAAGCCTCAGTTAAGAAAAATCTTGCTG TCCCAAACCGCAGTGATGAGGATAGTTCATCTCTGTCATCCAATCCTAAC ACGCCATCCAGTCTTCCTAAATGCTATGCAGTCAATGAGCGAACCAATGT GGGTGCATTCATGGTTAAAAAAGAGAAAACATACAAAGTGCTGGGACTCG ATGTGATGATGGACGAGCTTGGGTTATGTCACGTGACCGAAATCTCTAAA CACGGCATGTTCGCTAATGATAATCGAATACGGTGGGTTGGTGCCTATAA TTCGAAATAAATGCAATTAAAGTGATATATCCCCTATACTATATGCAAGT TTCTTTCGTCTAGAGCGTAGAACTAAACTTTAAGGAAAGCCTTATAATAT TCAAACTGGTATAAAACACAAATGGAACATCAAAAATATGCATATTGCAA CGTTTTGCTTACTTGTCCTTTACTCAGTTTTTTGTCTAATAACTATTTTT TTATTTCCGAAATGTATTACTACAACCTTGCATTGAATTAAGACCCATTT TTCTCTTTTTTCCAGGGTTGGTGACAATTTACTTGCTATCAACAAAGAAT CTCTATCAGGGAAACCTATCTCGTTCGTTCGCAACGCCATCNGTTACCAG AATCGTCGGATGTTCCGGAAGGCTACAATGTTCATTTATTGGAAGTCTCT TTAACGAAGGGAGAAAACCTTGGCCTTAGTTTGGTACCGGCAACAAGTAA ACTCAAGAGCTACTTGCAGGTATTTGGTTGGATTCATAATCTCTCGCTTC ACATACTAATACAGAGGAGTCTCTAC
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_001006XLOC_001006Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001946-exon-sc0000012-1575043694:614338..614342TCONS_00001946-exon-sc0000012-1575043694:614338..614342Clytia hemisphaericaexon
TCONS_00001946-exon-sc0000012-1575043694:611420..611585TCONS_00001946-exon-sc0000012-1575043694:611420..611585Clytia hemisphaericaexon
TCONS_00001946-exon-sc0000012-1575043694:609906..610039TCONS_00001946-exon-sc0000012-1575043694:609906..610039Clytia hemisphaericaexon
TCONS_00001946-exon-sc0000012-1575043694:609420..609552TCONS_00001946-exon-sc0000012-1575043694:609420..609552Clytia hemisphaericaexon
TCONS_00001946-exon-sc0000012-1575043694:608126..608170TCONS_00001946-exon-sc0000012-1575043694:608126..608170Clytia hemisphaericaexon
TCONS_00001946-exon-sc0000012-1575043694:607548..607785TCONS_00001946-exon-sc0000012-1575043694:607548..607785Clytia hemisphaericaexon
TCONS_00001946-exon-sc0000012-1575043694:607095..607168TCONS_00001946-exon-sc0000012-1575043694:607095..607168Clytia hemisphaericaexon
TCONS_00001946-exon-sc0000012-1575043694:606406..606535TCONS_00001946-exon-sc0000012-1575043694:606406..606535Clytia hemisphaericaexon
TCONS_00001946-exon-sc0000012-1575043694:605986..606091TCONS_00001946-exon-sc0000012-1575043694:605986..606091Clytia hemisphaericaexon
TCONS_00001946-exon-sc0000012-1575043694:605102..605379TCONS_00001946-exon-sc0000012-1575043694:605102..605379Clytia hemisphaericaexon
TCONS_00001946-exon-sc0000012-1575043694:603913..603989TCONS_00001946-exon-sc0000012-1575043694:603913..603989Clytia hemisphaericaexon
TCONS_00001946-exon-sc0000012-1575043694:603108..603390TCONS_00001946-exon-sc0000012-1575043694:603108..603390Clytia hemisphaericaexon
TCONS_00001946-exon-sc0000012-1575043694:602518..602772TCONS_00001946-exon-sc0000012-1575043694:602518..602772Clytia hemisphaericaexon
TCONS_00001946-exon-sc0000012-1575043694:601852..602228TCONS_00001946-exon-sc0000012-1575043694:601852..602228Clytia hemisphaericaexon
TCONS_00001946-exon-sc0000012-1575043694:600761..601422TCONS_00001946-exon-sc0000012-1575043694:600761..601422Clytia hemisphaericaexon
TCONS_00001946-exon-sc0000012-1575043694:600217..600477TCONS_00001946-exon-sc0000012-1575043694:600217..600477Clytia hemisphaericaexon
TCONS_00001946-exon-sc0000012-1510915933:614338..614342TCONS_00001946-exon-sc0000012-1510915933:614338..614342Clytia hemisphaericaexon
TCONS_00001946-exon-sc0000012-1510915933:611420..611585TCONS_00001946-exon-sc0000012-1510915933:611420..611585Clytia hemisphaericaexon
TCONS_00001946-exon-sc0000012-1510915933:609906..610039TCONS_00001946-exon-sc0000012-1510915933:609906..610039Clytia hemisphaericaexon
TCONS_00001946-exon-sc0000012-1510915933:609420..609552TCONS_00001946-exon-sc0000012-1510915933:609420..609552Clytia hemisphaericaexon
TCONS_00001946-exon-sc0000012-1510915933:608126..608170TCONS_00001946-exon-sc0000012-1510915933:608126..608170Clytia hemisphaericaexon
TCONS_00001946-exon-sc0000012-1510915933:607548..607785TCONS_00001946-exon-sc0000012-1510915933:607548..607785Clytia hemisphaericaexon
TCONS_00001946-exon-sc0000012-1510915933:607095..607168TCONS_00001946-exon-sc0000012-1510915933:607095..607168Clytia hemisphaericaexon
TCONS_00001946-exon-sc0000012-1510915933:606406..606535TCONS_00001946-exon-sc0000012-1510915933:606406..606535Clytia hemisphaericaexon
TCONS_00001946-exon-sc0000012-1510915933:605986..606091TCONS_00001946-exon-sc0000012-1510915933:605986..606091Clytia hemisphaericaexon
TCONS_00001946-exon-sc0000012-1510915933:605102..605379TCONS_00001946-exon-sc0000012-1510915933:605102..605379Clytia hemisphaericaexon
TCONS_00001946-exon-sc0000012-1510915933:603913..603989TCONS_00001946-exon-sc0000012-1510915933:603913..603989Clytia hemisphaericaexon
TCONS_00001946-exon-sc0000012-1510915933:603108..603390TCONS_00001946-exon-sc0000012-1510915933:603108..603390Clytia hemisphaericaexon
TCONS_00001946-exon-sc0000012-1510915933:602518..602772TCONS_00001946-exon-sc0000012-1510915933:602518..602772Clytia hemisphaericaexon
TCONS_00001946-exon-sc0000012-1510915933:601852..602228TCONS_00001946-exon-sc0000012-1510915933:601852..602228Clytia hemisphaericaexon
TCONS_00001946-exon-sc0000012-1510915933:600761..601422TCONS_00001946-exon-sc0000012-1510915933:600761..601422Clytia hemisphaericaexon
TCONS_00001946-exon-sc0000012-1510915933:600217..600477TCONS_00001946-exon-sc0000012-1510915933:600217..600477Clytia hemisphaericaexon
TCONS_00001946-exon-sc0000012-1491911889:614338..614342TCONS_00001946-exon-sc0000012-1491911889:614338..614342Clytia hemisphaericaexon
TCONS_00001946-exon-sc0000012-1491911889:611420..611585TCONS_00001946-exon-sc0000012-1491911889:611420..611585Clytia hemisphaericaexon
TCONS_00001946-exon-sc0000012-1491911889:609906..610039TCONS_00001946-exon-sc0000012-1491911889:609906..610039Clytia hemisphaericaexon
TCONS_00001946-exon-sc0000012-1491911889:609420..609552TCONS_00001946-exon-sc0000012-1491911889:609420..609552Clytia hemisphaericaexon
TCONS_00001946-exon-sc0000012-1491911889:608126..608170TCONS_00001946-exon-sc0000012-1491911889:608126..608170Clytia hemisphaericaexon
TCONS_00001946-exon-sc0000012-1491911889:607548..607785TCONS_00001946-exon-sc0000012-1491911889:607548..607785Clytia hemisphaericaexon
TCONS_00001946-exon-sc0000012-1491911889:607095..607168TCONS_00001946-exon-sc0000012-1491911889:607095..607168Clytia hemisphaericaexon
TCONS_00001946-exon-sc0000012-1491911889:606406..606535TCONS_00001946-exon-sc0000012-1491911889:606406..606535Clytia hemisphaericaexon
TCONS_00001946-exon-sc0000012-1491911889:605986..606091TCONS_00001946-exon-sc0000012-1491911889:605986..606091Clytia hemisphaericaexon
TCONS_00001946-exon-sc0000012-1491911889:605102..605379TCONS_00001946-exon-sc0000012-1491911889:605102..605379Clytia hemisphaericaexon
TCONS_00001946-exon-sc0000012-1491911889:603913..603989TCONS_00001946-exon-sc0000012-1491911889:603913..603989Clytia hemisphaericaexon
TCONS_00001946-exon-sc0000012-1491911889:603108..603390TCONS_00001946-exon-sc0000012-1491911889:603108..603390Clytia hemisphaericaexon
TCONS_00001946-exon-sc0000012-1491911889:602518..602772TCONS_00001946-exon-sc0000012-1491911889:602518..602772Clytia hemisphaericaexon
TCONS_00001946-exon-sc0000012-1491911889:601852..602228TCONS_00001946-exon-sc0000012-1491911889:601852..602228Clytia hemisphaericaexon
TCONS_00001946-exon-sc0000012-1491911889:600761..601422TCONS_00001946-exon-sc0000012-1491911889:600761..601422Clytia hemisphaericaexon
TCONS_00001946-exon-sc0000012-1491911889:600217..600477TCONS_00001946-exon-sc0000012-1491911889:600217..600477Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000012supercontigsc0000012:600217..614342 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
2.85725e-05 0 0 0 5.61425 4.34827 1.87589 3.61887 0.689305 1.25732 1.19711 1.03656 0.343808 0.384194 0.224475 0.622039 0.0818548 0.447349 0 0.321597 0.230152 0.831601 0.0505593 0.182538 1.28908 0.473798 0.960219 0.742525 0.295037 0.541337
Blast
BLAST of TCONS_00001946 vs. Swiss-Prot (Human)
Match: MPDZ (Multiple PDZ domain protein OS=Homo sapiens GN=MPDZ PE=1 SV=2)

HSP 1 Score: 103.99 bits (258), Expect = 2.751e-22
Identity = 95/293 (32.42%), Postives = 142/293 (48.46%), Query Frame = 1
Query:  262 GIFISHLLEDSVAEHDGRLQIGDEILFINGQSL-LTLGHKEAVQLLHSASNPVQLVISR----KLVSEKRQSSRKPSKSDVSPELFENNNNIFIGDVESPRLYTPTSEHHTKEIILINGRDGKKLGFSMAGGAEYGSPLVVKNILAGGIASLDGRLRIGDHLLKVNDIPLDNFKYNEAVSLFKS--------LKQGQIKLLVKTIXXXXXXXXXXXXXXXXLIDGA--------NIDV-VIKKVPGKGLG----VGFGQSSRSGIFIKYLAKGSLAARKSLLQLKDQVVALNG 1062
            GIF+  + E SVA  DGRL+  D+IL INGQ+L  T+ H++A+ +L  A + VQLVI+R    +LVS     SR PS +     +  ++N              P    H + I L+N  DG  LGF + GG   G  ++VK IL GG+A   GRL  GDH+LK+ D  L      +   + +         + +G I+          + +SS  STP   +D +          DV + K V G G+     +G  +   SGIF+K + K S       +Q+ DQ++A++G
Sbjct:  164 GIFVQEIQEGSVAHRDGRLKETDQILAINGQALDQTITHQQAISILQKAKDTVQLVIARGSLPQLVSPI--VSRSPSAAST---ISAHSN--------------PVHWQHMETIELVN--DGSGLGFGIIGGKATG--VIVKTILPGGVADQHGRLCSGDHILKIGDTDLAGMSSEQVAQVLRQCGNRVKLMIARGAIEERTAPTALGITLSSSPTSTPELRVDASTQKGEESETFDVELTKNVQGLGITIAGYIGDKKLEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDG 433          

HSP 2 Score: 88.1965 bits (217), Expect = 1.825e-17
Identity = 69/196 (35.20%), Postives = 104/196 (53.06%), Query Frame = 1
Query:  265 IFISHLLEDSVAEHDGRLQIGDEILFINGQSLLTLGHKEAVQLLHSASNPVQL-VISRKLVSEKRQSSRKPSKSDVSPELFE--NNNNIFIGDVESPRLYTPTSEHHTKEIILINGRDGKKLGFSMAGGAEYGSP-----LVVKNILAGGIASLDGRLRIGDHLLKVNDIPLDNFKYNEAVSLFKSLKQGQIKLLV 828
            IFI+ +    VA    +L++GD I+ I G S   + H +AV LL +AS  +++ V++   VS      ++P+ S +S   F    +++IF  D+  P+          K I L  G DG  LGFS+ GG  YGSP     + VK + A G AS DGRL+ GD ++ VN   L+   + EAV++ K  K G + L+V
Sbjct: 1890 IFIAMMHPTGVAAQTQKLRVGDRIVTICGTSTEGMTHTQAVNLLKNASGSIEMQVVAGGDVSVVTGHQQEPASSSLS---FTGLTSSSIFQDDLGPPQ---------CKSITLERGPDG--LGFSIVGG--YGSPHGDLPIYVKTVFAKGAASEDGRLKRGDQIIAVNGQSLEGVTHEEAVAILKRTK-GTVTLMV 2068          

HSP 3 Score: 85.8853 bits (211), Expect = 9.507e-17
Identity = 87/320 (27.19%), Postives = 149/320 (46.56%), Query Frame = 1
Query:  262 GIFISHLLEDSVAEHDGRLQIGDEILFINGQSLLTLGHKEAVQLLHSASNPVQLVI------SRKLVS-------EKRQSSRK---PSKSDVSPELFENNNN-----IFIGDVESPRLYTPTSEHHTKEIILINGRDGKKLGFSMAGGAE--YGSPLVVKNILAGGIASLDGRLRIGDHLLKVNDIPLDNFKYNEAVSLFKSLKQGQIKLLVKTIXXXXXXXXXXXXXXXXLIDGANIDVVIKKVPGKGLGVGF-GQSSRSGIFIKYLAKGSLAARKSLLQLKDQVVALNGIGTRDTSLDDFHKIIHNIQPGDVRLSVIR 1149
            G+ I  L E  VA  DGRL++GD+IL ++ + ++    ++ + LL +A   V+L I      S+ + S       EK+ SS+    P      PE   N +      IF  D  +     P        I +  GR G  LG S+ GG++   G+ +++  +   G A  DGRL  GD +L+VN I L    ++EA+++ +   Q +++L +                  ++ D   I+  ++K PGKGLG+   G+ + +G+F+  + KG +A     L   DQ++ +NG   R+ + +    ++     G V L V R
Sbjct: 1505 GVIIKSLTEHGVAATDGRLKVGDQILAVDDEIVVGYPIEKFISLLKTAKMTVKLTIHAENPDSQAVPSAAGAASGEKKNSSQSLMVPQSGSPEPESIRNTSRSSTPAIFASDPAT----CPIIPGCETTIEISKGRTG--LGLSIVGGSDTLLGA-IIIHEVYEEGAACKDGRLWAGDQILEVNGIDLRKATHDEAINVLRQTPQ-RVRLTL--------YRDEAPYKEEEVCDTLTIE--LQKKPGKGLGLSIVGKRNDTGVFVSDIVKGGIADADGRLMQGDQILMVNGEDVRNATQEAVAALL-KCSLGTVTLEVGR 1805          
The following BLAST results are available for this feature:
BLAST of TCONS_00001946 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
MPDZ2.751e-2232.42Multiple PDZ domain protein OS=Homo sapiens GN=MPD... [more]
back to top