Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001936 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001936
Unique NameTCONS_00001936
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length2961

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001936 ID=TCONS_00001936|Name=TCONS_00001936|organism=Clytia hemisphaerica|type=transcript|length=2961bp
ATTTAGTAAAGTGAAAGAAGCTAAGTGAAAAGCTAAATAGCAAAGTTTGG
AAAACTGAGTGCTTTTTTGATGCAGGGGTATCTTATAGCTTGAAGCAGTT
CACAagttgttttctgttttttattgGTAGTATCATTATATTGAATACGC
ACGAATGCGAAAGAGATTTTGAGCAGAAACAACTTGCTTGAATAGAGATA
TGACTCTGTTTGGTTGCTGTAGAGGCGATCCAGATGAAAATTTACCCTTA
ACCCAGCAGAACCAGAAGAAGACATCTAATCAAAATGTCGGTACCGTAAA
TGGTGATGAAACCAAGGAAACCTGGGGAAACAAAGCAGAATTTCTATTAG
CTTCAATTGGACTTGCAGTTGGTCTTGGTAACATCTGGAGATTTCCTTAC
TTATGTCAAAAAAATGGAGGAGGTGCTTTTCTTATTCCATATTTACTTAT
GATGATCATGGAAGGTTTCCCTTTGTTCTTCATCGAGTACGCTATTGGTC
AACGCTTCAAACAGAGTGCTGTCGGATGCTGGGGAAAAATCCATCCTGCT
TTGCGAGGAATCGGTGTTGGTTCAATCATTTTATCTggtttcctttgtat
ttattacGTGGCTGTTATTGCTTGGTCCTTCTTTTATCTCTTTGTTTCAA
TGAGGAAAGATTTGCCCTGGGAACGAAATAATTGTCCAAGTTCACTGCAA
CTGCTAAACAACTCGGTGACCAACGAAACATGTTGTACCAGAGATCCCGA
AGCTTATTATTTCTACGTCACCGCTCTAAATGCTGCTTCATCGATTGAGA
GTACTGATGGCAAGGGAATGTCATGGCAACTGATTCTTTGTTTATTGTTA
TCATGGGTTCTGGTTTACGCATGCGTGGTAAAAGGTGTGAAGTCCAGTGG
TAAAGCAGTATATTTCACGGCTACTTTTCCATACTTGATTTTGATCATTT
TATTGATAGCTGGCGCGTTACTTACCGGTGCTGATATTGGTTTGGTagcc
ttttttaaacctgatTTCTCGCGGTTATTGGATCCAAAGATCTGGTTAGA
TGCAGCTGGTCAAATGTTTTTCACTCTCAGTATTGGGTTTGGTGCTCTAC
TAGCTTTCGCTTCATACATGCCGACCAAAAATAATTGTATGAAAGATGCT
TATACTGTTGTCTCGATTAATTGTTTCACCTCTATTCTGGCTGGTATTGT
TGTATTCTCCATTTTGGGACATCGAGAACAAGAGACCGGTCAAAGTGCAA
TTGAGAGTGGCAGCGGTCCAGGTTTAGTTTTCATCACATTTGCCAACGCT
TTTCTACAAATGGATGGCGCTCCTTTTTGGGCAGTCTGTTTCTTCGTGAT
GTTGATCCTCTTGGGAATTGATTCAGAGTTCGGAACATTTGAAGCTTTTG
TATATCCTTTTTATGATATGAAATGGATCACCATGAATAAAAGCTTATTT
AGTGCTCTGGTAGCCATTGGTATGTTTCTGATTGGTTTATGTTTTGTATC
ACCTGTTGGTTATTACGTCTTCCAAATCTTTGACGATTACTCATTATCAT
TTGGTCTTCTCGCCGTCGGATTCTTCCAAACCATCAGTGTTTCGTGGGTT
TACGGTAACGATAAGTTTGCAAATGACATTGAGTATATGACGGGACGTCG
TCCATTGAAGTTGTGGTTGATTTGTTGGAAATATATTTCTCCTATAGTCA
TCATGATTATCATTATCTCCAATATTTATTTGTTATCCATTGGAGAGATG
ACATACAAAGCTTACGTTGGTTGTTTTGCTGGTTTTGCTGAGCCAGTAAT
TGAAAAAGAGTACCCAGCATGGGCGAAATTTGTTATTATTGTGCTTATAT
GTCTACCAATCGCACCCATCTTTATATACTTCATCAAAGACCTGGTGCAG
AACCCACAAGAATGGAAAGACGGTTTCCAAAATCGTTTATGTCATCCAAT
AGAATATGCTTTTGATCCAAGTGATTACGATTTGAATCGAAGATATCATA
TTGAAGATTTGACAATGACAGAGAAAGATCAAAATAATGCAGCTTCTGCG
GAAGAGGAACACGAAATTAAAGTTTAATTATCGTTTCCATCTGAGGTTAG
TTAGACTTCTACTACAAGTTCCAGACATTGAGTTTAGATTTTTAGAATaa
tcttttttatgaaaaattaatgcaacatttttagatttttaacgtaattt
gagaagaagaagaagaattatTTTCTGCTACTTAGCTcatattaatttta
ttttcgtaattaggtaataaatttttaaagaatttaataTACAATTTTTA
GGTAAGGACTAATAAATTTTGACTGGACACCAGCTGTTATTTTAAAAACG
TTGATAAAAAGGTCAATATAGTTCCATCGTGACTGATGTGATTTTTAACT
ATTTGACAAAATTCAAGACTCCAGTCCAGgttttttatgtttcttttctt
ataaaaagcgtgtattcaacaaaatttttacacccctgtgtcacagaccc
agtgggacTGGAATCCCAGCccaactgaaaaatttgacaaagatttcgtc
cccagtgggaaaatacccttgaatttcaacCTCAATAGAAAATTGACATT
ggtttcatccccactcgaaattccatgtttaaaaattgtactacaaaacc
atccccactgcgTTTTTTAgccttagaacaatagaatttctatccccatt
aggatttcaataggaatttttatccccacatACTGTGGACTaaagttcca
ccagggctgCAAGATAGGGGTGTATTTTTATACAGGTTTTGAAATTGAAC
CTTGTAATTATCTTTGACGCATTTTCATATcatacatttttttaatttta
ttttcatgaaacgttttttttatttaatttgaattttttttaatttgata
caaCTAGAAATCATTTTGTTAGTAAATATATAATAAAGGCAAATTTCATA
ATGCtccaaat
Run BLAST on NCBI

protein sequence of TCONS_00001936-protein

>TCONS_00001936-protein ID=TCONS_00001936-protein|Name=TCONS_00001936-protein|organism=Clytia hemisphaerica|type=polypeptide|length=625bp
MTLFGCCRGDPDENLPLTQQNQKKTSNQNVGTVNGDETKETWGNKAEFLL
ASIGLAVGLGNIWRFPYLCQKNGGGAFLIPYLLMMIMEGFPLFFIEYAIG
QRFKQSAVGCWGKIHPALRGIGVGSIILSGFLCIYYVAVIAWSFFYLFVS
MRKDLPWERNNCPSSLQLLNNSVTNETCCTRDPEAYYFYVTALNAASSIE
STDGKGMSWQLILCLLLSWVLVYACVVKGVKSSGKAVYFTATFPYLILII
LLIAGALLTGADIGLVAFFKPDFSRLLDPKIWLDAAGQMFFTLSIGFGAL
LAFASYMPTKNNCMKDAYTVVSINCFTSILAGIVVFSILGHREQETGQSA
IESGSGPGLVFITFANAFLQMDGAPFWAVCFFVMLILLGIDSEFGTFEAF
VYPFYDMKWITMNKSLFSALVAIGMFLIGLCFVSPVGYYVFQIFDDYSLS
FGLLAVGFFQTISVSWVYGNDKFANDIEYMTGRRPLKLWLICWKYISPIV
IMIIIISNIYLLSIGEMTYKAYVGCFAGFAEPVIEKEYPAWAKFVIIVLI
CLPIAPIFIYFIKDLVQNPQEWKDGFQNRLCHPIEYAFDPSDYDLNRRYH
IEDLTMTEKDQNNAASAEEEHEIKV
Run BLAST on NCBI

transcript from alignment at sc0000012:513974..529161-

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001936 ID=TCONS_00001936|Name=TCONS_00001936|organism=Clytia hemisphaerica|type=transcript|length=15188bp|location=Sequence derived from alignment at sc0000012:513974..529161- (Clytia hemisphaerica)
ATTTAGTAAAGTGAAAGAAGCTAAGTGAAAAGCTAAATAGCAAAGTTTGG AAAACTGAGTGCTTTTTTGATGCAGGGGTATCTTATAGCTTGAAGCAGTT CACAAGTTGTTTTCTGTTTTTTATTGGTAGTATCATTATATTGAATACGC ACGAATGCGAAAGAGATTTTGAGCAGAAACAACTTGCTTGAATAGAGATA TGACTCTGTTTGGTTGCTGTAGAGGTTTACTTATTATTACGTCTGCTTTT GGTGTTCATTTCTTCATCGTCAAGTTGTCCGTTACTTTATCGACATAGTG TGCACGTGGTAGCACAATCAATCAATTGATATCAAATACTTTTGCGTTGC ATCATTTAAAATACTGCAATTGATATTTTAACTTGTATAACCATTTTCTC CTTTTTTTCTTCAGAATATTGAGATAAACTATTTTTGATAATCATTTGAT AAGTTTATCTCACGAGTGAGCACGTTGTTAAAATTCCTGGGCTTCGAATG CCTGAAAAGCCATACTCTAAGGATCCTAATGAGGTTTCACCCAAGTACTT CACCATTTCTTTAAAATAATTTCAAAAAAGTTTAAACCTTCGAAAATTAT TTCTTATAATGTTCTTCTTAAAATGTCACCATTTTGTGAGAGTTTTTGTG CAATTTACCAAAATTAAATGTTTTAGAGTCCGCAAAGCCTTAAAATGTTC TTAACTTAATCTTGATATATTTGGCAATAGAGGCATTATGTTCTTCGTTC GTTCTTATAAAAGACGTGTATAATCAAGATAATTCAAAATATATACCTCT ATACCGGAAATGAAGTTTCCGGCAGAACCATCTCCAATATAAGAACTAGT GAACACACACTGAAAGCGAATGGAGTTTTTCATTTTGTAAAATCTCTATT TGTAATTTTTTTGCATATCATTGAAATTAAAGATGGCTTCTTTTAGGCGA TCCAGATGAAAATTTACCCTTAACCCAGCAGAACCAGAAGAAGACATCTA ATCAAAATGTCGGTACCGTAAATGGTGATGAAACCAAGGAAACCTGGGGA AACAAAGCAGAATTTCTATTAGCTTCAATTGGACTTGCAGTTGGTCTTGG TAACATCTGGAGATTTCCTTACTTATGTCAAAAAAATGGAGGAGGTAAAA ATTGGGTTTCTGATATTTGCAGACGCTAAGACTTTCCCATTCCAGGCAAA ATATTATTCCTGTTGCATGTTTCAAAAACTATATTTTGTTGATTTGATGA TGGAAATGGAGACTTTCTTGTGTTTTGAATTATGAATAAAGTCGCTCTTA GGAATCGCTCTGTAAAGCCTAATCAATCTTTCTTCCTTTTCAGGTGCTTT TCTTATTCCATATTTACTTATGATGATCATGGAAGGTTTCCCTTTGTTCT TCATCGAGTACGCTATTGGTCAACGCTTCAAACAGAGTGCTGTCGGATGC TGGGGAAAAATCCATCCTGCTTTGCGAGGAATCGGTGTTGGTTCAATCAT TTTATCTGGTTTCCTTTGTATTTATTACGTGGCTGTTATTGCTTGGTCCT TCTTTTATCTCTTTGTTTCAATGAGGAAAGATTTGCCCTGGGAACGAAAT AATTGTCCAAGGTATGACTAAGATCATAAAATTATTTTATAGCCTGTTTT AAGTAGGTTACAACTTTGAATCTTTGAAAAAAAAGTTCATTTTGTGACAA TGAAATTGGGCGATAGATATAATGAAACTAAAGTAATGGTATTAAAAAGG CAAGTTACGTGAAGTTTTTCTTTTTACATGGTACCAGTACACGTTTTTTT TATTAGAACCTAGTTTATAAGAACATTGAGGCTGAAATTCGTCGAAAAAT TAAGAACATCGTAAGAACATGCCCAGTCTAAGTTTTGAAAAAAATGACAA GAAACTACAATTTTTCCTCTTTTCAAGCAGTTTTAACCGAACATAGGCGT GGATTTTCTAAAATCGAGAGTCAAATATTGTCCAAATTTTACCAATTTTA AGTGCTCTTTATTTTGCACGATATTGTCGATATAGAGTAGACTGAAAAAT TAAGAACGCATTTAAGAACATTTTAGGCTGAGAATTGCTAAAAAAATAAG CACCTCCAGGCTCAGCCAAATTTTAGGTGTTCTAATAAAAAAAACGTGTA TATTTCTACTTAATGAGGACTTTGATTAACCTTATACCATGTGCCATATC TTAAGTTAAAAGTTATGACTAATCGTAAAGGACCTCAGAAGGCTTTTCCA AGTGTTCTTTAAAGATTTCACATCGAAAAGCAACATTAACTGCTTAAATA AACAAGGAACTGTAAAGACAGCGAGATTTGCGGTTTTCGTTTCCAGGGAA TTTTTGTGTCATTTATGTATTTTATGCTTTCCTGTTTCCAAGTATCTTTG GGAGGAGTCTTTTGACATTATAGTACATAACAATATTGACAAAAATAGTG AAGTGGAATATCGGATCTACACGTTTTTTATAAGAACATCCAAAATTTTT AAAGCCTTCGGATGTTCTTAACTTTTTGGGTTTAAAGCCTAAAAGTGTTC TTAAAATGTTCTTATTTTCGCCAGTTTCTGACCATTTTTACCCACTTTCC TAAAACATCGGGTATTTTCGAGTCTGCAAAGCCTTAAAAATGTTCTCAAC TTGTTATTAGTATTTTGGCCTTATGTTCTTATATAGTTTGCTCTTATAAA AAAACATGTACCTGTTGTAGATTATGGCATAGAGATAAAAATTTCGACGC CGTCACTTTCTTGAAAATATTTCTATCTACAATATCACGCCCAACCTGTA CCATATTCGAAGAACTTGAAATCGTTTACCCTGAGAAATCCCGCATTCTA AGTTAATACTAAACTTAACCAAAAACTATTTATTCCCCTAAAAAATACTA GCCGCTAACAATCATTTATCGCCTAATTTAAATCGTTCATATATGACTAG CCATTGACGTCTCCCAACCTTTAATAAGATAACAATTATCACTAAATTAT TTATTATACAGTCGAGTCTTTCTAACTCGAACCTTGATAACTCGTCTTAA CTCCCTTCAGGTAACAATGCTTCATAAACTTTTACTCCACAATTCGAACA AATTTCCGTTCCTCTTGCATGTTCGAGTTATGGAGAATCAAAAGATACTT GAGACTCAATTGTACCTCATTTTATATTTCAGTTCACTGCAACTGCTAAA CAACTCGGTGACCAACGAAACATGTTGTACCAGAGATCCCGAAGCTTATT ATTTCTACGTCACCGCTCTAAATGCTGCTTCATCGATTGAGAGTACTGAT GGCAAGGGAATGTCATGGCAACTGATTCTTTGTTTATTGTTATCATGGGT TCTGGTTTACGCATGCGTGGTAAAAGGTGTGAAGTCCAGTGGTAAAGCAG TATATTTCACGGCTACTTTTCCATACTTGATTTTGATCATTTTATTGATA GCTGGCGCGTTACTTACCGGTGCTGATATTGGTTTGGTAGCCTTTTTTAA ACCTGATGTAAGTAATTTTGTTGTTTTTATTTCCTCGTCAAATATCTTCC ATAAAAACCAATGTCCGAAAGAACGAAGGGTGTGATAGAAACAGTTTTAT TAGATTTGTTTATCATTCATATGTACATTAATGCCATAGGTAATCAAAAT AACCCAAATTAAATTCAATCTAAACTTTTTGAAATTATATAATTTCTATA AGCCATTTCTTGGTCGTGATTTGGAGAGCTTAGCTTATACCCCAGCTGGC ACACAACGTTGTTTCAACGTTCATCTAACGTTAAATGGACGTTGTGAACG TTAGAAAAACGTTGAAACAAGGTTGTGTGCCAGCTGGGACAGTTCTCACC ATTGAGAGGTCTATTTAACACTGGATCCTGATTAACCGTAAACTACTCAA GACTTATGTTTTCTATTTATCTTTTTTGTTTCTTTACTATTCAGTTCTCG CGGTTATTGGATCCAAAGATCTGGTTAGATGCAGCTGGTCAAATGTTTTT CACTCTCAGTATTGGGTTTGGTGCTCTACTAGCTTTCGCTTCATACATGC CGACCAAAAATAATTGTATGAAAGATGCTTATACTGTTGTCTCGATTAAT TGTTTCACCTCTATTCTGGCTGGTATTGTTGTATTCTCCATTTTGGGACA TCGAGAACAAGAGACCGGTCAAAGTGCAATTGAGGTAATCATAGTTAAAT TGATAAAAGTCCCTATTTTGATAGCGAGTCCACACTTTTGATGAATTGCG GAATAATCTATCTAGGACTTTTAAAAATCATTCGATCGCTTCCACGGCAA GCAGCAGCTGGCTTGGCTATCAATAATGAACTTAGCAATTATTGACAGGA ACGAGGCATTGTAATTTTGTTTTGTGGCACCGACGCCTTAGACCACTCGA TCTACGCTCCTTGAAAACACATAAAGTATATTAAAGTATTTCTTACCACA AGAGTAAACCCTTCACTATTACCGTGAAAAGCACATGGTGGAATCATATC CCGACCTGTGCCGACAAATCGAGATTTTATTCAGCACGCAATAAACGCAG AGAAAAGTAACCATGACGAAAATCCAAGACCTTGGATTAAGTTCAAAGTC GATATTTCTATTTGCGTCGTCGAAAACACACTCAAAAATGTGATCAAAGC TTTTTACTGGGAAACTCGTCAATAGTTAATATATACTGTACTGATGCAGT TTGCTAGACATATGGTAATGTTTGCTCTTCATCTTTGATTCTTTCTACAG TGATCAGATTGATGCACGCGTGATAAAATTTCTATACTTGGTCGTCAGAG GTCGATATGTTCTTTGAAAACTTAAGCCCCGATACTCAGGATACTTTTAC TATTGTTCCTTTATCTACCCCCTCTCCATGGTACATCGAGGTTTAGTTTC ATCTTCCTTTTTTCAAATTGGCATATCTTGACTAAAGAAAAACTTCAAAT ACGACTTGGACTTTCTTGCATTTTAACACGTTGTTCTCAGCGTGGTGTCT CAGTGATTGACAAGCAAATATATCTTAACCACATCCTTCAATTGAAACTT GTCATTCCATTAGAATGCTCCAATAACGTTTTGGTTTTGGAACATTTNTT GAAACTTGTCATTCCATTAGAATGCTCCAATAGCGTTTTGGTTTTGGAAC ATTTAAATAAAAGGGTTTACACTCATTAACTTAACTTTCCCAGATGGTAA TTATTCTGATATTGATTTCAATGATCTTGGTAGATTGGAATTTGAAACTA AGGGTAACATTATTTTCTTGGGTAGCCACTGATAGATTATCATTTCGTTG GCTCTTTAGAATCACGTGTGAATTTATATATTTTACCATATCCTAGTTTT ATTAAGGAGGAGCTAAAAGGCCACACATATTAATCAAATCAGCGTGAACT TTTTTCAAATCTTTTAGATATGTTTGTGTGTTAATAACATTTTTTTAAAT CTTTAAAACTGGTCCAAACTGTCCAAAATGACTATTGGTACTAAGAGAAA GTAGATAAAGGTATTTTAAATGAAAAATGAAAAAGAATTGAGTCCATGTT AACGACCTTCAAAATTCACCATCCAACTCTTTTTTCAAGCAATTCCAAGT AATTTGACATTATTTCTAAAATATTTTCCATCTGGAGTGAATTTCTAAAA ATACGTGTGCAAGAAATATACCACTGACGCTCTCTAGTTCGAGTTTTTAA AATTGTTGATTTCAATAAAATAAAGCTGTGATTTAGTATCTCCCTCGGTT CTTTCTCCCAATAACATGTCAATAAATTGTGTGTCAATATATCTGGTTTG AAATTCAAATTNAAAATTGTTGATTTCAATAAAATAAAGCTGCGATTTAG TGTCTCCCTCGGTTCTTTCTCCCAAGAACATGTCAATAAATTGTGTGTCA ATAAAATCTGGTTTGAAATTCAAATCTTGACATGTCTTTTCTAAGCATTC AAATTTTGAAGGGACGGTTGCTAACCTGTTTAGAGCACTCCCTTAAAGTT TTTAGCGATATAGCCAGTTTACTGTCGAAGAAAATAAAAATTTTCATAAA ATATTGACTTTAAATTTTTTCCATTTATAGAGTGGCAGCGGTCCAGGTTT AGTTTTCATCACATTTGCCAACGCTTTTCTACAAATGGATGGCGCTCCTT TTTGGGCAGTCTGTTTCTTCGTGATGTTGATCCTCTTGGGAATTGATTCA GAGTTCGGAACATTTGAAGCTTTTGTATATCCTTTTTATGATATGAAATG GATCACCATGAATAAAAGCTTATTTAGTGGTAAGTGTTTTCCTGCATGGT TTTTGTGGAAATATTTTGATTTGGTGTTTTTGATTTTGGACGTCTAGTAA TCTAGGAAAGTCATGCAGTTGTTTTCACAGGGTCCACAGCCAGCCGGCTC AGCTCTGCATCAATTTACCAAATAATATTGGAGAGTATGAATTTGGACCA GGAGCCGTTAGTTTGTGGCATCGACTCTTAAGGCTACTCGGACATAGTTC AAGATCAAAAATTTTGATCTCAACCCTGGTTAAGATCTATACGTAATAGG TTTGCATACTTTTTGCTACTATATGGTAACCACTCTCTCGTAAACATGGC CCACCATGGTTGGGCGACGAAGAAAATTTTCGACTTTTTGCCCTTATTTC ACCCCTCTAAACGGTATATATAAGATTTTTCAAAGTAAAAAAAAAATACT TTGCAAAATATTGGGGGGGCCATGGCCCCCCTGGCCCCCCCGGTGACGGG GGCCATGGTAAATTAATTAATATTATCAAAATGGTATGGCTAACTTAAAT TCCACAAGCGCCAAGAAAACGCCGTGTGTGAATTTATATTCTCAATACTG AAGCTGACGACATTGTTATCCTAAGGAAGACAAACTCTCTCTCTCTGACA TGCGCGTAGTGGTATCGCAGTAATCAATCAGATGACATAGTAGTGTCTCA GTTTATCCACGCTTAAATCTACCTCAATTACTGGCGATTACTTTAGGCGT AAAAACTTTCGTGAGCATAAACTTTCGTAACTTCCGTGAAAATCGGCCCT TTTCGTGAACGTAAATGTCTTTAAAAATTCTTGGAAGGGCCATTCATTCC GAAAAATTATTGACAAAATAAAAAATCTCTAAAACTTCAAACTTTAAATA CAATGTAACATTTATGGTATTTTTAGCCTTTTAAAAGACTAATAAGTTTT AAGGCAAAAGTTTCAAGCCAATCCAAGAAGTATTTGTTTCTCTAAACCAT TTTTTATGTGAAAATTTTCATTTTTGCGTCTTGATTCGCGAAAGTTTTTG CTCGTGAAAACGATTTTTCAAATTCGTGGAAGTAAATACCGTAAATTCGC TATTTTTTGACCTCGTGAAAGCTTATGCTCAGGAAAGTTTTTACGCCTAA AGTAGCATATTGCTGACACCGGTAAAAAACTGAAAATAGTGTTCAGCCAA TCGTTCAATTAGGTAGCATATCAGCATTTTCTGGAAAAGATTCAAGTTAA AGCTTGCTACAATATAATTAACTCTTTATAATTAATGTGGTAATTGATGA ATCTTGATTGTATTTTAATGAAACCATGTTTAGGAAAGAATTTCATGTGC GTTCCGATTCGTCTTTTCGAATACCCTGTCGCTTGGCTTACGTGAAGCAA TCACAGTTTTATGTGCCAATGACAAAAATACTTTTAGCATGACTTCAAAG CTTCAATTTGCTAAGAGTTATGCGAAAGAACACTTTTATGATATGCTTAA AATATTAAAATTTAGCCAACTTGAAAGTCGCCTGTGGCTCTTCTATCCAT TATGGAGGCCTTTGATCTCGCTTTTCCTCTTCGTTATTTTCCGACATTCA TAGAACCTCGCTTAGTTTTGTATGTAAATTTAATTTTGATTCTAATCATA ACGTTCAGCGCGTTAGACCTTCACCTGAGACAAGTTAATTATTGTGGCAA CATTTGGTAATGACAAGTCACCTTGAAGACTTCAGAATAATCTCCAAATT GAACGATATACTTTCTCGAAAAGGTCCAAGGGTCTTGGTTTTTAAATTAA AAATCATAAACCATATTAACTTTGATTAGTAGGTGTAGTAGTGTAGTTGA CTTTCACACGGGAGGCCAGGGTCCGAGTCCAACTCAATGCTACGATTCAC TTGGCAAGAATGCGCCTTCGCTGGAGTCAATCCAACCACGTTATGGGGAT TGGGTAATATACTCTGATATTAGACTGCATGTGGAGGTTCGCCAGACATT GTATCTGTGGTGTCGATGTTAGTAATCTTGTTCTACCAGGCTTGTTCGAG TAATATCGCCAATACATCATGGCTCTGTTGTTTCGCGAACAGAGAATCAT CGGTGTCTAGTAATAAGTACCATGATTTTCCTTTTTTTGGAATAGGGAAC TATCCCAGGATAGGGCTCATGCCGTTTGCAACGGCGGGATCATCCTTCCT TCCTTCCCGTTCTTTGAGTAAGAACTTGTTCTGTTCCGTTTCGCTCCGGT ATGATTTTCGTTACGGATCGAGTGTGTTCATATTGGTTTCGGAACGTTTC GGAGCAAGAAAACGGAGCAGTTCTGTCCCGAAGAAAAAGCTGGAGCGGAA CCGTTTCGATCTGTTTGGCTTTGTAACATCTTCCTTTTTGACGTTTCGAA TTTTGACGTTCACACTTGTTTCGGAACTGTTTCGTTTCGGAACGCAACGG AACCGTAACATGTTGACATGGTCTATGATAGCCTTTTGGCAATACCGACA CAACCTTTCGAACTTTCTGTCTACCGTTCATTTTCGTAAAACATAATTTG GCTCAGTTGTAAAGAAACTGTTACTAAAAATGGCTTTAACGACCAGTCAG CAATCATTTTTTGACATTTCATTTTTGTGAAATTTCTTTATGACGAAGGT TCTAGATATTTAATATTTGGACTTAAGCTTTAATCGGAAATTAAAGATGA TTATCGATTTCTTTCACTTTTGTTAAGATAACTCCAATTTGGGTTATGTC CAATTGCTTTCGGATACCATTGACGTATATCTTACCCCAAGTTTCTCTTT TCATTTTTCTACGAGGAGCAGTCGTGTTTTTACGCGAATTGACCGATTTT CGATCGCTAATTGACTTCCTTATACTCCTTTTCATGTGGTTTACACGCTT TTTTTCTATAAGAATGGTGTAAATCCATTTCATCATATCCTTAACTTTTT TGGGAAAATCATTCTAAAATATTCTTACAGCATTCTTAGGTTTAATTCAG ACTTGATTTAACATTTAGTACATACGTCTCAAGCATAAAATGACATTTTT GTGAAAGGAGTGAGTCTTACTTGGGGGTAATTGACAATTTATAACTGAAA ATGCTCTAAAAATGGCATTCTTAGCTTGAGTAGCAAAATTCCACCTTTTA GCTATTCTCATCATGGACATTTTTATAAAGTGTATTCTTATATAAAAAAG CGTGTAGCTACTTTCCCTCTACTTTTCCTGACCTGACTGAACTGAAGAAA AGGGTGTCAATAAGAACATAAAATCAATTATCTAGGGAAAAAATCTTGAA AACATATCCAAAATTTGTCGAATAGATATGATAAGTTCATCCCCGTAGTA CACCTCAAAAGGCGAATTAAATACTCCCTTGTATCAAAATATTAATTGTA TTTGGTCAGCTAGCCTTAACAATTCAATTAATAATAACTGTCGACACTCA ATTTGAACATTTAAATGCTTCCTTGTCTAAAATGATAGCAAAACCACTAA TTTCTCAGTGGAGAGTTTAACCAACCCATAAAATGCCACTACTCCGTAAC TTCAAATTTACAAATATTTATCTGTTAGGAGGCTTAAATAACAGAACGGC TTGGGTCACGTTCCCCTAGGTCTAGACCTACCCATGCAGGACCGAAAAAT TGAGCGATTTGATATGATGTCAATGGCACTTATGGGTTAACGGTCGACTG GAGAACAAAAAACAAATATCTGTTCTTTACCTCCATCGCAGGGCTCTGGC CATAATCTTGATCTTGAAAATGCAGGGACCGAAGATATTGTGACTAATAC CCAGCTGGCATACAACGTTGTTTCAACGTTTATCTAACATTCACAACGGC CATATAACGTTAGATTAACGTTAAAACAACGTTGTGTGCCAGCTAGGTAA AGAGGCCCTAGTTTGCGCGAAGGGGAGGAAATTTGATTTTGCTGTCTATC TCGAGATAAAGTTTATGGATGGAAAGAAATTTAACAAATTTCTAGTTTTA ATTTCTTAAACAGATGTCATCAAACTTTTACCAGATTAAGCGTGCTGACG TAAAATTACCATTTAAAAATGAAAAAAACTTACGTAGGAAGGTAGATGAT TTGGTCGCATTAATTTGGCTGAACAGGAATTTTTGAATAAAAGCCTTGAA GTCACTACAATTTGGAAAATAGACATCCATGTGACATCCTCTTGCTAAAA TACCTCAATAGTTTTCATCTTTATCCTAATAAAGTAGAGAAACCAATATT ATCTGAGTCAAAAATTTCAAATCATAAGTCTGGTTTTAACCCAAATAGAA AAGAAAAAATTTTCCACTTGGGGCTTTAAACTAAGCGCTTAAATGGAGAA AGGTATATGGAACGTCTTTGGCATCTTTCTATTTGGAACGATTTCATTTG GCAAAAATGATCACTCTCACATAATGATTCAAAAACGATTCAAGTCTAGA CAAGCGACCTCGTGTATTTTTTGGAACCGTTTACTGAATATACTTCGATA AAACCATAGTCATAGGAAAAACATAGGTTTTTCCTATGACTATGGTAATT TAAATTAAAGTTTTAGTCCCCTCAAATGGAAAGAAGCATTATTAAAAGCT CTCTGTATTTCGAGAAATGAATGAATGTGATAAAAACTTGTTTTAGAGTC TGTTTGCCGTTCCCGTCTTGAACGTACGGCTTGCACACAAAGGTTTTGTT TTGTTAAAAAGCAGAGAGTGTTGCTGAACTTGGCCCTGACTGATAAAATT TGGACCTTGTCAGAGCATATTTTGACCCTGTCAGATGCAAAATTTTATAT TTTTCCCCAAACTGACCCTGAAAAGTGGTGAAAAGTACCAAATGTAAACC CTATCAGATACAATCCTCAAAATTTAGTGAAGTCTGACCAACATCACTTC TCTGTGACTGTGCGTTCATTAATAAAGGTTTTTTAGAACGGTTCATTCTG ATAAATCCCTTTATTAATTTGAAATTTTATCTTCTACTTCTGCTTTTATT TGCTTTACAGCTCTGGTAGCCATTGGTATGTTTCTGATTGGTTTATGTTT TGTATCACCTGTTGGTTATTACGTCTTCCAAATCTTTGACGATTACTCAT TATCATTTGGTCTTCTCGCCGTCGGATTCTTCCAAACCATCAGTGTTTCG TGGGTTTACGGTAACGATAAGTAAGTGCTTCCACGGGTTTACAGCAACGT CAAGTAAGTGTTTCGATTATAGGAATGAAAGACTTCTTGAAAGTAAATTT TTCCCTTCCCTGGTGAAAATCGAGTTCTCGTTATCAAAGTTTTCATCTCC AATCTTTTCGTATCCAACTTGCTGTATCTTAAAGCTTATTACCCAGGATT GTACTTTCAGTCTATTAACTTAGAGTATGTAATACTCAATACATTGCTCC ATGTAATATAAATTGCTGACCATTATTATTGATTTCAGGTTTGCAAATGA CATTGAGTATATGACGGGACGTCGTCCATTGAAGTTGTGGTTGATTTGTT GGAAATATATTTCTCCTATAGTCATCATGATTATCATTATCTCCAATATT TATTTGTTATCCATTGGAGAGATGACATACAAAGCTTACGTTGGTTGTTT TGCTGTAAGTCAGCCATCAATTTTCTACACAGGACAGACCACAGATATCT GTAAAGCCCGAAGGACTAGATAAACAACTTTAAGCTTTCTCCAGCTAAAA AAAGTTAAGCAAAAATTTGACTTTTTAAATTTTGTGCCGATGGATAGGAT TTAGCATTTTAATTGTTTTCGGAGCGCGAGATGAAAAAAAGTAGGCGGCT AATTTGCATCTCTCAAACCAGTGAAATTACTTGTTGTCACGTGATTTCCT ACCGAAACTTGCTTCACTTTTCATAATTTCATTTCATAATAAAGGCCGTG GATCTAACCCTTCGGGCTTTTACAGATCTGTGGGACAGACCAATTTATTT ATTGCTCATGAGTTCATTTTTATTTCACCCATTTTAAAATTCCGATTTTC CGAAATGCAGTTGATGCTCTCTCTAATTTGACTTAAAAGAAGAATTGGAA ATTATTGAATAAGGTAGCGTATCGACTAGTGGAACGTCGTTTATGAGAGT TTCTTGTTAACGGGGAATTCCAATATTATTGATTAGTGGAGTGTATCGAA TAGTAGAGCGTCAAATAAGAGAGTGTCATCTGGAGTTCAATGTGAGGTAA ACAAAAATTCTGAAGCAAACAAAAAAGACTGTTATCTGGAATTTTCTTAC CTCCTATTCGACAAAGCTTACATTGAAATTCTTTTCTCAAAATATTAATT TCGATCGAACAAAAATAAAAATATGCATCTTTTTATTAATTTCGCTTAGC GAAAGTATTACAATAGCCTTTCGCGGCGGCGGTGTCATCGGAAAAAAAAT TAGAAAACGAAAGTGCTTGATACGGTGGACGAACTCACTAAATTTAATTT ACAAATTACACGCTCGTATAACCACTGACGATTTTCGTGGGTTTTCTTTG GATTACGTCATATATCTTTCTGTCTTTAGCTCCACAGCTTTGATTTTTTC TTTATTCTCTTATAAGCATATACTTTATAAGAATCAAATCAATAACTCTT GATAGACGGTAATATACCTTTCGGTAATTAGTTCTTACAAAGTNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGATGTAAAGTAGATTTCA AATTGGCTTCAATCTCTACTTCTTGTTTTTCCTATGTAGTTTAAATTCTA GGCGAAATTTTCGACTTTAAGTCGTCTTGTTCTGATTATAACTGTAAAAG GAATCTTTAGGCTAAGCTCCATTTCTTGAGTTTGTTCATTTCTTAAGTGT GGAGGGCGGTTTCATTATAGTTTTACAAGATAAAAAACTCATTTTCCACT TTTTTAGGGTTTTGCTGAGCCAGTAATTGAAAAAGAGTACCCAGCATGGG CGAAATTTGTTATTATTGTGCTTATATGTCTACCAATCGCACCCATCTTT ATATACTTCATCAAAGACCTGGTGCAGAACCCACAAGAATGGAAAGACGG TTTCCAAAATCGTTTATGTCATCCAATAGAATATGCTTTTGATCCAAGTG ATTACGATTTGAATCGAAGATATCATATTGAAGATTTGACAATGACAGAG AAAGATCAAAATAATGCAGCTTCTGCGGAAGAGGAACACGAAATTAAAGT TTAATTATCGTTTCCATCTGAGGTTAGTTAGACTTCTACTACAAGTTCCA GACATTGAGTTTAGATTTTTAGAATAATCTTTTTTATGAAAAATTAATGC AACATTTTTAGATTTTTAACGTAATTTGAGAAGAAGAAGAAGAATTATTT TCTGCTACTTAGCTCATATTAATTTTATTTTCGTAATTAGGTAATAAATT TTTAAAGAATTTAATATACAATTTTTAGGTAAGGACTAATAAATTTTGAC TGGACACCAGCTGTTATTTTAAAAACGTTGATAAAAAGGTCAATATAGTT CCATCGTGACTGATGTGATTTTTAACTATTTGACAAAATTCAAGACTCCA GTCCAGGTTTTTTATGTTTCTTTTCTTATAAAAAGCGTGTATTCAACAAA ATTTTTACACCCCTGTGTCACAGACCCAGTGGGACTGGAATCCCAGCCCA ACTGAAAAATTTGACAAAGATTTCGTCCCCAGTGGGAAAATACCCTTGAA TTTCAACCTCAATAGAAAATTGACATTGGTTTCATCCCCACTCGAAATTC CATGTTTAAAAATTGTACTACAAAACCATCCCCACTGCGTTTTTTAGCCT TAGAACAATAGAATTTCTATCCCCATTAGGATTTCAATAGGAATTTTTAT CCCCACATACTGTGGACTAAAGTTCCACCAGGGCTGCAAGATAGGGGTGT ATTTTTATACAGGTTTTGAAATTGAACCTTGTAATTATCTTTGACGCATT TTCATATCATACATTTTTTTAATTTTATTTTCATGAAACGTTTTTTTTAT TTAATTTGAATTTTTTTTAATTTGATACAACTAGAAATCATTTTGTTAGT AAATATATAATAAAGGCAAATTTCATAATGCTCCAAAT

Coding sequence (CDS) from alignment at sc0000012:513974..529161-

>TCONS_00001936 ID=TCONS_00001936|Name=TCONS_00001936|organism=Clytia hemisphaerica|type=CDS|length=16902bp|location=Sequence derived from alignment at sc0000012:513974..529161- (Clytia hemisphaerica)
GGTTTTGCTGAGCCAGTAATTGAAAAAGAGTACCCAGCATGGGCGAAATT
TGTTATTATTGTGCTTATATGTCTACCAATCGCACCCATCTTTATATACT
TCATCAAAGACCTGGTGCAGAACCCACAAGAATGGAAAGACGGTTTCCAA
AATCGTTTATGTCATCCAATAGAATATGCTTTTGATCCAAGTGATTACGA
TTTGAATCGAAGATATCATATTGAAGATTTGACAATGACAGAGAAAGATC
AAAATAATGCAGCTTCTGCGGAAGAGGAACACGAAATTAAAGTTTAAGTT
TGCAAATGACATTGAGTATATGACGGGACGTCGTCCATTGAAGTTGTGGT
TGATTTGTTGGAAATATATTTCTCCTATAGTCATCATGATTATCATTATC
TCCAATATTTATTTGTTATCCATTGGAGAGATGACATACAAAGCTTACGT
TGGTTGTTTTGCTCTCTGGTAGCCATTGGTATGTTTCTGATTGGTTTATG
TTTTGTATCACCTGTTGGTTATTACGTCTTCCAAATCTTTGACGATTACT
CATTATCATTTGGTCTTCTCGCCGTCGGATTCTTCCAAACCATCAGTGTT
TCGTGGGTTTACGGTAACGATAAAGTGGCAGCGGTCCAGGTTTAGTTTTC
ATCACATTTGCCAACGCTTTTCTACAAATGGATGGCGCTCCTTTTTGGGC
AGTCTGTTTCTTCGTGATGTTGATCCTCTTGGGAATTGATTCAGAGTTCG
GAACATTTGAAGCTTTTGTATATCCTTTTTATGATATGAAATGGATCACC
ATGAATAAAAGCTTATTTAGTGTTCTCGCGGTTATTGGATCCAAAGATCT
GGTTAGATGCAGCTGGTCAAATGTTTTTCACTCTCAGTATTGGGTTTGGT
GCTCTACTAGCTTTCGCTTCATACATGCCGACCAAAAATAATTGTATGAA
AGATGCTTATACTGTTGTCTCGATTAATTGTTTCACCTCTATTCTGGCTG
GTATTGTTGTATTCTCCATTTTGGGACATCGAGAACAAGAGACCGGTCAA
AGTGCAATTGAGTTCACTGCAACTGCTAAACAACTCGGTGACCAACGAAA
CATGTTGTACCAGAGATCCCGAAGCTTATTATTTCTACGTCACCGCTCTA
AATGCTGCTTCATCGATTGAGAGTACTGATGGCAAGGGAATGTCATGGCA
ACTGATTCTTTGTTTATTGTTATCATGGGTTCTGGTTTACGCATGCGTGG
TAAAAGGTGTGAAGTCCAGTGGTAAAGCAGTATATTTCACGGCTACTTTT
CCATACTTGATTTTGATCATTTTATTGATAGCTGGCGCGTTACTTACCGG
TGCTGATATTGGTTTGGTAGCCTTTTTTAAACCTGATGTGCTTTTCTTAT
TCCATATTTACTTATGATGATCATGGAAGGTTTCCCTTTGTTCTTCATCG
AGTACGCTATTGGTCAACGCTTCAAACAGAGTGCTGTCGGATGCTGGGGA
AAAATCCATCCTGCTTTGCGAGGAATCGGTGTTGGTTCAATCATTTTATC
TGGTTTCCTTTGTATTTATTACGTGGCTGTTATTGCTTGGTCCTTCTTTT
ATCTCTTTGTTTCAATGAGGAAAGATTTGCCCTGGGAACGAAATAATTGT
CCAAGGCGATCCAGATGAAAATTTACCCTTAACCCAGCAGAACCAGAAGA
AGACATCTAATCAAAATGTCGGTACCGTAAATGGTGATGAAACCAAGGAA
ACCTGGGGAAACAAAGCAGAATTTCTATTAGCTTCAATTGGACTTGCAGT
TGGTCTTGGTAACATCTGGAGATTTCCTTACTTATGTCAAAAAAATGGAG
GAGATGACTCTGTTTGGTTGCTGTAGAGGGTTTTGCTGAGCCAGTAATTG
AAAAAGAGTACCCAGCATGGGCGAAATTTGTTATTATTGTGCTTATATGT
CTACCAATCGCACCCATCTTTATATACTTCATCAAAGACCTGGTGCAGAA
CCCACAAGAATGGAAAGACGGTTTCCAAAATCGTTTATGTCATCCAATAG
AATATGCTTTTGATCCAAGTGATTACGATTTGAATCGAAGATATCATATT
GAAGATTTGACAATGACAGAGAAAGATCAAAATAATGCAGCTTCTGCGGA
AGAGGAACACGAAATTAAAGTTTAAGTTTGCAAATGACATTGAGTATATG
ACGGGACGTCGTCCATTGAAGTTGTGGTTGATTTGTTGGAAATATATTTC
TCCTATAGTCATCATGATTATCATTATCTCCAATATTTATTTGTTATCCA
TTGGAGAGATGACATACAAAGCTTACGTTGGTTGTTTTGCTCTCTGGTAG
CCATTGGTATGTTTCTGATTGGTTTATGTTTTGTATCACCTGTTGGTTAT
TACGTCTTCCAAATCTTTGACGATTACTCATTATCATTTGGTCTTCTCGC
CGTCGGATTCTTCCAAACCATCAGTGTTTCGTGGGTTTACGGTAACGATA
AAGTGGCAGCGGTCCAGGTTTAGTTTTCATCACATTTGCCAACGCTTTTC
TACAAATGGATGGCGCTCCTTTTTGGGCAGTCTGTTTCTTCGTGATGTTG
ATCCTCTTGGGAATTGATTCAGAGTTCGGAACATTTGAAGCTTTTGTATA
TCCTTTTTATGATATGAAATGGATCACCATGAATAAAAGCTTATTTAGTG
TTCTCGCGGTTATTGGATCCAAAGATCTGGTTAGATGCAGCTGGTCAAAT
GTTTTTCACTCTCAGTATTGGGTTTGGTGCTCTACTAGCTTTCGCTTCAT
ACATGCCGACCAAAAATAATTGTATGAAAGATGCTTATACTGTTGTCTCG
ATTAATTGTTTCACCTCTATTCTGGCTGGTATTGTTGTATTCTCCATTTT
GGGACATCGAGAACAAGAGACCGGTCAAAGTGCAATTGAGTTCACTGCAA
CTGCTAAACAACTCGGTGACCAACGAAACATGTTGTACCAGAGATCCCGA
AGCTTATTATTTCTACGTCACCGCTCTAAATGCTGCTTCATCGATTGAGA
GTACTGATGGCAAGGGAATGTCATGGCAACTGATTCTTTGTTTATTGTTA
TCATGGGTTCTGGTTTACGCATGCGTGGTAAAAGGTGTGAAGTCCAGTGG
TAAAGCAGTATATTTCACGGCTACTTTTCCATACTTGATTTTGATCATTT
TATTGATAGCTGGCGCGTTACTTACCGGTGCTGATATTGGTTTGGTAGCC
TTTTTTAAACCTGATGTGCTTTTCTTATTCCATATTTACTTATGATGATC
ATGGAAGGTTTCCCTTTGTTCTTCATCGAGTACGCTATTGGTCAACGCTT
CAAACAGAGTGCTGTCGGATGCTGGGGAAAAATCCATCCTGCTTTGCGAG
GAATCGGTGTTGGTTCAATCATTTTATCTGGTTTCCTTTGTATTTATTAC
GTGGCTGTTATTGCTTGGTCCTTCTTTTATCTCTTTGTTTCAATGAGGAA
AGATTTGCCCTGGGAACGAAATAATTGTCCAAGGCGATCCAGATGAAAAT
TTACCCTTAACCCAGCAGAACCAGAAGAAGACATCTAATCAAAATGTCGG
TACCGTAAATGGTGATGAAACCAAGGAAACCTGGGGAAACAAAGCAGAAT
TTCTATTAGCTTCAATTGGACTTGCAGTTGGTCTTGGTAACATCTGGAGA
TTTCCTTACTTATGTCAAAAAAATGGAGGAGATGACTCTGTTTGGTTGCT
GTAGAGGGTTTTGCTGAGCCAGTAATTGAAAAAGAGTACCCAGCATGGGC
GAAATTTGTTATTATTGTGCTTATATGTCTACCAATCGCACCCATCTTTA
TATACTTCATCAAAGACCTGGTGCAGAACCCACAAGAATGGAAAGACGGT
TTCCAAAATCGTTTATGTCATCCAATAGAATATGCTTTTGATCCAAGTGA
TTACGATTTGAATCGAAGATATCATATTGAAGATTTGACAATGACAGAGA
AAGATCAAAATAATGCAGCTTCTGCGGAAGAGGAACACGAAATTAAAGTT
TAAGTTTGCAAATGACATTGAGTATATGACGGGACGTCGTCCATTGAAGT
TGTGGTTGATTTGTTGGAAATATATTTCTCCTATAGTCATCATGATTATC
ATTATCTCCAATATTTATTTGTTATCCATTGGAGAGATGACATACAAAGC
TTACGTTGGTTGTTTTGCTCTCTGGTAGCCATTGGTATGTTTCTGATTGG
TTTATGTTTTGTATCACCTGTTGGTTATTACGTCTTCCAAATCTTTGACG
ATTACTCATTATCATTTGGTCTTCTCGCCGTCGGATTCTTCCAAACCATC
AGTGTTTCGTGGGTTTACGGTAACGATAAAGTGGCAGCGGTCCAGGTTTA
GTTTTCATCACATTTGCCAACGCTTTTCTACAAATGGATGGCGCTCCTTT
TTGGGCAGTCTGTTTCTTCGTGATGTTGATCCTCTTGGGAATTGATTCAG
AGTTCGGAACATTTGAAGCTTTTGTATATCCTTTTTATGATATGAAATGG
ATCACCATGAATAAAAGCTTATTTAGTGTTCTCGCGGTTATTGGATCCAA
AGATCTGGTTAGATGCAGCTGGTCAAATGTTTTTCACTCTCAGTATTGGG
TTTGGTGCTCTACTAGCTTTCGCTTCATACATGCCGACCAAAAATAATTG
TATGAAAGATGCTTATACTGTTGTCTCGATTAATTGTTTCACCTCTATTC
TGGCTGGTATTGTTGTATTCTCCATTTTGGGACATCGAGAACAAGAGACC
GGTCAAAGTGCAATTGAGTTCACTGCAACTGCTAAACAACTCGGTGACCA
ACGAAACATGTTGTACCAGAGATCCCGAAGCTTATTATTTCTACGTCACC
GCTCTAAATGCTGCTTCATCGATTGAGAGTACTGATGGCAAGGGAATGTC
ATGGCAACTGATTCTTTGTTTATTGTTATCATGGGTTCTGGTTTACGCAT
GCGTGGTAAAAGGTGTGAAGTCCAGTGGTAAAGCAGTATATTTCACGGCT
ACTTTTCCATACTTGATTTTGATCATTTTATTGATAGCTGGCGCGTTACT
TACCGGTGCTGATATTGGTTTGGTAGCCTTTTTTAAACCTGATGTGCTTT
TCTTATTCCATATTTACTTATGATGATCATGGAAGGTTTCCCTTTGTTCT
TCATCGAGTACGCTATTGGTCAACGCTTCAAACAGAGTGCTGTCGGATGC
TGGGGAAAAATCCATCCTGCTTTGCGAGGAATCGGTGTTGGTTCAATCAT
TTTATCTGGTTTCCTTTGTATTTATTACGTGGCTGTTATTGCTTGGTCCT
TCTTTTATCTCTTTGTTTCAATGAGGAAAGATTTGCCCTGGGAACGAAAT
AATTGTCCAAGGCGATCCAGATGAAAATTTACCCTTAACCCAGCAGAACC
AGAAGAAGACATCTAATCAAAATGTCGGTACCGTAAATGGTGATGAAACC
AAGGAAACCTGGGGAAACAAAGCAGAATTTCTATTAGCTTCAATTGGACT
TGCAGTTGGTCTTGGTAACATCTGGAGATTTCCTTACTTATGTCAAAAAA
ATGGAGGAGATGACTCTGTTTGGTTGCTGTAGAGGGTTTTGCTGAGCCAG
TAATTGAAAAAGAGTACCCAGCATGGGCGAAATTTGTTATTATTGTGCTT
ATATGTCTACCAATCGCACCCATCTTTATATACTTCATCAAAGACCTGGT
GCAGAACCCACAAGAATGGAAAGACGGTTTCCAAAATCGTTTATGTCATC
CAATAGAATATGCTTTTGATCCAAGTGATTACGATTTGAATCGAAGATAT
CATATTGAAGATTTGACAATGACAGAGAAAGATCAAAATAATGCAGCTTC
TGCGGAAGAGGAACACGAAATTAAAGTTTAAGTTTGCAAATGACATTGAG
TATATGACGGGACGTCGTCCATTGAAGTTGTGGTTGATTTGTTGGAAATA
TATTTCTCCTATAGTCATCATGATTATCATTATCTCCAATATTTATTTGT
TATCCATTGGAGAGATGACATACAAAGCTTACGTTGGTTGTTTTGCTCTC
TGGTAGCCATTGGTATGTTTCTGATTGGTTTATGTTTTGTATCACCTGTT
GGTTATTACGTCTTCCAAATCTTTGACGATTACTCATTATCATTTGGTCT
TCTCGCCGTCGGATTCTTCCAAACCATCAGTGTTTCGTGGGTTTACGGTA
ACGATAAAGTGGCAGCGGTCCAGGTTTAGTTTTCATCACATTTGCCAACG
CTTTTCTACAAATGGATGGCGCTCCTTTTTGGGCAGTCTGTTTCTTCGTG
ATGTTGATCCTCTTGGGAATTGATTCAGAGTTCGGAACATTTGAAGCTTT
TGTATATCCTTTTTATGATATGAAATGGATCACCATGAATAAAAGCTTAT
TTAGTGTTCTCGCGGTTATTGGATCCAAAGATCTGGTTAGATGCAGCTGG
TCAAATGTTTTTCACTCTCAGTATTGGGTTTGGTGCTCTACTAGCTTTCG
CTTCATACATGCCGACCAAAAATAATTGTATGAAAGATGCTTATACTGTT
GTCTCGATTAATTGTTTCACCTCTATTCTGGCTGGTATTGTTGTATTCTC
CATTTTGGGACATCGAGAACAAGAGACCGGTCAAAGTGCAATTGAGTTCA
CTGCAACTGCTAAACAACTCGGTGACCAACGAAACATGTTGTACCAGAGA
TCCCGAAGCTTATTATTTCTACGTCACCGCTCTAAATGCTGCTTCATCGA
TTGAGAGTACTGATGGCAAGGGAATGTCATGGCAACTGATTCTTTGTTTA
TTGTTATCATGGGTTCTGGTTTACGCATGCGTGGTAAAAGGTGTGAAGTC
CAGTGGTAAAGCAGTATATTTCACGGCTACTTTTCCATACTTGATTTTGA
TCATTTTATTGATAGCTGGCGCGTTACTTACCGGTGCTGATATTGGTTTG
GTAGCCTTTTTTAAACCTGATGTGCTTTTCTTATTCCATATTTACTTATG
ATGATCATGGAAGGTTTCCCTTTGTTCTTCATCGAGTACGCTATTGGTCA
ACGCTTCAAACAGAGTGCTGTCGGATGCTGGGGAAAAATCCATCCTGCTT
TGCGAGGAATCGGTGTTGGTTCAATCATTTTATCTGGTTTCCTTTGTATT
TATTACGTGGCTGTTATTGCTTGGTCCTTCTTTTATCTCTTTGTTTCAAT
GAGGAAAGATTTGCCCTGGGAACGAAATAATTGTCCAAGGCGATCCAGAT
GAAAATTTACCCTTAACCCAGCAGAACCAGAAGAAGACATCTAATCAAAA
TGTCGGTACCGTAAATGGTGATGAAACCAAGGAAACCTGGGGAAACAAAG
CAGAATTTCTATTAGCTTCAATTGGACTTGCAGTTGGTCTTGGTAACATC
TGGAGATTTCCTTACTTATGTCAAAAAAATGGAGGAGATGACTCTGTTTG
GTTGCTGTAGAGGGTTTTGCTGAGCCAGTAATTGAAAAAGAGTACCCAGC
ATGGGCGAAATTTGTTATTATTGTGCTTATATGTCTACCAATCGCACCCA
TCTTTATATACTTCATCAAAGACCTGGTGCAGAACCCACAAGAATGGAAA
GACGGTTTCCAAAATCGTTTATGTCATCCAATAGAATATGCTTTTGATCC
AAGTGATTACGATTTGAATCGAAGATATCATATTGAAGATTTGACAATGA
CAGAGAAAGATCAAAATAATGCAGCTTCTGCGGAAGAGGAACACGAAATT
AAAGTTTAAGTTTGCAAATGACATTGAGTATATGACGGGACGTCGTCCAT
TGAAGTTGTGGTTGATTTGTTGGAAATATATTTCTCCTATAGTCATCATG
ATTATCATTATCTCCAATATTTATTTGTTATCCATTGGAGAGATGACATA
CAAAGCTTACGTTGGTTGTTTTGCTCTCTGGTAGCCATTGGTATGTTTCT
GATTGGTTTATGTTTTGTATCACCTGTTGGTTATTACGTCTTCCAAATCT
TTGACGATTACTCATTATCATTTGGTCTTCTCGCCGTCGGATTCTTCCAA
ACCATCAGTGTTTCGTGGGTTTACGGTAACGATAAAGTGGCAGCGGTCCA
GGTTTAGTTTTCATCACATTTGCCAACGCTTTTCTACAAATGGATGGCGC
TCCTTTTTGGGCAGTCTGTTTCTTCGTGATGTTGATCCTCTTGGGAATTG
ATTCAGAGTTCGGAACATTTGAAGCTTTTGTATATCCTTTTTATGATATG
AAATGGATCACCATGAATAAAAGCTTATTTAGTGTTCTCGCGGTTATTGG
ATCCAAAGATCTGGTTAGATGCAGCTGGTCAAATGTTTTTCACTCTCAGT
ATTGGGTTTGGTGCTCTACTAGCTTTCGCTTCATACATGCCGACCAAAAA
TAATTGTATGAAAGATGCTTATACTGTTGTCTCGATTAATTGTTTCACCT
CTATTCTGGCTGGTATTGTTGTATTCTCCATTTTGGGACATCGAGAACAA
GAGACCGGTCAAAGTGCAATTGAGTTCACTGCAACTGCTAAACAACTCGG
TGACCAACGAAACATGTTGTACCAGAGATCCCGAAGCTTATTATTTCTAC
GTCACCGCTCTAAATGCTGCTTCATCGATTGAGAGTACTGATGGCAAGGG
AATGTCATGGCAACTGATTCTTTGTTTATTGTTATCATGGGTTCTGGTTT
ACGCATGCGTGGTAAAAGGTGTGAAGTCCAGTGGTAAAGCAGTATATTTC
ACGGCTACTTTTCCATACTTGATTTTGATCATTTTATTGATAGCTGGCGC
GTTACTTACCGGTGCTGATATTGGTTTGGTAGCCTTTTTTAAACCTGATG
TGCTTTTCTTATTCCATATTTACTTATGATGATCATGGAAGGTTTCCCTT
TGTTCTTCATCGAGTACGCTATTGGTCAACGCTTCAAACAGAGTGCTGTC
GGATGCTGGGGAAAAATCCATCCTGCTTTGCGAGGAATCGGTGTTGGTTC
AATCATTTTATCTGGTTTCCTTTGTATTTATTACGTGGCTGTTATTGCTT
GGTCCTTCTTTTATCTCTTTGTTTCAATGAGGAAAGATTTGCCCTGGGAA
CGAAATAATTGTCCAAGGCGATCCAGATGAAAATTTACCCTTAACCCAGC
AGAACCAGAAGAAGACATCTAATCAAAATGTCGGTACCGTAAATGGTGAT
GAAACCAAGGAAACCTGGGGAAACAAAGCAGAATTTCTATTAGCTTCAAT
TGGACTTGCAGTTGGTCTTGGTAACATCTGGAGATTTCCTTACTTATGTC
AAAAAAATGGAGGAGATGACTCTGTTTGGTTGCTGTAGAGGGTTTTGCTG
AGCCAGTAATTGAAAAAGAGTACCCAGCATGGGCGAAATTTGTTATTATT
GTGCTTATATGTCTACCAATCGCACCCATCTTTATATACTTCATCAAAGA
CCTGGTGCAGAACCCACAAGAATGGAAAGACGGTTTCCAAAATCGTTTAT
GTCATCCAATAGAATATGCTTTTGATCCAAGTGATTACGATTTGAATCGA
AGATATCATATTGAAGATTTGACAATGACAGAGAAAGATCAAAATAATGC
AGCTTCTGCGGAAGAGGAACACGAAATTAAAGTTTAAGTTTGCAAATGAC
ATTGAGTATATGACGGGACGTCGTCCATTGAAGTTGTGGTTGATTTGTTG
GAAATATATTTCTCCTATAGTCATCATGATTATCATTATCTCCAATATTT
ATTTGTTATCCATTGGAGAGATGACATACAAAGCTTACGTTGGTTGTTTT
GCTCTCTGGTAGCCATTGGTATGTTTCTGATTGGTTTATGTTTTGTATCA
CCTGTTGGTTATTACGTCTTCCAAATCTTTGACGATTACTCATTATCATT
TGGTCTTCTCGCCGTCGGATTCTTCCAAACCATCAGTGTTTCGTGGGTTT
ACGGTAACGATAAAGTGGCAGCGGTCCAGGTTTAGTTTTCATCACATTTG
CCAACGCTTTTCTACAAATGGATGGCGCTCCTTTTTGGGCAGTCTGTTTC
TTCGTGATGTTGATCCTCTTGGGAATTGATTCAGAGTTCGGAACATTTGA
AGCTTTTGTATATCCTTTTTATGATATGAAATGGATCACCATGAATAAAA
GCTTATTTAGTGTTCTCGCGGTTATTGGATCCAAAGATCTGGTTAGATGC
AGCTGGTCAAATGTTTTTCACTCTCAGTATTGGGTTTGGTGCTCTACTAG
CTTTCGCTTCATACATGCCGACCAAAAATAATTGTATGAAAGATGCTTAT
ACTGTTGTCTCGATTAATTGTTTCACCTCTATTCTGGCTGGTATTGTTGT
ATTCTCCATTTTGGGACATCGAGAACAAGAGACCGGTCAAAGTGCAATTG
AGTTCACTGCAACTGCTAAACAACTCGGTGACCAACGAAACATGTTGTAC
CAGAGATCCCGAAGCTTATTATTTCTACGTCACCGCTCTAAATGCTGCTT
CATCGATTGAGAGTACTGATGGCAAGGGAATGTCATGGCAACTGATTCTT
TGTTTATTGTTATCATGGGTTCTGGTTTACGCATGCGTGGTAAAAGGTGT
GAAGTCCAGTGGTAAAGCAGTATATTTCACGGCTACTTTTCCATACTTGA
TTTTGATCATTTTATTGATAGCTGGCGCGTTACTTACCGGTGCTGATATT
GGTTTGGTAGCCTTTTTTAAACCTGATGTGCTTTTCTTATTCCATATTTA
CTTATGATGATCATGGAAGGTTTCCCTTTGTTCTTCATCGAGTACGCTAT
TGGTCAACGCTTCAAACAGAGTGCTGTCGGATGCTGGGGAAAAATCCATC
CTGCTTTGCGAGGAATCGGTGTTGGTTCAATCATTTTATCTGGTTTCCTT
TGTATTTATTACGTGGCTGTTATTGCTTGGTCCTTCTTTTATCTCTTTGT
TTCAATGAGGAAAGATTTGCCCTGGGAACGAAATAATTGTCCAAGGCGAT
CCAGATGAAAATTTACCCTTAACCCAGCAGAACCAGAAGAAGACATCTAA
TCAAAATGTCGGTACCGTAAATGGTGATGAAACCAAGGAAACCTGGGGAA
ACAAAGCAGAATTTCTATTAGCTTCAATTGGACTTGCAGTTGGTCTTGGT
AACATCTGGAGATTTCCTTACTTATGTCAAAAAAATGGAGGAGATGACTC
TGTTTGGTTGCTGTAGAGGGTTTTGCTGAGCCAGTAATTGAAAAAGAGTA
CCCAGCATGGGCGAAATTTGTTATTATTGTGCTTATATGTCTACCAATCG
CACCCATCTTTATATACTTCATCAAAGACCTGGTGCAGAACCCACAAGAA
TGGAAAGACGGTTTCCAAAATCGTTTATGTCATCCAATAGAATATGCTTT
TGATCCAAGTGATTACGATTTGAATCGAAGATATCATATTGAAGATTTGA
CAATGACAGAGAAAGATCAAAATAATGCAGCTTCTGCGGAAGAGGAACAC
GAAATTAAAGTTTAAGTTTGCAAATGACATTGAGTATATGACGGGACGTC
GTCCATTGAAGTTGTGGTTGATTTGTTGGAAATATATTTCTCCTATAGTC
ATCATGATTATCATTATCTCCAATATTTATTTGTTATCCATTGGAGAGAT
GACATACAAAGCTTACGTTGGTTGTTTTGCTCTCTGGTAGCCATTGGTAT
GTTTCTGATTGGTTTATGTTTTGTATCACCTGTTGGTTATTACGTCTTCC
AAATCTTTGACGATTACTCATTATCATTTGGTCTTCTCGCCGTCGGATTC
TTCCAAACCATCAGTGTTTCGTGGGTTTACGGTAACGATAAAGTGGCAGC
GGTCCAGGTTTAGTTTTCATCACATTTGCCAACGCTTTTCTACAAATGGA
TGGCGCTCCTTTTTGGGCAGTCTGTTTCTTCGTGATGTTGATCCTCTTGG
GAATTGATTCAGAGTTCGGAACATTTGAAGCTTTTGTATATCCTTTTTAT
GATATGAAATGGATCACCATGAATAAAAGCTTATTTAGTGTTCTCGCGGT
TATTGGATCCAAAGATCTGGTTAGATGCAGCTGGTCAAATGTTTTTCACT
CTCAGTATTGGGTTTGGTGCTCTACTAGCTTTCGCTTCATACATGCCGAC
CAAAAATAATTGTATGAAAGATGCTTATACTGTTGTCTCGATTAATTGTT
TCACCTCTATTCTGGCTGGTATTGTTGTATTCTCCATTTTGGGACATCGA
GAACAAGAGACCGGTCAAAGTGCAATTGAGTTCACTGCAACTGCTAAACA
ACTCGGTGACCAACGAAACATGTTGTACCAGAGATCCCGAAGCTTATTAT
TTCTACGTCACCGCTCTAAATGCTGCTTCATCGATTGAGAGTACTGATGG
CAAGGGAATGTCATGGCAACTGATTCTTTGTTTATTGTTATCATGGGTTC
TGGTTTACGCATGCGTGGTAAAAGGTGTGAAGTCCAGTGGTAAAGCAGTA
TATTTCACGGCTACTTTTCCATACTTGATTTTGATCATTTTATTGATAGC
TGGCGCGTTACTTACCGGTGCTGATATTGGTTTGGTAGCCTTTTTTAAAC
CTGATGTGCTTTTCTTATTCCATATTTACTTATGATGATCATGGAAGGTT
TCCCTTTGTTCTTCATCGAGTACGCTATTGGTCAACGCTTCAAACAGAGT
GCTGTCGGATGCTGGGGAAAAATCCATCCTGCTTTGCGAGGAATCGGTGT
TGGTTCAATCATTTTATCTGGTTTCCTTTGTATTTATTACGTGGCTGTTA
TTGCTTGGTCCTTCTTTTATCTCTTTGTTTCAATGAGGAAAGATTTGCCC
TGGGAACGAAATAATTGTCCAAGGCGATCCAGATGAAAATTTACCCTTAA
CCCAGCAGAACCAGAAGAAGACATCTAATCAAAATGTCGGTACCGTAAAT
GGTGATGAAACCAAGGAAACCTGGGGAAACAAAGCAGAATTTCTATTAGC
TTCAATTGGACTTGCAGTTGGTCTTGGTAACATCTGGAGATTTCCTTACT
TATGTCAAAAAAATGGAGGAGATGACTCTGTTTGGTTGCTGTAGAGGGTT
TTGCTGAGCCAGTAATTGAAAAAGAGTACCCAGCATGGGCGAAATTTGTT
ATTATTGTGCTTATATGTCTACCAATCGCACCCATCTTTATATACTTCAT
CAAAGACCTGGTGCAGAACCCACAAGAATGGAAAGACGGTTTCCAAAATC
GTTTATGTCATCCAATAGAATATGCTTTTGATCCAAGTGATTACGATTTG
AATCGAAGATATCATATTGAAGATTTGACAATGACAGAGAAAGATCAAAA
TAATGCAGCTTCTGCGGAAGAGGAACACGAAATTAAAGTTTAAGTTTGCA
AATGACATTGAGTATATGACGGGACGTCGTCCATTGAAGTTGTGGTTGAT
TTGTTGGAAATATATTTCTCCTATAGTCATCATGATTATCATTATCTCCA
ATATTTATTTGTTATCCATTGGAGAGATGACATACAAAGCTTACGTTGGT
TGTTTTGCTCTCTGGTAGCCATTGGTATGTTTCTGATTGGTTTATGTTTT
GTATCACCTGTTGGTTATTACGTCTTCCAAATCTTTGACGATTACTCATT
ATCATTTGGTCTTCTCGCCGTCGGATTCTTCCAAACCATCAGTGTTTCGT
GGGTTTACGGTAACGATAAAGTGGCAGCGGTCCAGGTTTAGTTTTCATCA
CATTTGCCAACGCTTTTCTACAAATGGATGGCGCTCCTTTTTGGGCAGTC
TGTTTCTTCGTGATGTTGATCCTCTTGGGAATTGATTCAGAGTTCGGAAC
ATTTGAAGCTTTTGTATATCCTTTTTATGATATGAAATGGATCACCATGA
ATAAAAGCTTATTTAGTGTTCTCGCGGTTATTGGATCCAAAGATCTGGTT
AGATGCAGCTGGTCAAATGTTTTTCACTCTCAGTATTGGGTTTGGTGCTC
TACTAGCTTTCGCTTCATACATGCCGACCAAAAATAATTGTATGAAAGAT
GCTTATACTGTTGTCTCGATTAATTGTTTCACCTCTATTCTGGCTGGTAT
TGTTGTATTCTCCATTTTGGGACATCGAGAACAAGAGACCGGTCAAAGTG
CAATTGAGTTCACTGCAACTGCTAAACAACTCGGTGACCAACGAAACATG
TTGTACCAGAGATCCCGAAGCTTATTATTTCTACGTCACCGCTCTAAATG
CTGCTTCATCGATTGAGAGTACTGATGGCAAGGGAATGTCATGGCAACTG
ATTCTTTGTTTATTGTTATCATGGGTTCTGGTTTACGCATGCGTGGTAAA
AGGTGTGAAGTCCAGTGGTAAAGCAGTATATTTCACGGCTACTTTTCCAT
ACTTGATTTTGATCATTTTATTGATAGCTGGCGCGTTACTTACCGGTGCT
GATATTGGTTTGGTAGCCTTTTTTAAACCTGATGTGCTTTTCTTATTCCA
TATTTACTTATGATGATCATGGAAGGTTTCCCTTTGTTCTTCATCGAGTA
CGCTATTGGTCAACGCTTCAAACAGAGTGCTGTCGGATGCTGGGGAAAAA
TCCATCCTGCTTTGCGAGGAATCGGTGTTGGTTCAATCATTTTATCTGGT
TTCCTTTGTATTTATTACGTGGCTGTTATTGCTTGGTCCTTCTTTTATCT
CTTTGTTTCAATGAGGAAAGATTTGCCCTGGGAACGAAATAATTGTCCAA
GGCGATCCAGATGAAAATTTACCCTTAACCCAGCAGAACCAGAAGAAGAC
ATCTAATCAAAATGTCGGTACCGTAAATGGTGATGAAACCAAGGAAACCT
GGGGAAACAAAGCAGAATTTCTATTAGCTTCAATTGGACTTGCAGTTGGT
CTTGGTAACATCTGGAGATTTCCTTACTTATGTCAAAAAAATGGAGGAGA
TGACTCTGTTTGGTTGCTGTAGAGGGTTTTGCTGAGCCAGTAATTGAAAA
AGAGTACCCAGCATGGGCGAAATTTGTTATTATTGTGCTTATATGTCTAC
CAATCGCACCCATCTTTATATACTTCATCAAAGACCTGGTGCAGAACCCA
CAAGAATGGAAAGACGGTTTCCAAAATCGTTTATGTCATCCAATAGAATA
TGCTTTTGATCCAAGTGATTACGATTTGAATCGAAGATATCATATTGAAG
ATTTGACAATGACAGAGAAAGATCAAAATAATGCAGCTTCTGCGGAAGAG
GAACACGAAATTAAAGTTTAAGTTTGCAAATGACATTGAGTATATGACGG
GACGTCGTCCATTGAAGTTGTGGTTGATTTGTTGGAAATATATTTCTCCT
ATAGTCATCATGATTATCATTATCTCCAATATTTATTTGTTATCCATTGG
AGAGATGACATACAAAGCTTACGTTGGTTGTTTTGCTCTCTGGTAGCCAT
TGGTATGTTTCTGATTGGTTTATGTTTTGTATCACCTGTTGGTTATTACG
TCTTCCAAATCTTTGACGATTACTCATTATCATTTGGTCTTCTCGCCGTC
GGATTCTTCCAAACCATCAGTGTTTCGTGGGTTTACGGTAACGATAAAGT
GGCAGCGGTCCAGGTTTAGTTTTCATCACATTTGCCAACGCTTTTCTACA
AATGGATGGCGCTCCTTTTTGGGCAGTCTGTTTCTTCGTGATGTTGATCC
TCTTGGGAATTGATTCAGAGTTCGGAACATTTGAAGCTTTTGTATATCCT
TTTTATGATATGAAATGGATCACCATGAATAAAAGCTTATTTAGTGTTCT
CGCGGTTATTGGATCCAAAGATCTGGTTAGATGCAGCTGGTCAAATGTTT
TTCACTCTCAGTATTGGGTTTGGTGCTCTACTAGCTTTCGCTTCATACAT
GCCGACCAAAAATAATTGTATGAAAGATGCTTATACTGTTGTCTCGATTA
ATTGTTTCACCTCTATTCTGGCTGGTATTGTTGTATTCTCCATTTTGGGA
CATCGAGAACAAGAGACCGGTCAAAGTGCAATTGAGTTCACTGCAACTGC
TAAACAACTCGGTGACCAACGAAACATGTTGTACCAGAGATCCCGAAGCT
TATTATTTCTACGTCACCGCTCTAAATGCTGCTTCATCGATTGAGAGTAC
TGATGGCAAGGGAATGTCATGGCAACTGATTCTTTGTTTATTGTTATCAT
GGGTTCTGGTTTACGCATGCGTGGTAAAAGGTGTGAAGTCCAGTGGTAAA
GCAGTATATTTCACGGCTACTTTTCCATACTTGATTTTGATCATTTTATT
GATAGCTGGCGCGTTACTTACCGGTGCTGATATTGGTTTGGTAGCCTTTT
TTAAACCTGATGTGCTTTTCTTATTCCATATTTACTTATGATGATCATGG
AAGGTTTCCCTTTGTTCTTCATCGAGTACGCTATTGGTCAACGCTTCAAA
CAGAGTGCTGTCGGATGCTGGGGAAAAATCCATCCTGCTTTGCGAGGAAT
CGGTGTTGGTTCAATCATTTTATCTGGTTTCCTTTGTATTTATTACGTGG
CTGTTATTGCTTGGTCCTTCTTTTATCTCTTTGTTTCAATGAGGAAAGAT
TTGCCCTGGGAACGAAATAATTGTCCAAGGCGATCCAGATGAAAATTTAC
CCTTAACCCAGCAGAACCAGAAGAAGACATCTAATCAAAATGTCGGTACC
GTAAATGGTGATGAAACCAAGGAAACCTGGGGAAACAAAGCAGAATTTCT
ATTAGCTTCAATTGGACTTGCAGTTGGTCTTGGTAACATCTGGAGATTTC
CTTACTTATGTCAAAAAAATGGAGGAGATGACTCTGTTTGGTTGCTGTAG
AG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_001002XLOC_001002Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001936-exon-sc0000012-1575043694:528938..529161TCONS_00001936-exon-sc0000012-1575043694:528938..529161Clytia hemisphaericaexon
TCONS_00001936-exon-sc0000012-1575043694:528018..528215TCONS_00001936-exon-sc0000012-1575043694:528018..528215Clytia hemisphaericaexon
TCONS_00001936-exon-sc0000012-1575043694:527551..527818TCONS_00001936-exon-sc0000012-1575043694:527551..527818Clytia hemisphaericaexon
TCONS_00001936-exon-sc0000012-1575043694:525655..525979TCONS_00001936-exon-sc0000012-1575043694:525655..525979Clytia hemisphaericaexon
TCONS_00001936-exon-sc0000012-1575043694:524978..525217TCONS_00001936-exon-sc0000012-1575043694:524978..525217Clytia hemisphaericaexon
TCONS_00001936-exon-sc0000012-1575043694:522883..523081TCONS_00001936-exon-sc0000012-1575043694:522883..523081Clytia hemisphaericaexon
TCONS_00001936-exon-sc0000012-1575043694:517742..517901TCONS_00001936-exon-sc0000012-1575043694:517742..517901Clytia hemisphaericaexon
TCONS_00001936-exon-sc0000012-1575043694:517308..517473TCONS_00001936-exon-sc0000012-1575043694:517308..517473Clytia hemisphaericaexon
TCONS_00001936-exon-sc0000012-1575043694:513974..515154TCONS_00001936-exon-sc0000012-1575043694:513974..515154Clytia hemisphaericaexon
TCONS_00001936-exon-sc0000012-1510915933:528938..529161TCONS_00001936-exon-sc0000012-1510915933:528938..529161Clytia hemisphaericaexon
TCONS_00001936-exon-sc0000012-1510915933:528018..528215TCONS_00001936-exon-sc0000012-1510915933:528018..528215Clytia hemisphaericaexon
TCONS_00001936-exon-sc0000012-1510915933:527551..527818TCONS_00001936-exon-sc0000012-1510915933:527551..527818Clytia hemisphaericaexon
TCONS_00001936-exon-sc0000012-1510915933:525655..525979TCONS_00001936-exon-sc0000012-1510915933:525655..525979Clytia hemisphaericaexon
TCONS_00001936-exon-sc0000012-1510915933:524978..525217TCONS_00001936-exon-sc0000012-1510915933:524978..525217Clytia hemisphaericaexon
TCONS_00001936-exon-sc0000012-1510915933:522883..523081TCONS_00001936-exon-sc0000012-1510915933:522883..523081Clytia hemisphaericaexon
TCONS_00001936-exon-sc0000012-1510915933:517742..517901TCONS_00001936-exon-sc0000012-1510915933:517742..517901Clytia hemisphaericaexon
TCONS_00001936-exon-sc0000012-1510915933:517308..517473TCONS_00001936-exon-sc0000012-1510915933:517308..517473Clytia hemisphaericaexon
TCONS_00001936-exon-sc0000012-1510915933:513974..515154TCONS_00001936-exon-sc0000012-1510915933:513974..515154Clytia hemisphaericaexon
TCONS_00001936-exon-sc0000012-1491911889:528938..529161TCONS_00001936-exon-sc0000012-1491911889:528938..529161Clytia hemisphaericaexon
TCONS_00001936-exon-sc0000012-1491911889:528018..528215TCONS_00001936-exon-sc0000012-1491911889:528018..528215Clytia hemisphaericaexon
TCONS_00001936-exon-sc0000012-1491911889:527551..527818TCONS_00001936-exon-sc0000012-1491911889:527551..527818Clytia hemisphaericaexon
TCONS_00001936-exon-sc0000012-1491911889:525655..525979TCONS_00001936-exon-sc0000012-1491911889:525655..525979Clytia hemisphaericaexon
TCONS_00001936-exon-sc0000012-1491911889:524978..525217TCONS_00001936-exon-sc0000012-1491911889:524978..525217Clytia hemisphaericaexon
TCONS_00001936-exon-sc0000012-1491911889:522883..523081TCONS_00001936-exon-sc0000012-1491911889:522883..523081Clytia hemisphaericaexon
TCONS_00001936-exon-sc0000012-1491911889:517742..517901TCONS_00001936-exon-sc0000012-1491911889:517742..517901Clytia hemisphaericaexon
TCONS_00001936-exon-sc0000012-1491911889:517308..517473TCONS_00001936-exon-sc0000012-1491911889:517308..517473Clytia hemisphaericaexon
TCONS_00001936-exon-sc0000012-1491911889:513974..515154TCONS_00001936-exon-sc0000012-1491911889:513974..515154Clytia hemisphaericaexon
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001936-proteinTCONS_00001936-proteinClytia hemisphaericapolypeptide
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000012supercontigsc0000012:513974..529161 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0.0773497 0 0 0 0.257212 0.289911 5.14956 5.50989 3.14776 5.59871 1.89348 2.22063 7.07467 6.17655 19.2805 19.6619 9.11312 7.15695 14.5544 15.0657 4.61047 5.06942 2.84309 4.77191 3.93435 4.17528 9.41555 12.2815 8.67999 4.52962
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR000175Na/ntran_symport
Vocabulary: Molecular Function
TermDefinition
GO:0005328neurotransmitter:sodium symporter activity
Vocabulary: Cellular Component
TermDefinition
GO:0016021integral component of membrane
Vocabulary: Biological Process
TermDefinition
GO:0006836neurotransmitter transport
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006836 neurotransmitter transport
cellular_component GO:0016021 integral component of membrane
molecular_function GO:0005328 neurotransmitter:sodium symporter activity
Blast
BLAST of TCONS_00001936 vs. Swiss-Prot (Human)
Match: S6A18 (Sodium-dependent neutral amino acid transporter B(0)AT3 OS=Homo sapiens GN=SLC6A18 PE=2 SV=2)

HSP 1 Score: 323.939 bits (829), Expect = 1.366e-97
Identity = 221/577 (38.30%), Postives = 317/577 (54.94%), Query Frame = 2
Query:  302 GDETKETWGNKAEFLLASIGLAVGLGNIWRFPYLCQKNGGGAFLIPYLLMMIMEGFPLFFIEYAIGQRFKQSAVGCWGKIHPALRGIGVGSIILSGFLCIYYVAVIAWSFFYLFVSMRKDLPWERNNCPSSLQLLNNSVTNETCCTRDPEAYYFYVTALNAASSIESTDGKGMSWQXXXXXXXXXXXVYACXXXXXXXXXXAVYFTATFPYXXXXXXXXXXXXXXXXXXXXVAFFKPDFSRLLDPKIWLDAAGQMFFTLSIGFGALLAFASYMPTKNNCMKDAYTVVSINCFTSILAGIVVFSILGHREQETGQSAIE-----------------------------------------------------SGSGPGLVFITFANAFLQMDGAPFWAVCFFVMLILLGIDSEFGTFEAFVYPFYDM----KWITMNKSLFSALVAIGMFLIGLCFVSPVGYYVFQIFDDYSLSFGLLAVGFFQTISVSWVYGNDKFANDIEYMTGRRPLKLWLICWKYXXXXXXXXXXXXXXXXXXXGEMTYKAYVGCFAGFAEPVIEKEYPAWAKFVIIVLICLPI 1861
            GDE +  W NKA++LL+  G AVGLGNIWRFPYLCQ  GGGAFLIPY++ ++ EG P+F +E AIGQR ++ +VG W  I P L G+G+G + LS  + +YY  ++AW  +YL  S +  LPW  ++CP     LN +   E C      +Y++Y   LN  + I   D   + W L++CL  SW +VY CV++G++++GK +YFTA FPYL+L I LI G  L GA  GL+  F P+   L +P++WLDAA Q+FF+LS+ FG  +AFASY   +N+C KDA  +  +N  TS+ A I VFS+LG +     +  ++                                                     S SGPGL F+ F    L M GAP WA+ FF ML  LG+ + FGT EA + P  D+    +W+   K   + LV +  FL   CF    G Y  +IFD+++ S  LL + F + + V +VYG  +F +DI +MTGRRP   W + W+ +   +++ I ++ I LL    + YKA+   +  F     EK YP WA+   ++L  LP+
Sbjct:   15 GDE-RPKWDNKAQYLLSCTGFAVGLGNIWRFPYLCQTYGGGAFLIPYVIALVFEGIPIFHVELAIGQRLRKGSVGVWTAISPYLSGVGLGCVTLSFLISLYYNTIVAWVLWYLLNSFQHPLPW--SSCPPD---LNRTGFVEECQGSSAVSYFWYRQTLNITADIN--DSGSIQWWLLICLAASWAVVYMCVIRGIETTGKVIYFTALFPYLVLTIFLIRGLTLPGATKGLIYLFTPNMHILQNPRVWLDAATQIFFSLSLAFGGHIAFASYNSPRNDCQKDAVVIALVNRMTSLYASIAVFSVLGFKATNDYEHCLDRNILSLINDFDFPEQSISRDDYPAVLMHLNATWPKRVAQLPLKACLLEDFLDKSASGPGLAFVVFTETDLHMPGAPVWAMLFFGMLFTLGLSTMFGTVEAVITPLLDVGVLPRWVP--KEALTGLVCLVCFLSATCFTLQSGNYWLEIFDNFAASPNLLMLAFLEVVGVVYVYGMKRFCDDIAWMTGRRPSPYWRLTWR-VVSPLLLTIFVAYIILLFWKPLRYKAWNPKYELFPSRQ-EKLYPGWARAACVLLSLLPV 579          
The following BLAST results are available for this feature:
BLAST of TCONS_00001936 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
S6A181.366e-9738.30Sodium-dependent neutral amino acid transporter B(... [more]
back to top