Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001937 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001937
Unique NameTCONS_00001937
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length2775

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001937 ID=TCONS_00001937|Name=TCONS_00001937|organism=Clytia hemisphaerica|type=transcript|length=2775bp
GAAAAAAGGGCAGACGATTTAAAGGATATCTTATTCAGGCGATCCAGATG
AAAATTTACCCTTAACCCAGCAGAACCAGAAGAAGACATCTAATCAAAAT
GTCGGTACCGTAAATGGTGATGAAACCAAGGAAACCTGGGGAAACAAAGC
AGAATTTCTATTAGCTTCAATTGGACTTGCAGTTGGTCTTGGTAACATCT
GGAGATTTCCTTACTTATGTCAAAAAAATGGAGGAGGTGCTTTTCTTATT
CCATATTTACTTATGATGATCATGGAAGGTTTCCCTTTGTTCTTCATCGA
GTACGCTATTGGTCAACGCTTCAAACAGAGTGCTGTCGGATGCTGGGGAA
AAATCCATCCTGCTTTGCGAGGAATCGGTGTTGGTTCAATCATTTTATCT
ggtttcctttgtatttattacGTGGCTGTTATTGCTTGGTCCTTCTTTTA
TCTCTTTGTTTCAATGAGGAAAGATTTGCCCTGGGAACGAAATAATTGTC
CAAGTTCACTGCAACTGCTAAACAACTCGGTGACCAACGAAACATGTTGT
ACCAGAGATCCCGAAGCTTATTATTTCTACGTCACCGCTCTAAATGCTGC
TTCATCGATTGAGAGTACTGATGGCAAGGGAATGTCATGGCAACTGATTC
TTTGTTTATTGTTATCATGGGTTCTGGTTTACGCATGCGTGGTAAAAGGT
GTGAAGTCCAGTGGTAAAGCAGTATATTTCACGGCTACTTTTCCATACTT
GATTTTGATCATTTTATTGATAGCTGGCGCGTTACTTACCGGTGCTGATA
TTGGTTTGGTagccttttttaaacctgatTTCTCGCGGTTATTGGATCCA
AAGATCTGGTTAGATGCAGCTGGTCAAATGTTTTTCACTCTCAGTATTGG
GTTTGGTGCTCTACTAGCTTTCGCTTCATACATGCCGACCAAAAATAATT
GTATGAAAGATGCTTATACTGTTGTCTCGATTAATTGTTTCACCTCTATT
CTGGCTGGTATTGTTGTATTCTCCATTTTGGGACATCGAGAACAAGAGAC
CGGTCAAAGTGCAATTGAGAGTGGCAGCGGTCCAGGTTTAGTTTTCATCA
CATTTGCCAACGCTTTTCTACAAATGGATGGCGCTCCTTTTTGGGCAGTC
TGTTTCTTCGTGATGTTGATCCTCTTGGGAATTGATTCAGAGTTCGGAAC
ATTTGAAGCTTTTGTATATCCTTTTTATGATATGAAATGGATCACCATGA
ATAAAAGCTTATTTAGTGCTCTGGTAGCCATTGGTATGTTTCTGATTGGT
TTATGTTTTGTATCACCTGTTGGTTATTACGTCTTCCAAATCTTTGACGA
TTACTCATTATCATTTGGTCTTCTCGCCGTCGGATTCTTCCAAACCATCA
GTGTTTCGTGGGTTTACGGTAACGATAAGTTTGCAAATGACATTGAGTAT
ATGACGGGACGTCGTCCATTGAAGTTGTGGTTGATTTGTTGGAAATATAT
TTCTCCTATAGTCATCATGATTATCATTATCTCCAATATTTATTTGTTAT
CCATTGGAGAGATGACATACAAAGCTTACGTTGGTTGTTTTGCTGGTTTT
GCTGAGCCAGTAATTGAAAAAGAGTACCCAGCATGGGCGAAATTTGTTAT
TATTGTGCTTATATGTCTACCAATCGCACCCATCTTTATATACTTCATCA
AAGACCTGGTGCAGAACCCACAAGAATGGAAAGACGGTTTCCAAAATCGT
TTATGTCATCCAATAGAATATGCTTTTGATCCAAGTGATTACGATTTGAA
TCGAAGATATCATATTGAAGATTTGACAATGACAGAGAAAGATCAAAATA
ATGCAGCTTCTGCGGAAGAGGAACACGAAATTAAAGTTTAATTATCGTTT
CCATCTGAGGTTAGTTAGACTTCTACTACAAGTTCCAGACATTGAGTTTA
GATTTTTAGAATaatcttttttatgaaaaattaatgcaacatttttagat
ttttaacgtaatttgagaagaagaagaagaattatTTTCTGCTACTTAGC
Tcatattaattttattttcgtaattaggtaataaatttttaaagaattta
ataTACAATTTTTAGGTAAGGACTAATAAATTTTGACTGGACACCAGCTG
TTATTTTAAAAACGTTGATAAAAAGGTCAATATAGTTCCATCGTGACTGA
TGTGATTTTTAACTATTTGACAAAATTCAAGACTCCAGTCCAGgtttttt
atgtttcttttcttataaaaagcgtgtattcaacaaaatttttacacccc
tgtgtcacagacccagtgggacTGGAATCCCAGCccaactgaaaaatttg
acaaagatttcgtccccagtgggaaaatacccttgaatttcaacCTCAAT
AGAAAATTGACATTggtttcatccccactcgaaattccatgtttaaaaat
tgtactacaaaaccatccccactgcgTTTTTTAgccttagaacaatagaa
tttctatccccattaggatttcaataggaatttttatccccacatACTGT
GGACTaaagttccaccagggctgCAAGATAGGGGTGTATTTTTATACAGG
TTTTGAAATTGAACCTTGTAATTATCTTTGACGCATTTTCATATcataca
tttttttaattttattttcatgaaacgttttttttatttaatttgaattt
tttttaatttgatacaaCTAGAAATCATTTTGTTAGTAAATATATAATAA
AGGCAAATTTCATAATGCtccaaat
Run BLAST on NCBI

transcript from alignment at sc0000012:513974..534296-

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001937 ID=TCONS_00001937|Name=TCONS_00001937|organism=Clytia hemisphaerica|type=transcript|length=20323bp|location=Sequence derived from alignment at sc0000012:513974..534296- (Clytia hemisphaerica)
GAAAAAAGGGCAGACGATTTAAAGGATATCTTATTCAGGTAAAATTGAAG GAGCAATACCTGCAAAAACGATTATTAATCAGCAAATAGTAAGCTACGCT GTATATACACAACAGGTTGACGAATTTGTACGTGGTAAAATATTATATAT TATTTAAAATGCTGGAGCCCCTATTTGAGACATCGAGGTGGTAAATTCGT ATTCGATAACGTCACCCCTGAATCTCAGCCAGGCAAAGAAATATCTTAGA CTACAATAATTTATCATTTTTGGGCAGGTAATATAAGATATTTGAGAAAT TCCATCTAAAAAAATCATTTCTATCCAGCCGGTGAAGCCTAAATTTATTA TCCTGTAATATCTTAAACCAAGACTGAAAACAGAACTGATTCCTTAAACC CTGTCTTTAAAGTAGTGAAGAAGCGCTAGAAATGCTGTACAGCTAAAACA TATTGAATAGACGGCGCTATATGCTTAAGGTGTGTTATCGGATGCGATAT AACCTTCTTCTTGAGATGCAGAGGATATTCACTTTTCTGTTTCTTTATTA ATTTAGAAGCACTAATTCACCGTGTTTCTGTGTCTTAGGAAAGACAACAC TTGCTAGTTAGGATACCCATTTTTGATAAGATGATTTTATCGCCTAAATA AGACAACTCTAGATGGGTTGTATCATCCTCAATCCCAAGGATAACTAACA TCATCGAAGTTTGTTAATAACGAAATGCCGTCACTTTTNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNGAATAGTATTGTGTGTGTAATTTTGGCAGCTTGTAGCTTTGTCA CTAAGTACCTACTTTTGGCTCAATCCATGCGGTATTAAAAGATCTTTAAT ACCCCCTGGTCAATCTGACTGAATCGGGTAAGATGCATGCTTTTTGAAAG ATTCTGGTTTAATCTTTTTGTTTAGTTTTCAATTTATTTAGTTAGACCAA GTACGCACAATTTGGGTTGTAACAGACCTATGTTCTTCAGAATTTTGGAA TACCAGTGGATACCCCTTAAAACCTACAACAAAAAAAGCTACTCCCTATA TCCTGATAGAGAAAACAGTAAGGGCTGAAACCTTTTCTGGTGAGTCTAGC AGGCTACCTTTAAATTTCTTCCCTGGTTATGGCTTTTTGTAAAAGCTGCT AAGAAAATCTTTATTGCTTCGTGAAAAAATGCAGTTTCAGCTATTTACCC CTTAAAACCTACAAAAGGGTTTTCTTGAATAACTTTTTATAAAATAGCCC TTTTGGTCTCAAATTTTGAACAGTGATTCACTGGAAAGTTACTAATGCTA CAGTTAGATCATTGGTACCTAAATCTTTTCAAAACTGTACGTTAAAATCA AATTACATCTTAAAACCTACAAACATTGACCCCTTGCTCACAACTCACTG AAACTGTGAAATTGGGGAACTGTGAAATTCAGGAACCGACTGAACCGTGA TTTAATTGATTAAACACTGGCTAGAAATCCATTCCCAAAACAATATTTGT ATTTTTGAGGATTTCATGCCCATAATGCAATTGCGCCTTGTTTTTGTCCC AAAAATGGCATTGAAGGGTCAAAACTTTTTTTGAATTCATTTTTGACGTA TGTTGCTAATGTTTTTCTAAATCTCCATCAAATTTGTGAAATTTTGGTAT GCAATATGACCATGTATTGAGAAAGTCGATGTTCAGATTTTATTGGCCAC TAACCATAAATGAGTTTTAAAATAGAACTTTGAGGGCCTTATGATTTCTT TGGGACTGTAACCATGGAGAAGAAAATGATTTTTTCGTACCTACCATAAG TATAGGTACCTAAGAAGTATAGATTTTATGACCTTAACTTCATTTGTGTA ATCTCTAAGTCCGAAAAACTTGATTTTTTGAAGGGATTTTTGACAAAATT TTGAATAACTTCAAATTTCACGACACTTTGCGATAATTGAAATTCTTGAA ATTAGGTATTTTTTGAAAGTACTATATTAGAGAAAGAAAGTGAGTTATAC AATATTAAATTTAGTTTGGTGGTTGCGGAGAGAGCCCAAAACCCAAATTT GTAGGTTTTAAGGGGTATGTGGGGTATCCACTGGTATATGAATATAATGA ACTTTGGTATTGGAAGGATCCCTTATTTTTACTGTGAAATTAATAAATTC TGATTCATGAGGAGTATTTATCCGGGGGGGGGNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNGGGGGGGGGGGGTGCCGCCCGACTTTCGAACTTTGGACCCTTA CCGGGACTAAAATGGAGAAAACAAAGGAAAATTTTGTGAATTTCACGACC CTTAGCGGGACAAATTGGACCAAATTTCGATCTTTCAGGGGGTAAAAAGT TGAAATTTTCCAATTTACCGACCCTTGGTGGGACTGAAACTAGATTTTCT GATTTTTCCGACCCTTAGCGGGACTTTGGAAGTCCAAAAAAGGTACCCTT AAGGGCGGCACATACCGTACCTTCCATTTGCCTAAGTACCCCNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNCCCTTAAGGGCGGCACATACCGTCCCTTCCATTTG CCTAAGTCCCCCCCCCCGGGTATTTATCTCAGTAGCGAGGGCCTAAGTAC CCCCCCGGGTATTTATCTCAGTAGCGAGGGATTTCAGCGGACCTTTGACA AAAAGACGAAAAATACTAAAACAATAGTTATCATTATTGGAAACGAGACA TTCCTTACTTACCCAGTCTCCTGCTTACGTTTTCAGAAATGAATCTGATT TGATTTGTACTTACTGTATATGTTATATTCATTATAAACGATTCTTTAAT CGTCAACAAAAATTCTTGTCATAACTTATCCTAATAAAATGCTTATTCAT TCTACAAAAAAAGCGCAAAATAAATTTATTACGAAATTCCTATACACGTA TTATTTGTCCAATTATCCGCTTTGTTGCACTAAAAAATACGTCAATTGAT TTTGAGATTATTATCCAGAACATTATGCCTCAAATAAAATATATTGAAAT TCAAACTCGACTCCTTTTTTACCGGACACCCTGTATCAAACACCAGTTAT CGCTGGCCCGATGTGTCCTGATCTATCGAAGCAGCTCCTATTTACTTTGT GCTAATCACACCCCTGTCTCACAAGTGGATTTTTTTTTCCTCTGGTTATA AACATTTTTATTGAATCCGTATGAGGATAGAAATTACATTGTTCCAAGGT TAAAAAATGCAGTGGAGATGGTTTTTGAGTGCAACTTTTAACATTGAGCT TCGAATGGGAGTGAAATCGAAGTCAATTTTCCAGGTGTGGGTTAAATTCT AAGGGTATTTTCCCACCGAGGACGAAGTTTTTGCCAAATTTTCTAGTGAT GCTTGGGTCCCAATGGGTCTGTGACACAGGAGTGTGTAATCACTCAAAAG CTTTGTTACAATAAGGAGCCCAAGTTGGTGGATCGCTTTGATGTTTTTCG TGCAGATTTGGGATGAACATTATATGAGCTCTGTAGCACGGTGATTACCA ATCTAGCAAAACTAAAGAACAAGGCTAGTACTCTTTTTCATGTGACATTG CTAAATCGATTATTCTTATAGTAAAACTAATGACAGGCTTGTTGAGTGTC TATCTGCTTAATTCTACTCACATTGCAAGGTACCGTTAATTGTCAATTGG GAATCGAATTTTGACCTTGTGATTAATTGAAAACCACCACACTAGTATAC AATGATGGTCAAAAAGATAAATTGAAAAAGTTTAAATGAAGAAAGGTTCT ACAATCCTAGACATAACTATTTTTCCCCCTCCACCATCTTCAGTGCTGAT GGAGAGTCAGTGGAACTTGCAAGATTCCTTCTTCCAACATTGAAATTAAA GGGAGACTCAGCAGTGGGTTATGTGTAATCGAACAGCAGGTTTGTCTGCG ATTGGTGTGGGGGGGAGGTGGTTTGTACTTTTACGGTGTGACGGGATTGG CCCTTTTTAGTACGGTATTACGGGATTTTACGAAAAAAAAAGACGGGAAA ACGGTATTTTAAAATCAGACGGTAGGTGACGGTATTTGGCCTTATCTCGG GCCTTACATATTTTTGTCATTATGCCGGTATTTGAACCTGTACAAACCGG TGCGAAGGTGTTATTATTTTTTTCAATTTTCGGGATTCCGGGGATCAGCA AAAATTTTGACGGGAAAACGGTATTTCGAACCCCTACAAACCCCCCCATT GTAGCATAGGTGACACATTACCACTGACCTCTATTTGAAACTTTATTTCA TACTTTGATGGGCATTTTGGATTTTGCTTTAAAAGTAAGTACCCACATTG AGACGTTCTTCACCACAATTAGCTGATTAGATGCATCAGCCAAGAAGATT TACACGTTTTTTATAACAACATCCAAAAAGCTTTCGGACGTTCTCAACTT TTCGAGTTCTAAGTCTTAAAATTCTTCTTAATTTAGCCATTTTTTATTAT TTTTAAGAGATAAAACAAATTGACAATTTTACTGTCCACAAAGCCTTAAA ATTTTTTAATATAATATTTAGGCCATCAAAGCCTTGTTTAGTTTTTTCTT ATAAAAAACGTGTACATTATCAAAGTGAGAAAGTGATACTTCATATACGT GCTAAGAACCTTATCGGCTTTGACCTTTCACTTTTAAAAATGATGATATA GCTTCCCAATTTTCATAGCTTATCCGTTAAAGTCGTTAAGCAATCTGTTG CTAATAGTAGTCTAATAAAAAGTATACTTTTTTAAAAAGCAACCATGGGG GAGAGATGCATTTTCATCTTGTTTGTTGTTATAATGCCGTTAAGTATTAC TCTCCTTCAAGGGTGGTTTTTTAAAGTACACAGGTTTGTAAATCATAACA TACTGTTTGCTAGACAGCTAAAAAGATGAATTATGATTTAGTAAAGTGAA AGAAGCTAAGTGAAAAGCTAAATAGCAAAGTTTGGAAAACTGAGTGCTTT TTTGATGCAGGGGTATCTTATAGCTTGAAGCAGTTCACAAGTTGTTTTCT GTTTTTTATTGGTAGTATCATTATATTGAATACGCACGAATGCGAAAGAG ATTTTGAGCAGAAACAACTTGCTTGAATAGAGATATGACTCTGTTTGGTT GCTGTAGAGGTTTACTTATTATTACGTCTGCTTTTGGTGTTCATTTCTTC ATCGTCAAGTTGTCCGTTACTTTATCGACATAGTGTGCACGTGGTAGCAC AATCAATCAATTGATATCAAATACTTTTGCGTTGCATCATTTAAAATACT GCAATTGATATTTTAACTTGTATAACCATTTTCTCCTTTTTTTCTTCAGA ATATTGAGATAAACTATTTTTGATAATCATTTGATAAGTTTATCTCACGA GTGAGCACGTTGTTAAAATTCCTGGGCTTCGAATGCCTGAAAAGCCATAC TCTAAGGATCCTAATGAGGTTTCACCCAAGTACTTCACCATTTCTTTAAA ATAATTTCAAAAAAGTTTAAACCTTCGAAAATTATTTCTTATAATGTTCT TCTTAAAATGTCACCATTTTGTGAGAGTTTTTGTGCAATTTACCAAAATT AAATGTTTTAGAGTCCGCAAAGCCTTAAAATGTTCTTAACTTAATCTTGA TATATTTGGCAATAGAGGCATTATGTTCTTCGTTCGTTCTTATAAAAGAC GTGTATAATCAAGATAATTCAAAATATATACCTCTATACCGGAAATGAAG TTTCCGGCAGAACCATCTCCAATATAAGAACTAGTGAACACACACTGAAA GCGAATGGAGTTTTTCATTTTGTAAAATCTCTATTTGTAATTTTTTTGCA TATCATTGAAATTAAAGATGGCTTCTTTTAGGCGATCCAGATGAAAATTT ACCCTTAACCCAGCAGAACCAGAAGAAGACATCTAATCAAAATGTCGGTA CCGTAAATGGTGATGAAACCAAGGAAACCTGGGGAAACAAAGCAGAATTT CTATTAGCTTCAATTGGACTTGCAGTTGGTCTTGGTAACATCTGGAGATT TCCTTACTTATGTCAAAAAAATGGAGGAGGTAAAAATTGGGTTTCTGATA TTTGCAGACGCTAAGACTTTCCCATTCCAGGCAAAATATTATTCCTGTTG CATGTTTCAAAAACTATATTTTGTTGATTTGATGATGGAAATGGAGACTT TCTTGTGTTTTGAATTATGAATAAAGTCGCTCTTAGGAATCGCTCTGTAA AGCCTAATCAATCTTTCTTCCTTTTCAGGTGCTTTTCTTATTCCATATTT ACTTATGATGATCATGGAAGGTTTCCCTTTGTTCTTCATCGAGTACGCTA TTGGTCAACGCTTCAAACAGAGTGCTGTCGGATGCTGGGGAAAAATCCAT CCTGCTTTGCGAGGAATCGGTGTTGGTTCAATCATTTTATCTGGTTTCCT TTGTATTTATTACGTGGCTGTTATTGCTTGGTCCTTCTTTTATCTCTTTG TTTCAATGAGGAAAGATTTGCCCTGGGAACGAAATAATTGTCCAAGGTAT GACTAAGATCATAAAATTATTTTATAGCCTGTTTTAAGTAGGTTACAACT TTGAATCTTTGAAAAAAAAGTTCATTTTGTGACAATGAAATTGGGCGATA GATATAATGAAACTAAAGTAATGGTATTAAAAAGGCAAGTTACGTGAAGT TTTTCTTTTTACATGGTACCAGTACACGTTTTTTTTATTAGAACCTAGTT TATAAGAACATTGAGGCTGAAATTCGTCGAAAAATTAAGAACATCGTAAG AACATGCCCAGTCTAAGTTTTGAAAAAAATGACAAGAAACTACAATTTTT CCTCTTTTCAAGCAGTTTTAACCGAACATAGGCGTGGATTTTCTAAAATC GAGAGTCAAATATTGTCCAAATTTTACCAATTTTAAGTGCTCTTTATTTT GCACGATATTGTCGATATAGAGTAGACTGAAAAATTAAGAACGCATTTAA GAACATTTTAGGCTGAGAATTGCTAAAAAAATAAGCACCTCCAGGCTCAG CCAAATTTTAGGTGTTCTAATAAAAAAAACGTGTATATTTCTACTTAATG AGGACTTTGATTAACCTTATACCATGTGCCATATCTTAAGTTAAAAGTTA TGACTAATCGTAAAGGACCTCAGAAGGCTTTTCCAAGTGTTCTTTAAAGA TTTCACATCGAAAAGCAACATTAACTGCTTAAATAAACAAGGAACTGTAA AGACAGCGAGATTTGCGGTTTTCGTTTCCAGGGAATTTTTGTGTCATTTA TGTATTTTATGCTTTCCTGTTTCCAAGTATCTTTGGGAGGAGTCTTTTGA CATTATAGTACATAACAATATTGACAAAAATAGTGAAGTGGAATATCGGA TCTACACGTTTTTTATAAGAACATCCAAAATTTTTAAAGCCTTCGGATGT TCTTAACTTTTTGGGTTTAAAGCCTAAAAGTGTTCTTAAAATGTTCTTAT TTTCGCCAGTTTCTGACCATTTTTACCCACTTTCCTAAAACATCGGGTAT TTTCGAGTCTGCAAAGCCTTAAAAATGTTCTCAACTTGTTATTAGTATTT TGGCCTTATGTTCTTATATAGTTTGCTCTTATAAAAAAACATGTACCTGT TGTAGATTATGGCATAGAGATAAAAATTTCGACGCCGTCACTTTCTTGAA AATATTTCTATCTACAATATCACGCCCAACCTGTACCATATTCGAAGAAC TTGAAATCGTTTACCCTGAGAAATCCCGCATTCTAAGTTAATACTAAACT TAACCAAAAACTATTTATTCCCCTAAAAAATACTAGCCGCTAACAATCAT TTATCGCCTAATTTAAATCGTTCATATATGACTAGCCATTGACGTCTCCC AACCTTTAATAAGATAACAATTATCACTAAATTATTTATTATACAGTCGA GTCTTTCTAACTCGAACCTTGATAACTCGTCTTAACTCCCTTCAGGTAAC AATGCTTCATAAACTTTTACTCCACAATTCGAACAAATTTCCGTTCCTCT TGCATGTTCGAGTTATGGAGAATCAAAAGATACTTGAGACTCAATTGTAC CTCATTTTATATTTCAGTTCACTGCAACTGCTAAACAACTCGGTGACCAA CGAAACATGTTGTACCAGAGATCCCGAAGCTTATTATTTCTACGTCACCG CTCTAAATGCTGCTTCATCGATTGAGAGTACTGATGGCAAGGGAATGTCA TGGCAACTGATTCTTTGTTTATTGTTATCATGGGTTCTGGTTTACGCATG CGTGGTAAAAGGTGTGAAGTCCAGTGGTAAAGCAGTATATTTCACGGCTA CTTTTCCATACTTGATTTTGATCATTTTATTGATAGCTGGCGCGTTACTT ACCGGTGCTGATATTGGTTTGGTAGCCTTTTTTAAACCTGATGTAAGTAA TTTTGTTGTTTTTATTTCCTCGTCAAATATCTTCCATAAAAACCAATGTC CGAAAGAACGAAGGGTGTGATAGAAACAGTTTTATTAGATTTGTTTATCA TTCATATGTACATTAATGCCATAGGTAATCAAAATAACCCAAATTAAATT CAATCTAAACTTTTTGAAATTATATAATTTCTATAAGCCATTTCTTGGTC GTGATTTGGAGAGCTTAGCTTATACCCCAGCTGGCACACAACGTTGTTTC AACGTTCATCTAACGTTAAATGGACGTTGTGAACGTTAGAAAAACGTTGA AACAAGGTTGTGTGCCAGCTGGGACAGTTCTCACCATTGAGAGGTCTATT TAACACTGGATCCTGATTAACCGTAAACTACTCAAGACTTATGTTTTCTA TTTATCTTTTTTGTTTCTTTACTATTCAGTTCTCGCGGTTATTGGATCCA AAGATCTGGTTAGATGCAGCTGGTCAAATGTTTTTCACTCTCAGTATTGG GTTTGGTGCTCTACTAGCTTTCGCTTCATACATGCCGACCAAAAATAATT GTATGAAAGATGCTTATACTGTTGTCTCGATTAATTGTTTCACCTCTATT CTGGCTGGTATTGTTGTATTCTCCATTTTGGGACATCGAGAACAAGAGAC CGGTCAAAGTGCAATTGAGGTAATCATAGTTAAATTGATAAAAGTCCCTA TTTTGATAGCGAGTCCACACTTTTGATGAATTGCGGAATAATCTATCTAG GACTTTTAAAAATCATTCGATCGCTTCCACGGCAAGCAGCAGCTGGCTTG GCTATCAATAATGAACTTAGCAATTATTGACAGGAACGAGGCATTGTAAT TTTGTTTTGTGGCACCGACGCCTTAGACCACTCGATCTACGCTCCTTGAA AACACATAAAGTATATTAAAGTATTTCTTACCACAAGAGTAAACCCTTCA CTATTACCGTGAAAAGCACATGGTGGAATCATATCCCGACCTGTGCCGAC AAATCGAGATTTTATTCAGCACGCAATAAACGCAGAGAAAAGTAACCATG ACGAAAATCCAAGACCTTGGATTAAGTTCAAAGTCGATATTTCTATTTGC GTCGTCGAAAACACACTCAAAAATGTGATCAAAGCTTTTTACTGGGAAAC TCGTCAATAGTTAATATATACTGTACTGATGCAGTTTGCTAGACATATGG TAATGTTTGCTCTTCATCTTTGATTCTTTCTACAGTGATCAGATTGATGC ACGCGTGATAAAATTTCTATACTTGGTCGTCAGAGGTCGATATGTTCTTT GAAAACTTAAGCCCCGATACTCAGGATACTTTTACTATTGTTCCTTTATC TACCCCCTCTCCATGGTACATCGAGGTTTAGTTTCATCTTCCTTTTTTCA AATTGGCATATCTTGACTAAAGAAAAACTTCAAATACGACTTGGACTTTC TTGCATTTTAACACGTTGTTCTCAGCGTGGTGTCTCAGTGATTGACAAGC AAATATATCTTAACCACATCCTTCAATTGAAACTTGTCATTCCATTAGAA TGCTCCAATAACGTTTTGGTTTTGGAACATTTNTTGAAACTTGTCATTCC ATTAGAATGCTCCAATAGCGTTTTGGTTTTGGAACATTTAAATAAAAGGG TTTACACTCATTAACTTAACTTTCCCAGATGGTAATTATTCTGATATTGA TTTCAATGATCTTGGTAGATTGGAATTTGAAACTAAGGGTAACATTATTT TCTTGGGTAGCCACTGATAGATTATCATTTCGTTGGCTCTTTAGAATCAC GTGTGAATTTATATATTTTACCATATCCTAGTTTTATTAAGGAGGAGCTA AAAGGCCACACATATTAATCAAATCAGCGTGAACTTTTTTCAAATCTTTT AGATATGTTTGTGTGTTAATAACATTTTTTTAAATCTTTAAAACTGGTCC AAACTGTCCAAAATGACTATTGGTACTAAGAGAAAGTAGATAAAGGTATT TTAAATGAAAAATGAAAAAGAATTGAGTCCATGTTAACGACCTTCAAAAT TCACCATCCAACTCTTTTTTCAAGCAATTCCAAGTAATTTGACATTATTT CTAAAATATTTTCCATCTGGAGTGAATTTCTAAAAATACGTGTGCAAGAA ATATACCACTGACGCTCTCTAGTTCGAGTTTTTAAAATTGTTGATTTCAA TAAAATAAAGCTGTGATTTAGTATCTCCCTCGGTTCTTTCTCCCAATAAC ATGTCAATAAATTGTGTGTCAATATATCTGGTTTGAAATTCAAATTNAAA ATTGTTGATTTCAATAAAATAAAGCTGCGATTTAGTGTCTCCCTCGGTTC TTTCTCCCAAGAACATGTCAATAAATTGTGTGTCAATAAAATCTGGTTTG AAATTCAAATCTTGACATGTCTTTTCTAAGCATTCAAATTTTGAAGGGAC GGTTGCTAACCTGTTTAGAGCACTCCCTTAAAGTTTTTAGCGATATAGCC AGTTTACTGTCGAAGAAAATAAAAATTTTCATAAAATATTGACTTTAAAT TTTTTCCATTTATAGAGTGGCAGCGGTCCAGGTTTAGTTTTCATCACATT TGCCAACGCTTTTCTACAAATGGATGGCGCTCCTTTTTGGGCAGTCTGTT TCTTCGTGATGTTGATCCTCTTGGGAATTGATTCAGAGTTCGGAACATTT GAAGCTTTTGTATATCCTTTTTATGATATGAAATGGATCACCATGAATAA AAGCTTATTTAGTGGTAAGTGTTTTCCTGCATGGTTTTTGTGGAAATATT TTGATTTGGTGTTTTTGATTTTGGACGTCTAGTAATCTAGGAAAGTCATG CAGTTGTTTTCACAGGGTCCACAGCCAGCCGGCTCAGCTCTGCATCAATT TACCAAATAATATTGGAGAGTATGAATTTGGACCAGGAGCCGTTAGTTTG TGGCATCGACTCTTAAGGCTACTCGGACATAGTTCAAGATCAAAAATTTT GATCTCAACCCTGGTTAAGATCTATACGTAATAGGTTTGCATACTTTTTG CTACTATATGGTAACCACTCTCTCGTAAACATGGCCCACCATGGTTGGGC GACGAAGAAAATTTTCGACTTTTTGCCCTTATTTCACCCCTCTAAACGGT ATATATAAGATTTTTCAAAGTAAAAAAAAAATACTTTGCAAAATATTGGG GGGGCCATGGCCCCCCTGGCCCCCCCGGTGACGGGGGCCATGGTAAATTA ATTAATATTATCAAAATGGTATGGCTAACTTAAATTCCACAAGCGCCAAG AAAACGCCGTGTGTGAATTTATATTCTCAATACTGAAGCTGACGACATTG TTATCCTAAGGAAGACAAACTCTCTCTCTCTGACATGCGCGTAGTGGTAT CGCAGTAATCAATCAGATGACATAGTAGTGTCTCAGTTTATCCACGCTTA AATCTACCTCAATTACTGGCGATTACTTTAGGCGTAAAAACTTTCGTGAG CATAAACTTTCGTAACTTCCGTGAAAATCGGCCCTTTTCGTGAACGTAAA TGTCTTTAAAAATTCTTGGAAGGGCCATTCATTCCGAAAAATTATTGACA AAATAAAAAATCTCTAAAACTTCAAACTTTAAATACAATGTAACATTTAT GGTATTTTTAGCCTTTTAAAAGACTAATAAGTTTTAAGGCAAAAGTTTCA AGCCAATCCAAGAAGTATTTGTTTCTCTAAACCATTTTTTATGTGAAAAT TTTCATTTTTGCGTCTTGATTCGCGAAAGTTTTTGCTCGTGAAAACGATT TTTCAAATTCGTGGAAGTAAATACCGTAAATTCGCTATTTTTTGACCTCG TGAAAGCTTATGCTCAGGAAAGTTTTTACGCCTAAAGTAGCATATTGCTG ACACCGGTAAAAAACTGAAAATAGTGTTCAGCCAATCGTTCAATTAGGTA GCATATCAGCATTTTCTGGAAAAGATTCAAGTTAAAGCTTGCTACAATAT AATTAACTCTTTATAATTAATGTGGTAATTGATGAATCTTGATTGTATTT TAATGAAACCATGTTTAGGAAAGAATTTCATGTGCGTTCCGATTCGTCTT TTCGAATACCCTGTCGCTTGGCTTACGTGAAGCAATCACAGTTTTATGTG CCAATGACAAAAATACTTTTAGCATGACTTCAAAGCTTCAATTTGCTAAG AGTTATGCGAAAGAACACTTTTATGATATGCTTAAAATATTAAAATTTAG CCAACTTGAAAGTCGCCTGTGGCTCTTCTATCCATTATGGAGGCCTTTGA TCTCGCTTTTCCTCTTCGTTATTTTCCGACATTCATAGAACCTCGCTTAG TTTTGTATGTAAATTTAATTTTGATTCTAATCATAACGTTCAGCGCGTTA GACCTTCACCTGAGACAAGTTAATTATTGTGGCAACATTTGGTAATGACA AGTCACCTTGAAGACTTCAGAATAATCTCCAAATTGAACGATATACTTTC TCGAAAAGGTCCAAGGGTCTTGGTTTTTAAATTAAAAATCATAAACCATA TTAACTTTGATTAGTAGGTGTAGTAGTGTAGTTGACTTTCACACGGGAGG CCAGGGTCCGAGTCCAACTCAATGCTACGATTCACTTGGCAAGAATGCGC CTTCGCTGGAGTCAATCCAACCACGTTATGGGGATTGGGTAATATACTCT GATATTAGACTGCATGTGGAGGTTCGCCAGACATTGTATCTGTGGTGTCG ATGTTAGTAATCTTGTTCTACCAGGCTTGTTCGAGTAATATCGCCAATAC ATCATGGCTCTGTTGTTTCGCGAACAGAGAATCATCGGTGTCTAGTAATA AGTACCATGATTTTCCTTTTTTTGGAATAGGGAACTATCCCAGGATAGGG CTCATGCCGTTTGCAACGGCGGGATCATCCTTCCTTCCTTCCCGTTCTTT GAGTAAGAACTTGTTCTGTTCCGTTTCGCTCCGGTATGATTTTCGTTACG GATCGAGTGTGTTCATATTGGTTTCGGAACGTTTCGGAGCAAGAAAACGG AGCAGTTCTGTCCCGAAGAAAAAGCTGGAGCGGAACCGTTTCGATCTGTT TGGCTTTGTAACATCTTCCTTTTTGACGTTTCGAATTTTGACGTTCACAC TTGTTTCGGAACTGTTTCGTTTCGGAACGCAACGGAACCGTAACATGTTG ACATGGTCTATGATAGCCTTTTGGCAATACCGACACAACCTTTCGAACTT TCTGTCTACCGTTCATTTTCGTAAAACATAATTTGGCTCAGTTGTAAAGA AACTGTTACTAAAAATGGCTTTAACGACCAGTCAGCAATCATTTTTTGAC ATTTCATTTTTGTGAAATTTCTTTATGACGAAGGTTCTAGATATTTAATA TTTGGACTTAAGCTTTAATCGGAAATTAAAGATGATTATCGATTTCTTTC ACTTTTGTTAAGATAACTCCAATTTGGGTTATGTCCAATTGCTTTCGGAT ACCATTGACGTATATCTTACCCCAAGTTTCTCTTTTCATTTTTCTACGAG GAGCAGTCGTGTTTTTACGCGAATTGACCGATTTTCGATCGCTAATTGAC TTCCTTATACTCCTTTTCATGTGGTTTACACGCTTTTTTTCTATAAGAAT GGTGTAAATCCATTTCATCATATCCTTAACTTTTTTGGGAAAATCATTCT AAAATATTCTTACAGCATTCTTAGGTTTAATTCAGACTTGATTTAACATT TAGTACATACGTCTCAAGCATAAAATGACATTTTTGTGAAAGGAGTGAGT CTTACTTGGGGGTAATTGACAATTTATAACTGAAAATGCTCTAAAAATGG CATTCTTAGCTTGAGTAGCAAAATTCCACCTTTTAGCTATTCTCATCATG GACATTTTTATAAAGTGTATTCTTATATAAAAAAGCGTGTAGCTACTTTC CCTCTACTTTTCCTGACCTGACTGAACTGAAGAAAAGGGTGTCAATAAGA ACATAAAATCAATTATCTAGGGAAAAAATCTTGAAAACATATCCAAAATT TGTCGAATAGATATGATAAGTTCATCCCCGTAGTACACCTCAAAAGGCGA ATTAAATACTCCCTTGTATCAAAATATTAATTGTATTTGGTCAGCTAGCC TTAACAATTCAATTAATAATAACTGTCGACACTCAATTTGAACATTTAAA TGCTTCCTTGTCTAAAATGATAGCAAAACCACTAATTTCTCAGTGGAGAG TTTAACCAACCCATAAAATGCCACTACTCCGTAACTTCAAATTTACAAAT ATTTATCTGTTAGGAGGCTTAAATAACAGAACGGCTTGGGTCACGTTCCC CTAGGTCTAGACCTACCCATGCAGGACCGAAAAATTGAGCGATTTGATAT GATGTCAATGGCACTTATGGGTTAACGGTCGACTGGAGAACAAAAAACAA ATATCTGTTCTTTACCTCCATCGCAGGGCTCTGGCCATAATCTTGATCTT GAAAATGCAGGGACCGAAGATATTGTGACTAATACCCAGCTGGCATACAA CGTTGTTTCAACGTTTATCTAACATTCACAACGGCCATATAACGTTAGAT TAACGTTAAAACAACGTTGTGTGCCAGCTAGGTAAAGAGGCCCTAGTTTG CGCGAAGGGGAGGAAATTTGATTTTGCTGTCTATCTCGAGATAAAGTTTA TGGATGGAAAGAAATTTAACAAATTTCTAGTTTTAATTTCTTAAACAGAT GTCATCAAACTTTTACCAGATTAAGCGTGCTGACGTAAAATTACCATTTA AAAATGAAAAAAACTTACGTAGGAAGGTAGATGATTTGGTCGCATTAATT TGGCTGAACAGGAATTTTTGAATAAAAGCCTTGAAGTCACTACAATTTGG AAAATAGACATCCATGTGACATCCTCTTGCTAAAATACCTCAATAGTTTT CATCTTTATCCTAATAAAGTAGAGAAACCAATATTATCTGAGTCAAAAAT TTCAAATCATAAGTCTGGTTTTAACCCAAATAGAAAAGAAAAAATTTTCC ACTTGGGGCTTTAAACTAAGCGCTTAAATGGAGAAAGGTATATGGAACGT CTTTGGCATCTTTCTATTTGGAACGATTTCATTTGGCAAAAATGATCACT CTCACATAATGATTCAAAAACGATTCAAGTCTAGACAAGCGACCTCGTGT ATTTTTTGGAACCGTTTACTGAATATACTTCGATAAAACCATAGTCATAG GAAAAACATAGGTTTTTCCTATGACTATGGTAATTTAAATTAAAGTTTTA GTCCCCTCAAATGGAAAGAAGCATTATTAAAAGCTCTCTGTATTTCGAGA AATGAATGAATGTGATAAAAACTTGTTTTAGAGTCTGTTTGCCGTTCCCG TCTTGAACGTACGGCTTGCACACAAAGGTTTTGTTTTGTTAAAAAGCAGA GAGTGTTGCTGAACTTGGCCCTGACTGATAAAATTTGGACCTTGTCAGAG CATATTTTGACCCTGTCAGATGCAAAATTTTATATTTTTCCCCAAACTGA CCCTGAAAAGTGGTGAAAAGTACCAAATGTAAACCCTATCAGATACAATC CTCAAAATTTAGTGAAGTCTGACCAACATCACTTCTCTGTGACTGTGCGT TCATTAATAAAGGTTTTTTAGAACGGTTCATTCTGATAAATCCCTTTATT AATTTGAAATTTTATCTTCTACTTCTGCTTTTATTTGCTTTACAGCTCTG GTAGCCATTGGTATGTTTCTGATTGGTTTATGTTTTGTATCACCTGTTGG TTATTACGTCTTCCAAATCTTTGACGATTACTCATTATCATTTGGTCTTC TCGCCGTCGGATTCTTCCAAACCATCAGTGTTTCGTGGGTTTACGGTAAC GATAAGTAAGTGCTTCCACGGGTTTACAGCAACGTCAAGTAAGTGTTTCG ATTATAGGAATGAAAGACTTCTTGAAAGTAAATTTTTCCCTTCCCTGGTG AAAATCGAGTTCTCGTTATCAAAGTTTTCATCTCCAATCTTTTCGTATCC AACTTGCTGTATCTTAAAGCTTATTACCCAGGATTGTACTTTCAGTCTAT TAACTTAGAGTATGTAATACTCAATACATTGCTCCATGTAATATAAATTG CTGACCATTATTATTGATTTCAGGTTTGCAAATGACATTGAGTATATGAC GGGACGTCGTCCATTGAAGTTGTGGTTGATTTGTTGGAAATATATTTCTC CTATAGTCATCATGATTATCATTATCTCCAATATTTATTTGTTATCCATT GGAGAGATGACATACAAAGCTTACGTTGGTTGTTTTGCTGTAAGTCAGCC ATCAATTTTCTACACAGGACAGACCACAGATATCTGTAAAGCCCGAAGGA CTAGATAAACAACTTTAAGCTTTCTCCAGCTAAAAAAAGTTAAGCAAAAA TTTGACTTTTTAAATTTTGTGCCGATGGATAGGATTTAGCATTTTAATTG TTTTCGGAGCGCGAGATGAAAAAAAGTAGGCGGCTAATTTGCATCTCTCA AACCAGTGAAATTACTTGTTGTCACGTGATTTCCTACCGAAACTTGCTTC ACTTTTCATAATTTCATTTCATAATAAAGGCCGTGGATCTAACCCTTCGG GCTTTTACAGATCTGTGGGACAGACCAATTTATTTATTGCTCATGAGTTC ATTTTTATTTCACCCATTTTAAAATTCCGATTTTCCGAAATGCAGTTGAT GCTCTCTCTAATTTGACTTAAAAGAAGAATTGGAAATTATTGAATAAGGT AGCGTATCGACTAGTGGAACGTCGTTTATGAGAGTTTCTTGTTAACGGGG AATTCCAATATTATTGATTAGTGGAGTGTATCGAATAGTAGAGCGTCAAA TAAGAGAGTGTCATCTGGAGTTCAATGTGAGGTAAACAAAAATTCTGAAG CAAACAAAAAAGACTGTTATCTGGAATTTTCTTACCTCCTATTCGACAAA GCTTACATTGAAATTCTTTTCTCAAAATATTAATTTCGATCGAACAAAAA TAAAAATATGCATCTTTTTATTAATTTCGCTTAGCGAAAGTATTACAATA GCCTTTCGCGGCGGCGGTGTCATCGGAAAAAAAATTAGAAAACGAAAGTG CTTGATACGGTGGACGAACTCACTAAATTTAATTTACAAATTACACGCTC GTATAACCACTGACGATTTTCGTGGGTTTTCTTTGGATTACGTCATATAT CTTTCTGTCTTTAGCTCCACAGCTTTGATTTTTTCTTTATTCTCTTATAA GCATATACTTTATAAGAATCAAATCAATAACTCTTGATAGACGGTAATAT ACCTTTCGGTAATTAGTTCTTACAAAGTNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNGATGTAAAGTAGATTTCAAATTGGCTTCAATCT CTACTTCTTGTTTTTCCTATGTAGTTTAAATTCTAGGCGAAATTTTCGAC TTTAAGTCGTCTTGTTCTGATTATAACTGTAAAAGGAATCTTTAGGCTAA GCTCCATTTCTTGAGTTTGTTCATTTCTTAAGTGTGGAGGGCGGTTTCAT TATAGTTTTACAAGATAAAAAACTCATTTTCCACTTTTTTAGGGTTTTGC TGAGCCAGTAATTGAAAAAGAGTACCCAGCATGGGCGAAATTTGTTATTA TTGTGCTTATATGTCTACCAATCGCACCCATCTTTATATACTTCATCAAA GACCTGGTGCAGAACCCACAAGAATGGAAAGACGGTTTCCAAAATCGTTT ATGTCATCCAATAGAATATGCTTTTGATCCAAGTGATTACGATTTGAATC GAAGATATCATATTGAAGATTTGACAATGACAGAGAAAGATCAAAATAAT GCAGCTTCTGCGGAAGAGGAACACGAAATTAAAGTTTAATTATCGTTTCC ATCTGAGGTTAGTTAGACTTCTACTACAAGTTCCAGACATTGAGTTTAGA TTTTTAGAATAATCTTTTTTATGAAAAATTAATGCAACATTTTTAGATTT TTAACGTAATTTGAGAAGAAGAAGAAGAATTATTTTCTGCTACTTAGCTC ATATTAATTTTATTTTCGTAATTAGGTAATAAATTTTTAAAGAATTTAAT ATACAATTTTTAGGTAAGGACTAATAAATTTTGACTGGACACCAGCTGTT ATTTTAAAAACGTTGATAAAAAGGTCAATATAGTTCCATCGTGACTGATG TGATTTTTAACTATTTGACAAAATTCAAGACTCCAGTCCAGGTTTTTTAT GTTTCTTTTCTTATAAAAAGCGTGTATTCAACAAAATTTTTACACCCCTG TGTCACAGACCCAGTGGGACTGGAATCCCAGCCCAACTGAAAAATTTGAC AAAGATTTCGTCCCCAGTGGGAAAATACCCTTGAATTTCAACCTCAATAG AAAATTGACATTGGTTTCATCCCCACTCGAAATTCCATGTTTAAAAATTG TACTACAAAACCATCCCCACTGCGTTTTTTAGCCTTAGAACAATAGAATT TCTATCCCCATTAGGATTTCAATAGGAATTTTTATCCCCACATACTGTGG ACTAAAGTTCCACCAGGGCTGCAAGATAGGGGTGTATTTTTATACAGGTT TTGAAATTGAACCTTGTAATTATCTTTGACGCATTTTCATATCATACATT TTTTTAATTTTATTTTCATGAAACGTTTTTTTTATTTAATTTGAATTTTT TTTAATTTGATACAACTAGAAATCATTTTGTTAGTAAATATATAATAAAG GCAAATTTCATAATGCTCCAAAT
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_001002XLOC_001002Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001937-exon-sc0000012-1575043694:534259..534296TCONS_00001937-exon-sc0000012-1575043694:534259..534296Clytia hemisphaericaexon
TCONS_00001937-exon-sc0000012-1575043694:528018..528215TCONS_00001937-exon-sc0000012-1575043694:528018..528215Clytia hemisphaericaexon
TCONS_00001937-exon-sc0000012-1575043694:527551..527818TCONS_00001937-exon-sc0000012-1575043694:527551..527818Clytia hemisphaericaexon
TCONS_00001937-exon-sc0000012-1575043694:525655..525979TCONS_00001937-exon-sc0000012-1575043694:525655..525979Clytia hemisphaericaexon
TCONS_00001937-exon-sc0000012-1575043694:524978..525217TCONS_00001937-exon-sc0000012-1575043694:524978..525217Clytia hemisphaericaexon
TCONS_00001937-exon-sc0000012-1575043694:522883..523081TCONS_00001937-exon-sc0000012-1575043694:522883..523081Clytia hemisphaericaexon
TCONS_00001937-exon-sc0000012-1575043694:517742..517901TCONS_00001937-exon-sc0000012-1575043694:517742..517901Clytia hemisphaericaexon
TCONS_00001937-exon-sc0000012-1575043694:517308..517473TCONS_00001937-exon-sc0000012-1575043694:517308..517473Clytia hemisphaericaexon
TCONS_00001937-exon-sc0000012-1575043694:513974..515154TCONS_00001937-exon-sc0000012-1575043694:513974..515154Clytia hemisphaericaexon
TCONS_00001937-exon-sc0000012-1510915933:534259..534296TCONS_00001937-exon-sc0000012-1510915933:534259..534296Clytia hemisphaericaexon
TCONS_00001937-exon-sc0000012-1510915933:528018..528215TCONS_00001937-exon-sc0000012-1510915933:528018..528215Clytia hemisphaericaexon
TCONS_00001937-exon-sc0000012-1510915933:527551..527818TCONS_00001937-exon-sc0000012-1510915933:527551..527818Clytia hemisphaericaexon
TCONS_00001937-exon-sc0000012-1510915933:525655..525979TCONS_00001937-exon-sc0000012-1510915933:525655..525979Clytia hemisphaericaexon
TCONS_00001937-exon-sc0000012-1510915933:524978..525217TCONS_00001937-exon-sc0000012-1510915933:524978..525217Clytia hemisphaericaexon
TCONS_00001937-exon-sc0000012-1510915933:522883..523081TCONS_00001937-exon-sc0000012-1510915933:522883..523081Clytia hemisphaericaexon
TCONS_00001937-exon-sc0000012-1510915933:517742..517901TCONS_00001937-exon-sc0000012-1510915933:517742..517901Clytia hemisphaericaexon
TCONS_00001937-exon-sc0000012-1510915933:517308..517473TCONS_00001937-exon-sc0000012-1510915933:517308..517473Clytia hemisphaericaexon
TCONS_00001937-exon-sc0000012-1510915933:513974..515154TCONS_00001937-exon-sc0000012-1510915933:513974..515154Clytia hemisphaericaexon
TCONS_00001937-exon-sc0000012-1491911889:534259..534296TCONS_00001937-exon-sc0000012-1491911889:534259..534296Clytia hemisphaericaexon
TCONS_00001937-exon-sc0000012-1491911889:528018..528215TCONS_00001937-exon-sc0000012-1491911889:528018..528215Clytia hemisphaericaexon
TCONS_00001937-exon-sc0000012-1491911889:527551..527818TCONS_00001937-exon-sc0000012-1491911889:527551..527818Clytia hemisphaericaexon
TCONS_00001937-exon-sc0000012-1491911889:525655..525979TCONS_00001937-exon-sc0000012-1491911889:525655..525979Clytia hemisphaericaexon
TCONS_00001937-exon-sc0000012-1491911889:524978..525217TCONS_00001937-exon-sc0000012-1491911889:524978..525217Clytia hemisphaericaexon
TCONS_00001937-exon-sc0000012-1491911889:522883..523081TCONS_00001937-exon-sc0000012-1491911889:522883..523081Clytia hemisphaericaexon
TCONS_00001937-exon-sc0000012-1491911889:517742..517901TCONS_00001937-exon-sc0000012-1491911889:517742..517901Clytia hemisphaericaexon
TCONS_00001937-exon-sc0000012-1491911889:517308..517473TCONS_00001937-exon-sc0000012-1491911889:517308..517473Clytia hemisphaericaexon
TCONS_00001937-exon-sc0000012-1491911889:513974..515154TCONS_00001937-exon-sc0000012-1491911889:513974..515154Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000012supercontigsc0000012:513974..534296 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0 0.0136134 0.125795 0.124808 0.0258744 0 0.449771 1.01435 1.30273 0.000724281 2.70387 0.491383 0.333231 0.279281 0 0 2.20247e-09 0.000246433 0 4.27702e-10 0.481087 0.0475138 3.39946 2.29089 0 0 26.4038 24.4778 17.3807 13.3379
Blast
BLAST of TCONS_00001937 vs. Swiss-Prot (Human)
Match: S6A18 (Sodium-dependent neutral amino acid transporter B(0)AT3 OS=Homo sapiens GN=SLC6A18 PE=2 SV=2)

HSP 1 Score: 323.553 bits (828), Expect = 7.473e-98
Identity = 221/577 (38.30%), Postives = 317/577 (54.94%), Query Frame = 2
Query:  116 GDETKETWGNKAEFLLASIGLAVGLGNIWRFPYLCQKNGGGAFLIPYLLMMIMEGFPLFFIEYAIGQRFKQSAVGCWGKIHPALRGIGVGSIILSGFLCIYYVAVIAWSFFYLFVSMRKDLPWERNNCPSSLQLLNNSVTNETCCTRDPEAYYFYVTALNAASSIESTDGKGMSWQXXXXXXXXXXXVYACXXXXXXXXXXAVYFTATFPYXXXXXXXXXXXXXXXXXXXXVAFFKPDFSRLLDPKIWLDAAGQMFFTLSIGFGALLAFASYMPTKNNCMKDAYTVVSINCFTSILAGIVVFSILGHREQETGQSAIE-----------------------------------------------------SGSGPGLVFITFANAFLQMDGAPFWAVCFFVMLILLGIDSEFGTFEAFVYPFYDM----KWITMNKSLFSALVAIGMFLIGLCFVSPVGYYVFQIFDDYSLSFGLLAVGFFQTISVSWVYGNDKFANDIEYMTGRRPLKLWLICWKYXXXXXXXXXXXXXXXXXXXGEMTYKAYVGCFAGFAEPVIEKEYPAWAKFVIIVLICLPI 1675
            GDE +  W NKA++LL+  G AVGLGNIWRFPYLCQ  GGGAFLIPY++ ++ EG P+F +E AIGQR ++ +VG W  I P L G+G+G + LS  + +YY  ++AW  +YL  S +  LPW  ++CP     LN +   E C      +Y++Y   LN  + I   D   + W L++CL  SW +VY CV++G++++GK +YFTA FPYL+L I LI G  L GA  GL+  F P+   L +P++WLDAA Q+FF+LS+ FG  +AFASY   +N+C KDA  +  +N  TS+ A I VFS+LG +     +  ++                                                     S SGPGL F+ F    L M GAP WA+ FF ML  LG+ + FGT EA + P  D+    +W+   K   + LV +  FL   CF    G Y  +IFD+++ S  LL + F + + V +VYG  +F +DI +MTGRRP   W + W+ +   +++ I ++ I LL    + YKA+   +  F     EK YP WA+   ++L  LP+
Sbjct:   15 GDE-RPKWDNKAQYLLSCTGFAVGLGNIWRFPYLCQTYGGGAFLIPYVIALVFEGIPIFHVELAIGQRLRKGSVGVWTAISPYLSGVGLGCVTLSFLISLYYNTIVAWVLWYLLNSFQHPLPW--SSCPPD---LNRTGFVEECQGSSAVSYFWYRQTLNITADIN--DSGSIQWWLLICLAASWAVVYMCVIRGIETTGKVIYFTALFPYLVLTIFLIRGLTLPGATKGLIYLFTPNMHILQNPRVWLDAATQIFFSLSLAFGGHIAFASYNSPRNDCQKDAVVIALVNRMTSLYASIAVFSVLGFKATNDYEHCLDRNILSLINDFDFPEQSISRDDYPAVLMHLNATWPKRVAQLPLKACLLEDFLDKSASGPGLAFVVFTETDLHMPGAPVWAMLFFGMLFTLGLSTMFGTVEAVITPLLDVGVLPRWVP--KEALTGLVCLVCFLSATCFTLQSGNYWLEIFDNFAASPNLLMLAFLEVVGVVYVYGMKRFCDDIAWMTGRRPSPYWRLTWR-VVSPLLLTIFVAYIILLFWKPLRYKAWNPKYELFPSRQ-EKLYPGWARAACVLLSLLPV 579          
The following BLAST results are available for this feature:
BLAST of TCONS_00001937 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
S6A187.473e-9838.30Sodium-dependent neutral amino acid transporter B(... [more]
back to top