Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001934 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001934
Unique NameTCONS_00001934
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length2659

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001934 ID=TCONS_00001934|Name=TCONS_00001934|organism=Clytia hemisphaerica|type=transcript|length=2659bp
CTTTAAAATGTGTTTATCTCAATATGCCACATAtccaatgattttttttc
ttaaagttTGGAAATAATGTCATATTTGGTCGTTGTTTTTCAAGTTTACT
AGTGTAGTTGGGCACCGAGCATCGTGAGTCTCTCCATCCCTTGATGGCAG
AAGGAAGtCCATTTTACTAAATACATACATTGTTGTTTTGGTTTGGTTTA
TGTTGACAAAGTTATATCAACCTCAAAAATGTATGGTTTTATTCACTGTT
GTTTGCATGATTTGATTCTCAAACAATTTGGTGAAGAAACATGGAACGCT
ATCATAAAAGAAGCAGGTGTCAACTTAGCTGGCGGTGAATATATTATCCA
TCGTGTATATTCTGATcaagaaacaatgaaattggTCACTGTAgctcaga
agctctctggAATACCTTTGAATGACATTCTAGAAACATTTGGTAATCAT
TTCTACAAATACTGTAAACAATCAGGATACGACCGAGTCTTGAAAATCCT
TGGCCGAACTCTCCGGGAATTTCTTTGCAATCTAGACGCATTGCATGATC
ATTTAGCGTCCATTTATCCAGGGATGAACGCACCTTCCTTTCGTGCCTCC
GAAAGACCAGATGGTGGCCTAGATTTACATTATTATTCAAATCGTGATGG
TCTTGGCTATATCGTGATTGGAATAATGAAAACGGTGGCCCGAGAGTGCT
TGAATACGGAAATTGAGATTTatattgataaagaaaaagagaataaaGAT
GACCACGTAGTTTTTGCTGTGTTCGAGAAAACGGCCACACAATGTCCTTC
AATACCGTCTATAACATTCCCACCGGCTTCCAAATTCGAGCATCGTTCAA
GTTCGATAACAAGTTTTAAAGCATTATTTCGACGGAAGAAACATTTCATG
AGTATCAAATCTTTCACGGAAGCGTTCCCTTTTCACGTTGTTTTTGATCG
GAATTTGAATATCAAACAATGTGGTTCATCTATCAGTAAATATATTGAAC
AATCATATTTTGAAGTGAATGGACAAACCAATAGGAAGAAGAAAGGCAAA
ATTAAGTATCCGTTTACTGATGCGTTTCGTTTGATTCGTCCAAAGATGAA
TTTCACTTTCCAGAACATTCTACATCACATCAATACTGTTTTTGTGGTTG
CATCCAAACATCGTTTAGAACTAATCCGTGAAGACTCAGATGGAAACATA
TCAACACCAAGACCTGAGGACCTCAAAAAAGGACTCAATCGTGGCCGACA
CACTGGATCCGCATACTCGGCCATTCTCTCTGCAGCATCTGTCTGCACAC
CAAGTTTAGTCACAAGCACAACAAGAGCAAGTGAATTGAGACTTAAAGGT
CAAATGATCTATCTCCCAAAAACAGACTGTCTATTATTCCTCTGCTCACC
ACGTGTTGGAAGTCTGGAAGAATTAAGAAGGCGTGGTCTCTATTTATCAG
ATTTCCCTTTACACGACTCCACCAGAGAAGTCATTCTAACCAAGAAAGAA
CACCAACAAGATCGCCAACTAGTCAAACGAATCGAAGACTCGAATAACGg
actcaaaatcttgaaaaccaAACTAGTACATAACAAAAACATTACCGATG
AGCTTCTACATGAGTTACTACCACCTATAGTTGCTCAACAATTACGTTTA
AATTTACCAGTGTTGGCAGAATCATATGATATGGTCACCATATTGTTTTC
AGATTTGGTTGGTTTTACAGCACTTTGTTCCAATGAACAGGTTGTACCGA
TGGATATTATCAAATTGCTGAATAAGCTGTATACCATGTTTGATGTCATT
TCTCACATGCATAATGTTTTTAAGGTGGAGACGATCGGTGATGCATACAT
GGGTGTTTGCGGTATCCCACAACCAATCGAACACCATGCCAAACATGTGG
TTGAAATGGCAATGGATATGTTAGAATGTGTACAAAATGTCATCTCACCT
GTAGACGCCCACCCTGTCAAGataCGAGTTGGGTTGCACTCAGGTTCATG
CATGGCTGGTGTGGTGGGTAAAAAGACACCACGCTATtgtttgtttggaa
aacacGTGACACTTGCCAATAAAATGGAATCTGGAAGCAGTCCCGGAAAA
GTCAATGTCAGTATCGAAACTAAAAAGTTTTTGAGTAACGAGGAATGGTC
TTTTGAAGAGAACGCCAATCCAAACCCAATGGAATGTTATTTTATTAAGC
CAAAAAAAATCCAACCAGAAAAATTAGCAGAAAAGAAACAATTCTTAAAA
CAACTTGCTAATATGGAAACTCATCTGAAGGAAGGTTCACCTGCTATGCA
GCGGAAAGTGATTCGACCACTCTCCAAAgtgcttgaaacaaaagaaattt
cggCCACTGTTATTGATAATAACAACAGCTTACCTGCACTCAATGAGGGT
GTAACAACTAAGCTGACCATGAACGGAGGAGGTTGTCCTTTTAGTCATGG
TATGGTTAAGTGATAAACTAACGAAAAATTACGATTGAAAGTTAGAGAGG
GGAGTATAAATTATTTTGCTACTGTACATCGACTTCTATGACTCTTTTTT
GACATTCGAATCGACGAAACCATTATTATAGAAATAACCAAGTCTTCGTT
ACAAATCCGATAAATCTCAACGTTTAACCTTTTTTCATACGATAAAATTT
CAACCTGTA
Run BLAST on NCBI

protein sequence of TCONS_00001934-protein

>TCONS_00001934-protein ID=TCONS_00001934-protein|Name=TCONS_00001934-protein|organism=Clytia hemisphaerica|type=polypeptide|length=744bp
MYGFIHCCLHDLILKQFGEETWNAIIKEAGVNLAGGEYIIHRVYSDQETM
KLVTVAQKLSGIPLNDILETFGNHFYKYCKQSGYDRVLKILGRTLREFLC
NLDALHDHLASIYPGMNAPSFRASERPDGGLDLHYYSNRDGLGYIVIGIM
KTVARECLNTEIEIYIDKEKENKDDHVVFAVFEKTATQCPSIPSITFPPA
SKFEHRSSSITSFKALFRRKKHFMSIKSFTEAFPFHVVFDRNLNIKQCGS
SISKYIEQSYFEVNGQTNRKKKGKIKYPFTDAFRLIRPKMNFTFQNILHH
INTVFVVASKHRLELIREDSDGNISTPRPEDLKKGLNRGRHTGSAYSAIL
SAASVCTPSLVTSTTRASELRLKGQMIYLPKTDCLLFLCSPRVGSLEELR
RRGLYLSDFPLHDSTREVILTKKEHQQDRQLVKRIEDSNNGLKILKTKLV
HNKNITDELLHELLPPIVAQQLRLNLPVLAESYDMVTILFSDLVGFTALC
SNEQVVPMDIIKLLNKLYTMFDVISHMHNVFKVETIGDAYMGVCGIPQPI
EHHAKHVVEMAMDMLECVQNVISPVDAHPVKIRVGLHSGSCMAGVVGKKT
PRYCLFGKHVTLANKMESGSSPGKVNVSIETKKFLSNEEWSFEENANPNP
MECYFIKPKKIQPEKLAEKKQFLKQLANMETHLKEGSPAMQRKVIRPLSK
VLETKEISATVIDNNNSLPALNEGVTTKLTMNGGGCPFSHGMVK
Run BLAST on NCBI

transcript from alignment at sc0000012:397481..429980-

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001934 ID=TCONS_00001934|Name=TCONS_00001934|organism=Clytia hemisphaerica|type=transcript|length=32500bp|location=Sequence derived from alignment at sc0000012:397481..429980- (Clytia hemisphaerica)
CTTTAAAATGTGTTTATCTCAATATGCCACATATCCAATGATTTTTTTTC TTAAAGTTTGGAAATAATGTCATATTTGGTCGTTGTTTTTCAAGTTTACT AGTGTAGTTGGGCACCGAGCATCGTGAGTCTCTCCATCCCTTGATGGCAG AAGGAAGGTAGGATAATCACTCGAAACACCCCTGTCTCACAGCCCCGGTA GAACTTTTTTTCCTCAGTGGGGATGAAAACTCTTATTGAAAGCCAAACGG GGATATAAATTCTATTGTTTCAAAGTTAAAAAATTCAGTGGGGATAGGTT TGGAGTGCAATTTTTAAACATTGAATTTCGAATGGGGTACCAGCAGGTTT GTGAAACAGGGGCGTCTCGAATTAGGGACAGTTAGAGATCTTTCTCTATA GAGTCCATTGGACCGGGTTGGTTTAATGAGACATTTAAGTTTTACAGTCG GCTGAAATGATACACGTTTTTCTTATAAGAACAAACTATTTAACAACATT TCAATCCTTTGTGGACTCTAAAACACCCGATTTCTTAAAAAGATATTGAC AAAAACACTCACAAAATGGTGAAATTAAAAACATATTGAGAACATTTTAA GCTTGAAACTCAAAAAGTTAAACATCTGAAGGATTTCGGATGTTCTTATA AAAGAAACATGCAATTGATGATGTACTTTAAATAAATTAACCCACGTCAA CTCAACCCACGCTGAATCTTTAACTTCAGGGACTTAAAAGGTTTTTGAGA AGAGATGAATAACGCATCAGGGTAAAAATGCCAGCACAATGCTAGCAACA ATGTTATTTAAACGTCAATCTAACGTTTCTAATGTCCATTACTTTTTATG AGAACCAGTCAAATTTTATCGAGATTTTGCTGCTCTTATTTTTTCGAGGC TATTTCTATAGCAAAACAGATATTATTATTTTGATCTAAAATTTATTTTT AAGCGTATTTATTCTCTAGTTCTTAGATTCTTATGAAATTATTCTTATAG AAAATAGTGTAATGTAATTCGTATGGAGTATCAGTACTTCTCACGGGTTT CGGTGAACATTACAAAGCTGCAATCTGATTGGCTGTTAGAAAACCAATAA AATTCTAACCTAAAGACCAATTAGGAATAATTCAGGATAGGAGTAATAGC TCTCAAGGCTTTACACCCCTTTCCTTTCAGTTTTACGAGTGTCCCCACAC ACACACCCACATCCCCTATACACAGACACCCTATATACAGGCACCCCCAC ACACAGTGTGTTCAGATCTCGTGCTCGCCGTGCTAAGCGGGCTCGTTGAA TTAATTAAAATTTTACCCCCCTTTCCTTTCAGTTTTACGAGAGTTCCCAC ACACACACACACACACATACCCTATACACAGACCCCCTATACACAGACAC CCTATATACAGGCACCCCCACACACAGTGTGTTCAGATCTCGTGCTCGCC GTGCTAAGCGGGCTCGTTGAATTAATTAAAATTTTACCCCCCTTTCCTTT CAGTTTTACGAGAGTTCCCACACACACACACACACACATACCCTATACAC AGACCCCCTATACACAGACACCCTATATACAGGCACCCCCACACACAGTG TGTTCAGATCTCGTGCTCGCCGTGCTAAGCGGGCTCGTTGAATTAATTAA AATTTTACCCCCCTTTCCTTTCAGTTTTACGAGAGTTCCCACACACACAC ACACACACATACCCTATACACAGACCCCCTATACACAGACACCCTATATA CAGGCACCCCCACACACAGTGTGTTCAGATCTCGTGCTCGCCGTGCTAAG CGGGCTCGTTGAATTAATTAAAATTTTACCCCCCTTTCCTTTCAGTTTTA CGAGAGTTCCCACACACACACACACACACATACCCTATACACAGACCCCC TATACACAGACACCCTATATACAGGCACCCCCACACACAGTGTGTTCAGA TCTCGTGCTCGCCGTGCTAAGCGGGCTCGTTGAATTAATTAAAATTTTAC CCCCCTTTCCTTTCAGTTTTACGAGAGTTCCCACACACACACACACACAC ATACCCTATACACAGACCCCCTATACACAGACACCCTATATACAGGCACC CCCACACACAGTGTGTTCAGATCTCGTGCTCGCCGTGCTAAGCGTGCTCG TTGAATTAATTAAAATTTTACACCCCTTTCCTTTCAGTTTTACGAGTGCC CCCCCACACACACACCCACATACACCCTATACATAGACACCCTATACACA GACACCCCCACACACAATGTGTTCAGATCTCGTGCTCGCCGTGCTAAACG TGCTCGTTGAATTATTTAAAATTTTACACCCCTTTCCTTTAAGTTTTACG AGTGCCCCCACACACACACCCACATACCCTATACACAGACACCCTATACA CAGACACCCTATACNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNC AGATCTCGTGCTCGCCGTGCTAAGCGTGCTCGTTGAATTAATTAAAATTT TACACCCCTTTCCTTTCAGTTTTACGAGTGCACCCACACACACACCCACA TACCCTATACACAGACACCCTATACACAGACACCCCCACACACAGTGTGT TCAGATCTCGTGCTCGCCGTGCTAAGCGTGNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCTCGTGCTCGCCGT GCTAAGCGTGCTCGTTGAATTAGTTAAAATTTTACACCCCTTTCCTTTCA GTTTTACGAGTGTTCCCACACACACACACACACACACATACCCTATACAC AGACACCCTATACACAGACACCCTCACACACAGTGTGGTCAGATCTCGTG CTTGCCGTACTAAGCGTGCTCGATTTTGAAAAGTCTACAACATTTTGTCC GTGATTGTATGTATCTTATGATTGTAAAGGGCTACGTGCATCAAGTTTTG ACCAGTGATAGATAATGGATATTTAAATTTGAGTTTTATCGTTTTGATCC AGTTAATTTTAAGGGTATATTACTAGACGTCGTCGCAAACGCCGGTTAAC GGTTTTGCTTGTACATCAAAAGCCTTTAAAATACTATAATGTTGGTTAAT ACACTCTTCTCGAGATGCATAAATTTATTGTTGTCCTCGTTTTGAAACAG ATTTCATTGCTATAAAATTACATATTCACAATGATAATTGTGTTGTTTAC ACCTCATGAGACATTTTGAATTTCAAGTACTTTTGTTTTAGAGTTAACGT TTGCCTTTTGGGAATTTAAATTGGTTTTAATGTATAATTTCATAGCATTG AAATCTGTTTGAAAACGAGGACAACAATAAATTTATGCATCTCGAGAAGA GTGTATTTCTGACATTGTTTCGGCTTAAAATGCCGAAAACAATAATAAAA ATTATACTTCTAAACTTTCTACATTAGTCAAAAATTTGTGTCCGTAAGCC TCGTTGATATGTCTTTTTAAGATAACGGAAGTCTGTGTTCAATAAAATGC CATAGTGACCCTGTCAAAATTATCGAGGGTACCCGTCGTTGCAGACGTCC AAAGGTGTCTGAGGTGGTGAGAGGGTTGCTTCTAGNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNGCTGAGCACGGCAAGCACGGACTGCGAGGGTGTATTACTAAACA TCGTTTGATGAGCACGCTGAGCACGGCAAACACGGGATATGAAGACACTG TGTGTGTGGGGGGTGTATGTACCAATTGTGTGTGTGGGGGGTGTATATGA GTAGGGTGTAAAGGGTGTGTATGAGTAGGGTGTAAAGTAAAGGTAGGGTG TAAGAATTTTCTTTGACAATTCAGACACGCTGAGCACGGCAAGCACGGAC TTCAAGGGAATATGACTAAACATATTGTGCCGGACACACTGAGCACGGCA AGCACGGACTGCGAGGGTGTATTACTAAACATCGTTTGATGAGCACGCTG AGCACGGCAAGCACGGACTGCGAGGGTGTATTACTAAACATCGTTTGATG AGCACGCTGAGCACGGCAAACACGGGATATGAAGACACTGTGTGTGTGGG GGGGGGTCCTAATTTCTTGTCATGAGTTGCTTTAGTCTGCGTTAGGAAAA TTGTAACCAAAGTTCAAATATAAAGTGTCAAATATTTTAGTTTGATCAAA GGATTAAAGCCTTGGCAAGATTGAGATTAACGGAAAGATATTTGTTTATC AATGGCTTAATAACTATAACGCTTTTTTCATCGACCGTTGTGTTTATAAA TCAGCCGCAATAGAAAATACCGTATCAGACATTTTTTGATCATGGCAAGT ACTAACATTGGCAGTAGAGTTTGACCAAGTCTCTTTGATTGAAATGAAAT GCAAATTTTCAACTAAAATGTATAAATATAAATTAAACCTTGAGTTTTTA AGAACCTACATTTAGATGGGTTTTATCGGTGGAGAGGGGTGCGATTATTA ACGCACTCTAAATTGAGGTAGACATGTAGATATAATTAATTTAAAGTTGA AAGGATATTTATTTCATCATGTTATCATGTTGTTTTAATGAATTGAATAC ACGTTTATAAGGAACTAGAGGCTGAAATTGGTTCAAAAAATAAGGAATTG TTAAGGAACTGCTCAGGCTGAGAATAAGTGGATTTGAAAATAATGTACCT TATAAGGACTAATTTGACCAAATTTTGATCTTTCAAGGGGCAAAAAGTTC AAAATTTCCTATGTAGTAAGGAACTCGATAAGGATCTTTGAGACTGAAAT TCTCTGTAAAAATAAGGAACTCCAGGCTCAGAGCAAAGTTAAGGTTCCTT ATAAAAAAAAAATGTGTAATCTTGATTCCAAGGGTAAGGATTTAAATAAC AAATTGAATCGAGATTTTTATAAATAAGCTAAAAGAATTTTTTTTTACTT CTGATAGATGCAGTTTGTATTAATGAACTGCTTAATAAAGATTAATCAGA TCAATACCAACTAGATCCTAATTATGCTCAGCTTTTCTTTAAATCTTTCT TGTATATCAAGCAGTTTAAAGTTTAAGATGATGAGAGATTTCACTTACTT CGACTGAGTATTAAGACACTGTTCGAAATCAATCACTTTATTATTGATAT GAGGGTTGTATGGGGCAGAAAGTTTTTCAGCTATTCTTGGTATGTGCTGA GTAAGGTTCATTCCCTTTGAGTATATACTAACTCTTCCGTTTTGTCCACC ATTTTTCAAAAAACAACCCTTCAGTTCTAACATATCAAACTTTAAAAGTC TTCTCATAGCTTATAGTGCTCTGAATTATCTTTTCAACGGTATATGTTGA TCATTGAAATTGAAGTATCGCTAATCTAGAATGATAAACAAAATAAAGAA TTAGTGTACACTTAAATCGATGGGCTGAAGGTATATGGCATATGATTGAC ATTTCCTCCGCGTTCGACCCTACCTGTGTCCAGAACCACTTGCATCGCTT TTATAATTTAACTTATTTCAAGAGCGCTATCCGAGTCATGAAAGCTCACT AAAGGACACGAGTTAGACACTTGGAGCAAGCTTAACGTTTTTCAAATTAT ATGAAAGCTTAGTCTAAAATCCTCCACAAAATAAGCTCTACTGGTTGGCT AAGGATCAACAGAATGAATAAAAAATTGCCTTAGACTTGTTCCCTTAGGT ACCAAAAATTAGTCTGAGTTCAGTTGTGGCTCAGTCTTACTGTTAGCTAT GCTAGCGAATATCAACACACCTTGGCCATCATTATGCGCAAGGTTGTTGA TATAGCTATCAGGTCCTAGAGATAATTGGATCGAGGGAATATATTAGGGA GAGTATATCGGAGTTCATAGAGTAAAGACATAAGAAAACCGTAGTTACAA ATTCTTACATTTATCACACCCCCAGAACAACATTTTGTTAGCTCACAAGG CTAACAAGTGGAGGTTCTACCGAGATCCTTAATGGGTCTTGGACCGTCGT ACTGTTCTGGGGAACCGAGAGTTACATAAAGAGAACTTAAGTTTATAAAT GGAAGACTAGCACCTTCAAAGGTAGTCAGAATTTGATTGAAGGGAATTTT AATATGGAACTAGACATTATGAACTTAGGACATTGTAGTAGAAATCTATA AAAAGCACATTCTATTGCTCTCTATTTAATTCTGAACCCCCAGGACAGTT TTGTTAGCTTCGGCTAACACTTACTAACCCTTGTTTATAAATACCACTGT TGAATTAACCCACCCCGGTGGAAGTGAATCCTCACAACCAGCCAATTTTA CAAGTCACCTCGGAAAAATGCCCCGCCATAGGCACTGATAAAGGGGTGTT CTATATTGTCAGTATTTGTTTTTACTATATTGGTTAAAAGTATAAAAGTC TTCTGCTGTTTTTATTTCAGTTGCTTGGGTATATTGGTGACATTTAGGTT TTGTCTTGATCCTGCATTTACTTTTAGGTGATGGGGATTGTGCCTTTGTG CTCTTATAAAGTGTTTCCATAAATTTGTATTTACTATTTAGGAAAAGTAG GAATTTTGTCAAAACCTTTGAGAATTTACAAAAAGTAGCAAATGTCGGAA ATCCTTGGGACCTCCTTGAATCCTGATCTTACTAATACGCACTGTACGTA TAAAAGTATACGTTTTTTGAAAAAAATTCCTCTATTTTATGATACCAATA TTTTATTTTAGAAATATAATTTTAGAAATTTGTGTTTGACTTAAAATAAC TATAATTATAAATTAATTAGAATTCTGGGGGGGGTTTCATGGTTGGCGGA GGAGCGGAATCGGCCCTTTTTTCGGACGGAGTGGCGGAATTTGGCGAACA TTTAGACGGAATTACGGAAATTGGGTTCTCTGACGGAGACGGAAAATTAG ACAATTTTAGTGCGGAAAAACGGAATTTAGCAAAAAAATTTGCGGGATTT CGGAATTGGTAAAAGATATTTAAAATTTGCGGAATTTTCGACAAAAATAT TGAATTTCAAAGGAATTTTCGGTGACGGAATTTTGGTTCAATTTAAGACG GTTTGACGGAAATTGGAGAAAAAATTGGCGGAATTGCGGAATCGGGTACC CCCTGAAATCCCCCCCAATTCTAAGATAGCTCGAGTCTCACTTTTTTATG TCTTTCAAAGTTTTGTCAAAAATAAGAGAAGCTTAGGCTGAACCAAAATT TTCTTGTTCTTATAAAAAAGTCTGTTTTCTTCATTGAAATGTTGGTGAAA TCTTTGAGAAATATTTGACTTTTTCTATGTCATGCCCAACTGTGTTAAAT GAGGAAAAACAATAGAATAAGAAAAACTAGAAATGAAACAGGCGACAGAA AGAGATGATTTTTAACGAAAGCTTCAGCAGGGAGAACTTCCGTCTGATTA GTACGAAAAGTTTACACGTTTTTTTTTATAAGAACGTCAAAAATTTTCGA AGCCTCCGGATGATCTTAGTTTTTTGGATTTGAAGCCTAAAAATGTTCTT AAAATGTTCTTATTTTCAGCATTTTTTGAGCATTTTGATGTAGTTTCTTA AGAAAATGCATGTTTTTAAGTCTCCAAAGCCTTAGAATGTTCTTAGAATG CTCTTATAACTTTTTGGGCCTCGAAGCCTTATGTTCTTATATAGTTTATT CTTATAAAAAACGTGTATTTTACAGAACAAGCTTTTTTAATAGAAAATGC AGAACAGTGTTTTGAGAAAGTAGGAGTTTCTTTGTATTGATAAGAAATCA TGTTCAGCGCGGCGTGATGTTATTAGCAGAAAAAATAAGGTTTTGAGCGA CCTTTTGATACACCTTTGTGACTTTTCTCTTTTGATGACAGGATAGAGTT TTATTATCTTAAACTTTCATATTTTGCTTTGTAAATTTTGCTACCCTTGT CTTGATGATTGTGGTAGAAAACACAAATTTGAATTGAAATTTTATTCAAC TCCAGTTTATTTAATACCTTCATGGGTTTTATGGAGTTTAACAGAATGGC TGTGTTGTAACTTTTCCTGTTTTCTGATAACGGAAACATAGTGTTGTTTT AAGTGGTTTGCCAGCAAATAGTAAATTAAATGCTGGCTATTCTGGTCATG ATTACATCATATAGTGGACAAGATTGTCGAAAACTATTACACGTTTTTTT TTATAAGAACAAAGTATATAAGAACATAAGGCTTCGATGGCCGAAATATT AAGAACATGTTAAGAACATCTTAAGGCTTTGTGGACTCGAAAACACCCAA TTTCTTAGGACATTGCACAAAAATACTCACAAGATGGTGAAAATAAGAGC ATTTTAAGAACATTTTTAGGCTTAAAACTCAAAAAGTTTAGAACATCGGA AGGCTTCAAAAATTTTCGACGTTCTTATTAAAAAAAAAACGTGTAACACA ACAGATGAAATTTTCATTAAATTAGGTCTGAGGAAAAAAACTCTAATATG CACCTTATACTTGATAGTTTTAATTTTTCAAGAGACTTTTTAAGCGATCG AAGTAAGAAATCTAATTGAACTACAAATTCTAGAAAACCGTTGGCTCATT ATTGATATTTCTATCAAAGAGAACATTTTATGGGATCGGGGAACCAGATT CTTTGTGGGAAATCTTTTCCTAGTCTATTTCATAGCCTTTTGGTTATTAA GTATAAGTCGGGTAGATGTTCAATGTATGACAGTATACTCATTCAAAATG CCTAAAAGCAAAAAAGGAGTTTGAAACATCAGCAAATTCCTCTTCCTTTT TTTCAAAAACTGTTTGACAATATAAAAGAATGTTTCTTATATTACGTCAT TCTGGTCTTGAACAAATCGGCTTAACTTCGTCCCTCCCAAACATCAGTTT AAAAAGATATTGTAGGATTATTATTCAATAATTTGGGACAACTTACCGTA ACCGCAAATCTATAGTGGGTGTAGTTGATTAGGATTGGACAAGCCTTTTC TTGAAAAATGTAAATCTAAATTCAAAAACAAGTTACTTGTACCGAAAAAA AACATTGTGAAGTGTGAATTCCTTAGTTGGTTATAGTACATTTGACAAAG TGGAGATTTTCATGATAAATATATTAGATTATTACAAATCATCATTGAAA TAGAAAATCTTAAAGGTTTGTTAATTGGCTTTTACAGAAGAAAAAAAACC GTATACCCCCTGTTGAGGAGGTCCATTTCCGTTCCAAGAGGGTAAGGTTT GATATGTGGCGGAATTCCATAGGGATACAAAAATCTGTCAAAAATAACTG AAACTCCATGGGGTAGCTTTTTAAATCCTACTAAAATTCAGAATTCCAGA GTGGATTAAACCTGAGGTTGCCTGGAATTCCAGGGAATTACAGCATTTCC AGTCACAGAGGAATATACCTCCCCAACAGGGGTACACGGTTGTTTTCTGG AAAAGCTCAATTAGACTTACAGCATCTTGAACATACAATTGACTCCCTTG AATTGAAAGAAGATTTCAAATTACAGAGAGGATTTTATACTATAGGAAAA TTGAGAGATAATCATTTTGATTCGACTTACAGGAAGATTCGAGTTATAGA GGTTTGAATTAAAGAGAGTTGGCTCTATAGAGAGATTATCTTCACGCGAC AACCTCTTGTATTTGCGGATGTTTTTTGAATATCTTGATTTCAAGAAGAA CCTTGAAGTTAGATCAATGCGAACTTAATCTTTTTTTCTCGGTCATTTGG GTTCCAGATGCTTGGAAAATCCTTTGCTCCAGATACAGGACGAAAAACTT ATTTATCTGGACATGATAAATTCTTATAATTTTGATGTTTACAGGGACTT CCATCTTATGGGCAAGTTTGGACAATTTTTTTGAAAATTTGTGAAAGAAA AATTGTTTTTTGTTCAAAAAAAAAATTAAAAAGGAATCTCTACACCTAGA CTGGGACACTTATTTTTAATTCTACTAAAAACCTTTTCTCCTCTCTTGTC TTTCCAAAATTTTTATTATGGGATGCATGCTGTTTTGCTACAGTGTGTTC TTATTCAACTGAAAATTTCATTACGATTTTTTGTGTTTTTTTTTCGTCCA TGTATAGTACAAATGGTTTATTTGATAGAAATTTTTTTTCAAACATTCTC TAAGTTTTTTTAACAGTAACATTTCCTCGTTTAGTAAGAATGGTTCTCTT TTTTTTCTTGGTTGGTAACACACTGTTTTTGGAAGTTTGCCAATTTTTCA AAAATGATGGTCTGCTAGGCGCTTTTATATATCTTTAACGTTGTAAAAGG CGTGTTTTATGATTATATAATTACGTTTCGAACTGACTTTTTCATGCATA CGTCGGTTGGTTATGTAATTTCAGCATTTTTTAATCGATTGGTCTGTACG AACAGGTGATTTTTTATTAAAACATTCGAATTCTATTAGTTGGTTGTGAT GCGATGTAAATCAGCTTTCTTATACCTTTAGCTGATGAATATAAAGGTTT TACTGTTTAGTGGTGCTCGAATAAGTGAGCTTCTGTATATTTCGTAGCTG AAAATTACCAAGCTATTCTCATGTCTTTGGGTGTCTATTGGTTTTAGACC CTGGCAATATGTGATTGTCTTTTTTGGGAAAAGCAGTTTCTAACGTCAAC TCCGTCGTTGCCTACATCTTTAGGAAAACTTGAAATTTCTTGGCTGTAAC GATAGAATACAAAATCCGAACCATATTGCGCTAAGCTCTAGATTGGGTTC AATACCAATCAATGTTAATCTGGATTTGCTTCATTTGATACATATTTCGC TCAAATATTTATGTAGGGCAGCTTAGACAGGGTACAATCAACTTTGTTAT TTACCACTGCCTCAGTGACCCGGTGGCTTTTAGAATTATTCAGCGGGGAT ATATTTCTTTGAAAGTCCAGTGGGGATTTTTGAAAAACGAAAAACACCAG TAGGGACACTGAATTTGGATAAATTTCAAAAGGAACAATATTTTTATATT TTTGTTTAACAATTTGTATATGACTGATGATAATAATATCATCAATCAGC GACGATTTTGACAGGTACGTAGAAATAATGGTTGAGCAACCTCATGGGTG TGGTACCAGGTACTAAATATGCTTCTCCTTGCATCTCGTGATTTCACCAT TAAAAGTAAAAAACATACGTGTCTAAAATCCCGACTCCAGTAATAAATTT GATATCAAAAGAACTACATGACTTTTTAAAGGTCTTTAAGGGAGCTTTTC CGTTTGGCTTTTATTAGAGACTAGCGCTTGATAATTCATATGAAATAAGG TTGTTTTAGAATGAAATTATTAAATATCTAGCTCTGAATAAAGAAATAGC TTTTATAGAGAAACATCTAGACTAGTAGACGAATGGGAAAATACGTGGAT ATAACTAGATGTTTATAGTTAAGCGGAGAGGTTTTTTTTGGAACTATATA CAGAGGAGTCACATAAGAAATCACTGTGACTATTTGAGTTGATTTGCGTC GAAATTTATAGATAGATTGCATTCCGGTGATTTTCTTTCCTACATATTAT CCAATCATGATTTTACTGTGGGCAAGAAATTCTTACATGGTATACTACAA AATGTATTTTGTAAAACATTAGCTAAAACTTTTTGGTTTTTGCTCCCTAT GGTACTGTTTGTCGGAATATCTATTTTGAATGAAAGAGGCAATTCGAGGA TTTATAGGGATTATCAGATAGTTTGAGGTTTTTGGCCTTTAGATGCGCCA AACCTCCAATTGGCCCACTTAGTCCTTGCCCTGCCTATTTTCTAAATTCA AAATATTCTAGTTGCAAGTTTTTATTTCACTTCTAGCAAAAAAAGCAATG TTAATTTTGACGTAAGAACTGCAATAAGAACCAATTTCAAACAGTTAGAT ATTGACTTCAGAAAAAAAAATGATACGCAAATATTTGGAGGTAGTGTTCG TAGTGCTCACGCCTATGAAAGGAATTTTCCAGCCAAAGATCTCAAACCAT CTGGCTATCCCTCTTAGTCACACCATTGCACCATTAGATTATAGGTAATA GAACTTGTTTAGAACCCTCAAAAACCCAACGAGTTTTTACGTTCTTAAAA AACTTTTTTTGTGTACGTAAAGTTAATTGCCTGCCGCCAAGCTTCGAGTT GAATTATCTCGGTAATTGAAAAGGCTTAACGTGTCTAATACTGTTAGAAA GCTTTGCGCAAGTTATCTATCTCCGACATTCTATCTCGCAAATTTGATTT AGATCATGAATCTATCGAAAAGAACTCTGGTTTTAAAGCACGAGGGAATC TGAAAGGGTCAACGAGAATACACAGTTTTCGAATTAATTCTCGGAAAAAA AGTTTTTAAGTAACATTCTCTCTGATTGACTAAAAACTGCGGATTTTAGT ACATTGCCGATCCGAAGTTTTTTTTTTTGAAAATTGCACAGAACCCAAAA ACAGAGCTATTTGGAAACCTTCATATCCTCTGTACTTTCTTATTTTATCT TACTTTTACAAAAGATTGCCGCAGTAGTAACGATTTTTTTCACTATAGGG ATTTATCCTTATTGATAATCCCTTTTTACCTCTTTGTATTTTCAAATCTT TTGAATGAGAGTCATCAGCGAGAGTACGTTTATCAGGATATAATAGGAAC AAAAGAGGTACAAATTATCCTACAGCGAAATATCGCTGTGAAATTCTCAT CTTACTTACTTAATTCTACCTAAGAAGCTGTGTTCAAAATTCGAAACATC TAAATTATTTTTTGTTTGATTATTGCACCCGCAAATATTGTTTTGCATGT GTTTGAAATATTCTTTGGTAGGGTTGTTTCCTCGACAGAGGTTGGATTAG TTTGACAAATACTTCACCTTAGCTAGAACTGTTATCTGGTACCTGATTTT CTTCACAAATGTTACCGCTCTAAAGGTCGGAAAAATTTNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNTTTAGAACCCTCAAAAACCCAACGAGTTTTTACGTTCTTAAAAAACT CTTTATGTGTACGTAAAGTTAATTGCCTGCCGCCAAGCTTCGAGTTGAAT TATCTCGGTAATTGAAAAGGCTTAACGTGTCTAATACTGTTAGAAAGCTT TGCGCAAGTTATCTATCTCCGACATTCTATCTCGCAAATTTGATTTAGAT CATGAATCTATCGAAAAGAACTCTGGTTTTAAAGCACGAGGGAATCTGAA AGGGTCAACGTGAATACACAGTTTTCGAATTAATTCTCGGAAAAAAAGTT TTTAAGTAACATTCTCTCTGATTGACTAAAAACTGCGGATTTTAGTACAT TGCCGATCCGAAGTTTTTTTTTTTGAAAATTGCACAGAACCCAAAAACAG AGCTATTTGGAAACCTTCATATCCTCTGTACTTTCTTATTTTATCTTACT TTTACAAAAGATTGCCGCAGTAGTGACGATTTTTTTCACTATAGGGATTT ATCCTTATTGATAATCCCTTTTTACCTCTTTGTATTTTCAAATCTTTTGA ATGAGAGTCATCAGCGAGAGTACGTTTATCAGGATATAATAGGAACAAAA GAGGTACAAATTATCCTACAGCGAAATATCGCTGTGAAATTCTCATCTTA CTTACTTAATTCTACCTAAGAAGCTGTGTTCAAAATTCGAAACATCTAAA TTATTTTTTGTTTGATTATTGCACCCGCAAATATTGTTTTGCATGTGTTT GAAATATTCTTTGGTAGGGTTGTTTCCTCGACAGAGGTTGGATTAGTTTG ACAAATACTTCACCTTAGCTAGAACTGTTATCTGGTACCTGATTTTCTTC ACAAATGTTACCGCTCTAAAGGTCGGAAAAATTTTCAACTCTTTGAATGT TTAGATTATGGGAATTACACCAACCATGCCACAGATTTTGTGGTGGCAGT CCTGAACCCTAGCCCTCGGCTTTATCTATCATCCCACTCCTCTGGGAAAT CGACCCGCATTATTAGAGCTTCAACGTAACGAAAATCAGATAACTAGATT TGACGCTCTATCTCATTATGCAAACCTAAATCTTAATCTGTTAATTTGTA AAGTTGGTTTTAATGGGATTCTAAAGTAAATATGGCTTCTTAACATCAAG ATTCCAGGGGTCCCTTTGAATTTCATTTCAATAATTCGCTCTTTGAAAAC TTTTTGGCCAAAATCGTAACCTGTTTTATGTTTACCCTGAGTATCAGAGG TTAAGTTTTCAAAGAATATATTAACCTCTGAAGACCAATATTAGAAATTT GATCGCGCATGTGTCAATCTAATCACTGTAGAAAGAATCAAAGGGATGCT CTTAAATCGGATGGCCAAAAGTCACCTTCATTTTTTTTTTTTATTTTTTT ATCCACGGATCGCTGATAGTCACCTTTCCGGGGGGTTTTGTTGTTTGGAA TTGCTTAGGTCAGGATTGCTAGTAACGGCTTGTCACACACTGTGCCGGGT GCATACTCGGCACCGCAGGGTTGCTAGTAACGGCTCGAATTTCAGTCAGG TTTAAAAAAGAGGTACTTTTACCCATATTATAATAATATTACCCCCGTCT TTTGCCAGTTCGGTATAATATGTTATGAATTGAGTGGTTTTGCTGTGTGG CGATGGCTCAACGGATAGAGCGCTGGCTTCCAAATCTAAAGGTCTTTCTT TGGTGGTGGTTCGAATCCCAAAATTAGACTGGTCGGAATTGATGGACAAA TGATTGACAGGTATGAAAACTCAGTCAGAAATGAGAAACTAAGTCTCAGA AACTCAGACAGTCCAGAAAAGAGAAAAATAGGATAAGAGATAGGAAAGAA AAGAAGGTGAGTTTTGGCCATCCGATATAACATTTTCCGAATCAAAGATG AAGAGCAAATATTACCTTATAAATGTCTAGCAGAGTGTATCAGTATGCAG TTTACTATTTACTAATTCCCCAGAAACCTCCAAGTGTAATTGAAGTGAGT TTCTTTAAAAACAAATCTTTTACATGATCCCCAAATGTATAATAGTAATT ACTAAACTATTAATTATGGAAATGTCACTTTTAATTGAATCGAAATAATA GACAGACTTTATGTTATGATTCTCTATCACTGACNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNA CGACGGGAATAAAAATATCAACTTTGAACTTCATCCAAGATCTTGGATGG TCGTCATGGTTACTTTTGTCTTTGTTGATTGCGCGCTGAATAGAATCTCG TCTCGTCTTCGTCGGCACAGCGTCGATATATGATTTCGACCTGTGCTTTT CACGGTATTTTATAATATGAATGCGTTTTTAAAGAGCGGAAGTACAAGGG TTTGACAGTGTGATGGGTTAGCTCTTCTTCTTTCCATCGGTGTTGCGAGA AAGTGGCGTTATTTCAATATCAAACATGTGAAGAGAAATTACGGATATTA GCAATTTTTGCTATCAGTATGGACGGTGGTTTAAGGGCTCTGACCATAGT CGAAAAATTGATTTTGGTATTTGAACATAAAAGTTATATTTCATGTTCCT TAACACTTTTAACAAAGAATTGCCTTTATAAATTGCTTTTTAATCGAATG CCTTAAGATTAATTAAGAAGTTAATTGCAAAAATGACGTTATGAACTTTA AAAAGATGTTAATAATATGTTGCATCACCCTCTTTTACAAAAAGTGCTTA GTTTTAATGGGTACNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNTTAAGAAGAATGCTTCAGTTTTTCGGTGTTCCCG ATCCCCGTAACGCGACCGAAATGAGAATAAAAGAGAAAATGAAGACTTAA AAGCTAAAAGCGTTCCTCTATAAATTGGGACCTTTTACTTATTCTCTTAC TAAAAGCCTACCACTCAATATATTTTGAGGGCAAGGAGATAAGACTTTTT TATTGATATATTTTATTCCAGGAAATTAGAAGTTCGTTGTTGATTTTACT ACATTGGGTCAGACTAGAATGGATCAAAAAGGTTTCCCTCGGGTTTGTTT CCTACGATAACATCTTTGAAACACTTTAGAAATTTGTTTTTATTGATTGA TTGACAGGGAATAAAGATTGGGATATGTTGGATGACCGGGCAAGTTTTGG AGTATTTTGGCGAGGGCGTACTTATAGTTAGCGATGTTTTACATATGAGC TTTTAATTAGGTCTTAGGCGTGGTACTTGTTAAGAAGACATATGAAGATT TTAGCTCTGATCATGTATATAATAAACTTTTGGAATGAGTAATTATAATT TATTCGGCACCCCATCAATAAACATACCCTTCTTCTATTTCCAAAAACGG TTTTGTATAAATACGTATATAAAAATGATGTTTGTCTAAAGGTCTGTCTC AAACTAATCTGCAGAGAAACAAAACAGACTGCAACTTTTGATATAATTTG AATTGGTTTTCTGCTTGTTGAAAATATAGTTCGAAGTGGAATATTTATTA TTGAATAGTGAAAAAGTCTGAGTGTGAGAAAATTGGGTTTATGGCAAATT ACGAAAAGTCGTTATGCAAATGATGCATTAACGTCTTGTCAGACCCTAGT TATTGCGGATAGTAAGCGCAAAATGAAATATCAACCTTTGCGATCACAGA TTGTTGTTTTTCGAGGAAAGCCCAAGTTACACCCACGGTAGATTATTTAC GGGTTTAAGGCTGGCGTCACACGTCAACTCGTGGTTAGCTAGTCAGTACT TCCTACGTATAAAATTGCTATTACCATAACGACCAGAAATTTATCTAGTG TAGAAAATTGAATATAAATTTCCCTTATTTTAGTTCAGTCATTAAAAAAT GATAACATCCTTGAATAAAAAACAGTTATCAACGAAAGAAGGTCTCTCTT TCCCCGCAGCAGTAAATATTTAATTTTTTATACAGCTTTACACGATAAAT GGTTGTTTTTTCACATGGTCAATGGAAATGTATAATGTATAAAAATACAT TGTATACTGTATACATACAGAGGAAAAAAAATTCTTCATAAATTTTTTAA AATCTTCTATACTTGTTTCTTATACAAGTATACTATGCGAAGGTTATCTT CTTCTTCTTTTTTACAATTTTTTTTTGTACAGTAGAATTTTTCTTTTCTA TGTTTCAACTGGACACTATCATAGCCGCGCTGTGTAAAAAAATATTTGTA CGGGTTTTCTTTTTTCCTTTTTTTCCTCGCTACTGATTCAAAGTTGACGT TAAATTTTTTTAAAAAGGGGAAAAAGAAAAGTAGACGAAATCTAAAGTAC TTTTATGTTATCTGCTGGATGGTAAAATTAGATATTTCAATGGAGGATTT ATTTTGATATGTCATCAATGAGATACAAACTGTCAATGGAAATAAAATAA TCAACATTTTCACTATTTGACAAAATTTGTTCGAATGTTCGGCTGCTATT ATTCGTAAATTTTTCAAAGAAAAATATTTAGGTGTTTGAAATCAAGTTAT TTTCACTTTTTTTCAGTCCATTTTACTAAATACATACATTGTTGTTTTGG TTTGGTTTATGTTGACAAAGTTATATCAACCTCAAAAATGGTAAGGCGAT AATATATATTACTGTACAAACTTTCGATTTCAAATACACACCATCATATA AAACAAAGACACGTGTAGGGGGGTGTAGTGGGTACCTTATCGAGTGAAGC TACCTGCTCACCAAAAGATTATTCGAAAATGGTCCCCGTTCATGGATCAA ATTTCTAAATATCATACATTCCCTTTTCACAGAGCGATCGGGACACAAGT GGAAAATTATACTCTGATTTTTGTCCCCGTCGAAAATAATCAGATAAGCA AATAGTCACTGTAAAATGTTGTACTAATCTTTATATCCCCACTGAACTAT CTGACTCGAAAACAATGAAATTCAAATCCACAGGTCCGTCAATTTTACCT CCATTTGCTGAGAAAATCCTACCGGGTCTGTGAGAAGGGGCTGTTTTCCT ATTGAACAAATATCTTGACACTTATCGTCATCCATACACCCCTGTCTCAT AGCCCCGGTGGAACTTTTATTCTAAGTGGGGATAAAAATTCCTATTGAAA TCCCCAATGGAGATAGAAATTCTATTGTTCCAAGGTTAAATAACTCAGTG GGGATGGTTTTGAAGTCCAATTTTTAAACATTGAATTTGGAAAGGGGATG AAATCAAAGTCAATTCGGTGCTGAAATCCCATTATGGTATTTATTCACCG GGGACGAAGTTTTGCTAAATTTTCCAGAGGCGCTGTGGTGCCAGCGGGTC TGTGACACAGGGGTGTGTCAAACCCCAAAACATGCGCTGAATCGCCATCC ATTCTTAGACAATCTACAATTTTTATCACCGCTATCTTAAAAGCAAGAGG TTTTTGATACCCAACGACAATTAGATTCTTCATTTCATCCCTACATATAG TTTTTTTAGTTATGGTGAATTAGATTTAAGTTGGCTTGGTGAGATAACTA GAGTGAAATTAACTGGAATATCTTCCCGGTAAAGGCTTTTCAAAATTGAA TTACGTATTGACTAAGTTTAAAATTGTGATACTATTTAAATTTCAACTTC ATTTTTAGTATGGTTTTATTCACTGTTGTTTGCATGATTTGATTCTCAAA CAATTTGGTGAAGAAACATGGAACGCTATCATGTAAGTATCAATGGATGC AAAAACGTCATAGCACGATTGAGTGTGTTCTTAGCATTTGGTTTCCTTAT ATGGAAGCCACAAATTTCTATCACACATAACTACATATTCTCCTGTCTGT TTCTTAAACACAAACATGTTTATCAGAAGAATTATCCTACTGTTATCGAT TTAGAGGGGCTGTGAATAAGTGCAATTACCGACAAAGTGAATGTTTGCGC ATACAACGGAGACCTGTTTCTCAAAACATTTGTTTTGAAAAGCTTTATCC TTTACCGCTAGTGCATGCATTTTGAATATTCAGGAACCTTCATAGTTATT TTTTCCCTTTGATAAAAATCTTGTGTCATCGTTAGAGCCCCCAGCCCACT ATAAAATCTGGCCAAGAAATAGTCCCATGTGGAAAAATTCCTTGAAATGA AAACAATAGACTTTCTTTTTACATTGGGATTTTGATAGAAGTTTTCAAAC TTCAAACTTCCACCGGGACACCGAGACACCTGCTAGAAGGTAGTAAACTT TTAATCTAGCTTGGAACTTGGGATAACCTGGAGTCAGTGTCTTGCTGATC CGAACTATAGAAATGTTTAATGGAAAATAAAACAATGTAGTGTGCGTCGG TTTGAAAGCACACTTTCAAATCTTTGATTCCATTTTAGAAAAGAAGCAGG TGTCAACTTAGCTGGCGGTGAATATATTATCCATCGTGTATATTCTGATC AAGAAACAATGAAATTGGTCACTGTAGCTCAGAAGCTCTCTGGTAAGATT ACAACTTCTATACTTTTTTCCAAATGATCCTCTTCTTCGTTAAACAGCTG TCACTTCTGGTTGTATGAAATCCTTTCTTTGGTGATTTCCTGTGTCCTCG AAGCTTCTCTATCCGGCTATCGTCCTCCAATTTGGCTCATCATGTCTGAT TCATCAAGAGATTTGAATATAAATCCATTACCATTCCAATGGAATTAGCG ATAACTTTGGTAAGATACTAGTTGTCAATAATCTAAGTCGTTTCTGACCA AATTTCTTAAAATTTCACTTTTTAGGAATACCTTTGAATGACATTCTAGA AACATTTGGTAATCATTTCTACAAATACTGTAAACAATCAGGATACGACC GAGTCTTGAAAATCCTTGGCCGAACTCTCCGGGAATTTCTTTGCAATCTA GACGCATTGCATGATCATTTAGCGTCCATTTATCCAGGGATGAACGCACC TTCCTTTCGTGCCTCCGAAAGACCAGATGGTGGCCTAGATTTACATTATT ATTCAAATCGTGATGGTCTTGGCTATATCGTGATTGGAATAATGAAAACG GTGGCCCGAGAGTGCTTGAATACGGAAATTGAGATTTATATTGATAAAGA AAAAGAGAATAAAGATGACCACGTAGTTTTTGCTGTGTTCGAGAAAACGG CCACACAATGTCCTTCAATACCGTCTATAACATTCCCACCGGCTTCCAAA TTCGAGCATCGTTCAAGTTCGATAACAAGTTTTAAAGCATTATTTCGACG GAAGAAACATTTCATGAGTATCAAATCTTTCACGGAAGCGTTCCCTTTTC ACGTTGTTTTTGATCGGAATTTGAATATCAAACAATGTGGTTCATCTATC AGTAAATATATTGAACAATCATATTTTGAAGTGAATGGACAAACCAATAG GAAGAAGAAAGGCAAAATTAAGTATCCGTTTACTGATGCGTTTCGTTTGA TTCGTCCAAAGATGAATTTCACTTTCCAGAACATTCTACATCACATCAAT ACTGTTTTTGTGGTTGCATCCAAACATCGTTTAGAACTAATCCGTGAAGA CTCAGATGGAAACATATCAACACCAAGACCTGAGGACCTCAAAAAAGGAC TCAATCGTGGCCGACACACTGGATCCGCATACTCGGCCATTCTCTCTGCA GCATCTGTCTGCACACCAAGTTTAGTCACAAGCACAACAAGAGCAAGTGA ATTGAGACTTAAAGGTCAAATGATCTATCTCCCAAAAACAGACTGTCTAT TATTCCTCTGCTCACCACGTGTTGGAAGTCTGGAAGAATTAAGAAGGCGT GGTCTCTATTTATCAGATTTCCCTTTACACGACTCCACCAGAGAAGTCAT TCTAACCAAGAAAGAACACCAACAAGATCGCCAACTAGTCAAACGAATCG AAGACTCGAATAACGGACTCAAAATCTTGAAAACCAAACTAGTACATAAC AAAAACATTACCGATGAGCTTCTACATGAGTTACTACCACCTATAGTTGC TCAACAATTACGTTTAAATTTACCAGTGTTGGCAGAATCATATGATATGG TCACCATATTGTTTTCAGATTTGGTTGGTTTTACAGCACTTTGTTCCAAT GAACAGGTTGTACCGATGGATATTATCAAATTGCTGAATAAGCTGTATAC CATGTTTGATGTCATTTCTCACATGCATAATGTTTTTAAGGTAAATAGCT ACCTCTTTTGACAAACTAAATCCCCACTAAAATTTGAAAAATCTTCCATT CGCAAAATTAAATCCCCATCAAGTTTTACAAAATTGACATTTCGCCATAA TTAAATAGGAACTTGATAGATATAAACCAAAATTAATCCACTAAAGGTAT TTCACTTACACTACAAGCCCACTGGTAGACTAGGAAGACTAGGGAGAGCT CAGTCTATCCACTTTTGAGTGAAAGCATAATATTTTTCATTTCAATTCTT TATGAGACTCAATTAATTCTTAGCCCTCAAATTTAAACGGCCATGTTTTC GGTTCAATCTAAAAATCTTTCGCGTAATTAAGAGGCCTTCAAGCAGTAGG TGTGAAATTAAATGAGTGAAAGAGCATGTAGTGTTCACTTGGAGAAACTT TTTTAGGAAGACCCATGAATGCTTGTGTTGAAAATAAGACCCAATTACAT ATGATAATAGTGTTATGTTATGCTACCGATAGTGAATGGTAATGCATCCA GTTACAGTGCGCAAGGTCGCGAACTCAATCTCGGACCCAGATCATACCAA AGATTTCATACTTAGTTCTAAAGGCTTTTTGCTTGATGCTCACCAATTAA GAGAACAATCAAAGGACAGTGAAGTGGTTTAGCGAGAAAGAGCGGTGTCC TAGGAAACTTTAGATAGATATCTATATCGAAAGGATTCTAGGACAATTGC CCCCCCCCCCGGATGATTGCCCCGGGACAATTGTTGATATTGGCGCTTCC TTTGAAAAGTAAATATCTTTGTAAAAATGACGTGATGGAAACGAAAACGA AAATTTTGGCGGACTTTCTCTCTTTTTAGCCGGGACCCGAAATTAGCAAT AAGAGGCGTTTTTTTGTGCCCTTTTTATTTCGGCGCACCCCTCAAAAAAG ATCGGCCGCTTGGTGAGTGCTACCAAGCTACTGTTAATGAAGTAAATTTA ACTTTCGTTTTTGTGATTATTTAAAGGTGGAGACGATCGGTGATGCATAC ATGGGTGTTTGCGGTATCCCACAACCAATCGAACACCATGCCAAACATGT GGTTGAAATGGCAATGGATATGTTAGAATGTGTACAAAATGTCATCTCAC CTGTAGACGCCCACCCTGTCAAGGTAAGTCGTACTTTAAACCCTAAATCG GCATGGAATTCCATTAAATATGGGATAAAGGTTGACAACTCTCAATGATA AAGAAAAATAAGAAAAGCCATTGTCTCGGAGCCGAGGAACTTCTTTCCAC ATGGGATGAAAATTCTTATCCCAATGGTGATATGTTTGTTCTCAAGTCAA GGAATCCAGTGGGATGGTTTTGGAGTGTAAATTTTCCATTTAAATTTACA TAGGGATGGCAGTTTTCCAGTTGGGCTAAATTTCTTCTAAATGGGGATGA AATTTTGACCAAATTTTCGAGCGGGACAGGAATCCCAACAATTCTGTGAC AGGGTAGTACTGTTTAATTCATTTATATGCTCATTTCATTTTTAGATACG AGTTGGGTTGCACTCAGGTTCATGCATGGCTGGTGTGGTGGGTAAAAAGA CACCACGCTATTGTTTGTTTGGAAAACACGTGACACTTGCCAATAAAATG GAATCTGGAAGCAGTCCCGGAAAAGTCAATGTCAGTATCGAAACTAAAAA GTAAGTTAATAAAGGCAGCTTGTACGATTCAAATTTAAAAGCAAAAAAAT ACATAAATTAATTTTAAGGTTTTCGGTAAAAAAATTTCTTGTCAATTGTG AAATTCGGACTGATTATTTACCAGCTTTTGTTTTTCTTGACTAAGAAAGC CCTTATTTTTCGTCTTCGACAGTCTTCAAAATTACGTCCAAAATTTAATC AAAAGAGGACCGTTTCAACTCTTGCACTAACCATTGGTCCGTTGATATAA ATTTTTTGTAAATTTAGTTAGAAATGACTGTAAATGTCATGTGGTGACCA GGACACACAAGTGTCGAAAAATAGCATGATATGCTATAACGAGAATCTGT ATTTTCTTTTCGTTTAGGTTTTTGAGTAACGAGGAATGGTCTTTTGAAGA GAACGCCAATCCAAACCCAATGGAATGTTATTTTATTAAGCCAAAAAAAA TCCAACCAGAAAAATTAGCAGAAAAGAAACAATTCTTAAAACAACTTGCT AATATGGAAACTCATCTGAAGGAAGGTTCACCTGCTATGCAGCGGAAAGT GATTCGACCACTCTCCAAAGTGCTTGAAACAAAAGAAATTTCGGCCACTG TTATTGATAATAACAACAGCTTACCTGCACTCAATGAGGGTGTAACAACT AAGCTGACCATGAACGGAGGAGGTTGTCCTTTTAGTCATGGTATGGTTAA GTGATAAACTAACGAAAAATTACGATTGAAAGTTAGAGAGGGGAGTATAA ATTATTTTGCTACTGTACATCGACTTCTATGACTCTTTTTTGACATTCGA ATCGACGAAACCATTATTATAGAAATAACCAAGTCTTCGTTACAAATCCG ATAAATCTCAACGTTTAACCTTTTTTCATACGATAAAATTTCAACCTGTA

Coding sequence (CDS) from alignment at sc0000012:397481..429980-

>TCONS_00001934 ID=TCONS_00001934|Name=TCONS_00001934|organism=Clytia hemisphaerica|type=CDS|length=15645bp|location=Sequence derived from alignment at sc0000012:397481..429980- (Clytia hemisphaerica)
GTTTTTGAGTAACGAGGAATGGTCTTTTGAAGAGAACGCCAATCCAAACC
CAATGGAATGTTATTTTATTAAGCCAAAAAAAATCCAACCAGAAAAATTA
GCAGAAAAGAAACAATTCTTAAAACAACTTGCTAATATGGAAACTCATCT
GAAGGAAGGTTCACCTGCTATGCAGCGGAAAGTGATTCGACCACTCTCCA
AAGTGCTTGAAACAAAAGAAATTTCGGCCACTGTTATTGATAATAACAAC
AGCTTACCTGCACTCAATGAGGGTGTAACAACTAAGCTGACCATGAACGG
AGGAGGTTGTCCTTTTAGTCATGGTATGGTTAAGTGAATACGAGTTGGGT
TGCACTCAGGTTCATGCATGGCTGGTGTGGTGGGTAAAAAGACACCACGC
TATTGTTTGTTTGGAAAACACGTGACACTTGCCAATAAAATGGAATCTGG
AAGCAGTCCCGGAAAAGTCAATGTCAGTATCGAAACTAAAAAGTGGAGAC
GATCGGTGATGCATACATGGGTGTTTGCGGTATCCCACAACCAATCGAAC
ACCATGCCAAACATGTGGTTGAAATGGCAATGGATATGTTAGAATGTGTA
CAAAATGTCATCTCACCTGTAGACGCCCACCCTGTCAAGGAATACCTTTG
AATGACATTCTAGAAACATTTGGTAATCATTTCTACAAATACTGTAAACA
ATCAGGATACGACCGAGTCTTGAAAATCCTTGGCCGAACTCTCCGGGAAT
TTCTTTGCAATCTAGACGCATTGCATGATCATTTAGCGTCCATTTATCCA
GGGATGAACGCACCTTCCTTTCGTGCCTCCGAAAGACCAGATGGTGGCCT
AGATTTACATTATTATTCAAATCGTGATGGTCTTGGCTATATCGTGATTG
GAATAATGAAAACGGTGGCCCGAGAGTGCTTGAATACGGAAATTGAGATT
TATATTGATAAAGAAAAAGAGAATAAAGATGACCACGTAGTTTTTGCTGT
GTTCGAGAAAACGGCCACACAATGTCCTTCAATACCGTCTATAACATTCC
CACCGGCTTCCAAATTCGAGCATCGTTCAAGTTCGATAACAAGTTTTAAA
GCATTATTTCGACGGAAGAAACATTTCATGAGTATCAAATCTTTCACGGA
AGCGTTCCCTTTTCACGTTGTTTTTGATCGGAATTTGAATATCAAACAAT
GTGGTTCATCTATCAGTAAATATATTGAACAATCATATTTTGAAGTGAAT
GGACAAACCAATAGGAAGAAGAAAGGCAAAATTAAGTATCCGTTTACTGA
TGCGTTTCGTTTGATTCGTCCAAAGATGAATTTCACTTTCCAGAACATTC
TACATCACATCAATACTGTTTTTGTGGTTGCATCCAAACATCGTTTAGAA
CTAATCCGTGAAGACTCAGATGGAAACATATCAACACCAAGACCTGAGGA
CCTCAAAAAAGGACTCAATCGTGGCCGACACACTGGATCCGCATACTCGG
CCATTCTCTCTGCAGCATCTGTCTGCACACCAAGTTTAGTCACAAGCACA
ACAAGAGCAAGTGAATTGAGACTTAAAGGTCAAATGATCTATCTCCCAAA
AACAGACTGTCTATTATTCCTCTGCTCACCACGTGTTGGAAGTCTGGAAG
AATTAAGAAGGCGTGGTCTCTATTTATCAGATTTCCCTTTACACGACTCC
ACCAGAGAAGTCATTCTAACCAAGAAAGAACACCAACAAGATCGCCAACT
AGTCAAACGAATCGAAGACTCGAATAACGGACTCAAAATCTTGAAAACCA
AACTAGTACATAACAAAAACATTACCGATGAGCTTCTACATGAGTTACTA
CCACCTATAGTTGCTCAACAATTACGTTTAAATTTACCAGTGTTGGCAGA
ATCATATGATATGGTCACCATATTGTTTTCAGATTTGGTTGGTTTTACAG
CACTTTGTTCCAATGAACAGGTTGTACCGATGGATATTATCAAATTGCTG
AATAAGCTGTATACCATGTTTGATGTCATTTCTCACATGCATAATGTTTT
TAAGAAAAGAAGCAGGTGTCAACTTAGCTGGCGGTGAATATATTATCCAT
CGTGTATATTCTGATCAAGAAACAATGAAATTGGTCACTGTAGCTCAGAA
GCTCTCTGTATGGTTTTATTCACTGTTGTTTGCATGATTTGATTCTCAAA
CAATTTGGTGAAGAAACATGGAACGCTATCATATGGTTTTTGAGTAACGA
GGAATGGTCTTTTGAAGAGAACGCCAATCCAAACCCAATGGAATGTTATT
TTATTAAGCCAAAAAAAATCCAACCAGAAAAATTAGCAGAAAAGAAACAA
TTCTTAAAACAACTTGCTAATATGGAAACTCATCTGAAGGAAGGTTCACC
TGCTATGCAGCGGAAAGTGATTCGACCACTCTCCAAAGTGCTTGAAACAA
AAGAAATTTCGGCCACTGTTATTGATAATAACAACAGCTTACCTGCACTC
AATGAGGGTGTAACAACTAAGCTGACCATGAACGGAGGAGGTTGTCCTTT
TAGTCATGGTATGGTTAAGTGAATACGAGTTGGGTTGCACTCAGGTTCAT
GCATGGCTGGTGTGGTGGGTAAAAAGACACCACGCTATTGTTTGTTTGGA
AAACACGTGACACTTGCCAATAAAATGGAATCTGGAAGCAGTCCCGGAAA
AGTCAATGTCAGTATCGAAACTAAAAAGTGGAGACGATCGGTGATGCATA
CATGGGTGTTTGCGGTATCCCACAACCAATCGAACACCATGCCAAACATG
TGGTTGAAATGGCAATGGATATGTTAGAATGTGTACAAAATGTCATCTCA
CCTGTAGACGCCCACCCTGTCAAGGAATACCTTTGAATGACATTCTAGAA
ACATTTGGTAATCATTTCTACAAATACTGTAAACAATCAGGATACGACCG
AGTCTTGAAAATCCTTGGCCGAACTCTCCGGGAATTTCTTTGCAATCTAG
ACGCATTGCATGATCATTTAGCGTCCATTTATCCAGGGATGAACGCACCT
TCCTTTCGTGCCTCCGAAAGACCAGATGGTGGCCTAGATTTACATTATTA
TTCAAATCGTGATGGTCTTGGCTATATCGTGATTGGAATAATGAAAACGG
TGGCCCGAGAGTGCTTGAATACGGAAATTGAGATTTATATTGATAAAGAA
AAAGAGAATAAAGATGACCACGTAGTTTTTGCTGTGTTCGAGAAAACGGC
CACACAATGTCCTTCAATACCGTCTATAACATTCCCACCGGCTTCCAAAT
TCGAGCATCGTTCAAGTTCGATAACAAGTTTTAAAGCATTATTTCGACGG
AAGAAACATTTCATGAGTATCAAATCTTTCACGGAAGCGTTCCCTTTTCA
CGTTGTTTTTGATCGGAATTTGAATATCAAACAATGTGGTTCATCTATCA
GTAAATATATTGAACAATCATATTTTGAAGTGAATGGACAAACCAATAGG
AAGAAGAAAGGCAAAATTAAGTATCCGTTTACTGATGCGTTTCGTTTGAT
TCGTCCAAAGATGAATTTCACTTTCCAGAACATTCTACATCACATCAATA
CTGTTTTTGTGGTTGCATCCAAACATCGTTTAGAACTAATCCGTGAAGAC
TCAGATGGAAACATATCAACACCAAGACCTGAGGACCTCAAAAAAGGACT
CAATCGTGGCCGACACACTGGATCCGCATACTCGGCCATTCTCTCTGCAG
CATCTGTCTGCACACCAAGTTTAGTCACAAGCACAACAAGAGCAAGTGAA
TTGAGACTTAAAGGTCAAATGATCTATCTCCCAAAAACAGACTGTCTATT
ATTCCTCTGCTCACCACGTGTTGGAAGTCTGGAAGAATTAAGAAGGCGTG
GTCTCTATTTATCAGATTTCCCTTTACACGACTCCACCAGAGAAGTCATT
CTAACCAAGAAAGAACACCAACAAGATCGCCAACTAGTCAAACGAATCGA
AGACTCGAATAACGGACTCAAAATCTTGAAAACCAAACTAGTACATAACA
AAAACATTACCGATGAGCTTCTACATGAGTTACTACCACCTATAGTTGCT
CAACAATTACGTTTAAATTTACCAGTGTTGGCAGAATCATATGATATGGT
CACCATATTGTTTTCAGATTTGGTTGGTTTTACAGCACTTTGTTCCAATG
AACAGGTTGTACCGATGGATATTATCAAATTGCTGAATAAGCTGTATACC
ATGTTTGATGTCATTTCTCACATGCATAATGTTTTTAAGAAAAGAAGCAG
GTGTCAACTTAGCTGGCGGTGAATATATTATCCATCGTGTATATTCTGAT
CAAGAAACAATGAAATTGGTCACTGTAGCTCAGAAGCTCTCTGTATGGTT
TTATTCACTGTTGTTTGCATGATTTGATTCTCAAACAATTTGGTGAAGAA
ACATGGAACGCTATCATATGGTTTTTGAGTAACGAGGAATGGTCTTTTGA
AGAGAACGCCAATCCAAACCCAATGGAATGTTATTTTATTAAGCCAAAAA
AAATCCAACCAGAAAAATTAGCAGAAAAGAAACAATTCTTAAAACAACTT
GCTAATATGGAAACTCATCTGAAGGAAGGTTCACCTGCTATGCAGCGGAA
AGTGATTCGACCACTCTCCAAAGTGCTTGAAACAAAAGAAATTTCGGCCA
CTGTTATTGATAATAACAACAGCTTACCTGCACTCAATGAGGGTGTAACA
ACTAAGCTGACCATGAACGGAGGAGGTTGTCCTTTTAGTCATGGTATGGT
TAAGTGAATACGAGTTGGGTTGCACTCAGGTTCATGCATGGCTGGTGTGG
TGGGTAAAAAGACACCACGCTATTGTTTGTTTGGAAAACACGTGACACTT
GCCAATAAAATGGAATCTGGAAGCAGTCCCGGAAAAGTCAATGTCAGTAT
CGAAACTAAAAAGTGGAGACGATCGGTGATGCATACATGGGTGTTTGCGG
TATCCCACAACCAATCGAACACCATGCCAAACATGTGGTTGAAATGGCAA
TGGATATGTTAGAATGTGTACAAAATGTCATCTCACCTGTAGACGCCCAC
CCTGTCAAGGAATACCTTTGAATGACATTCTAGAAACATTTGGTAATCAT
TTCTACAAATACTGTAAACAATCAGGATACGACCGAGTCTTGAAAATCCT
TGGCCGAACTCTCCGGGAATTTCTTTGCAATCTAGACGCATTGCATGATC
ATTTAGCGTCCATTTATCCAGGGATGAACGCACCTTCCTTTCGTGCCTCC
GAAAGACCAGATGGTGGCCTAGATTTACATTATTATTCAAATCGTGATGG
TCTTGGCTATATCGTGATTGGAATAATGAAAACGGTGGCCCGAGAGTGCT
TGAATACGGAAATTGAGATTTATATTGATAAAGAAAAAGAGAATAAAGAT
GACCACGTAGTTTTTGCTGTGTTCGAGAAAACGGCCACACAATGTCCTTC
AATACCGTCTATAACATTCCCACCGGCTTCCAAATTCGAGCATCGTTCAA
GTTCGATAACAAGTTTTAAAGCATTATTTCGACGGAAGAAACATTTCATG
AGTATCAAATCTTTCACGGAAGCGTTCCCTTTTCACGTTGTTTTTGATCG
GAATTTGAATATCAAACAATGTGGTTCATCTATCAGTAAATATATTGAAC
AATCATATTTTGAAGTGAATGGACAAACCAATAGGAAGAAGAAAGGCAAA
ATTAAGTATCCGTTTACTGATGCGTTTCGTTTGATTCGTCCAAAGATGAA
TTTCACTTTCCAGAACATTCTACATCACATCAATACTGTTTTTGTGGTTG
CATCCAAACATCGTTTAGAACTAATCCGTGAAGACTCAGATGGAAACATA
TCAACACCAAGACCTGAGGACCTCAAAAAAGGACTCAATCGTGGCCGACA
CACTGGATCCGCATACTCGGCCATTCTCTCTGCAGCATCTGTCTGCACAC
CAAGTTTAGTCACAAGCACAACAAGAGCAAGTGAATTGAGACTTAAAGGT
CAAATGATCTATCTCCCAAAAACAGACTGTCTATTATTCCTCTGCTCACC
ACGTGTTGGAAGTCTGGAAGAATTAAGAAGGCGTGGTCTCTATTTATCAG
ATTTCCCTTTACACGACTCCACCAGAGAAGTCATTCTAACCAAGAAAGAA
CACCAACAAGATCGCCAACTAGTCAAACGAATCGAAGACTCGAATAACGG
ACTCAAAATCTTGAAAACCAAACTAGTACATAACAAAAACATTACCGATG
AGCTTCTACATGAGTTACTACCACCTATAGTTGCTCAACAATTACGTTTA
AATTTACCAGTGTTGGCAGAATCATATGATATGGTCACCATATTGTTTTC
AGATTTGGTTGGTTTTACAGCACTTTGTTCCAATGAACAGGTTGTACCGA
TGGATATTATCAAATTGCTGAATAAGCTGTATACCATGTTTGATGTCATT
TCTCACATGCATAATGTTTTTAAGAAAAGAAGCAGGTGTCAACTTAGCTG
GCGGTGAATATATTATCCATCGTGTATATTCTGATCAAGAAACAATGAAA
TTGGTCACTGTAGCTCAGAAGCTCTCTGTATGGTTTTATTCACTGTTGTT
TGCATGATTTGATTCTCAAACAATTTGGTGAAGAAACATGGAACGCTATC
ATATGGTTTTTGAGTAACGAGGAATGGTCTTTTGAAGAGAACGCCAATCC
AAACCCAATGGAATGTTATTTTATTAAGCCAAAAAAAATCCAACCAGAAA
AATTAGCAGAAAAGAAACAATTCTTAAAACAACTTGCTAATATGGAAACT
CATCTGAAGGAAGGTTCACCTGCTATGCAGCGGAAAGTGATTCGACCACT
CTCCAAAGTGCTTGAAACAAAAGAAATTTCGGCCACTGTTATTGATAATA
ACAACAGCTTACCTGCACTCAATGAGGGTGTAACAACTAAGCTGACCATG
AACGGAGGAGGTTGTCCTTTTAGTCATGGTATGGTTAAGTGAATACGAGT
TGGGTTGCACTCAGGTTCATGCATGGCTGGTGTGGTGGGTAAAAAGACAC
CACGCTATTGTTTGTTTGGAAAACACGTGACACTTGCCAATAAAATGGAA
TCTGGAAGCAGTCCCGGAAAAGTCAATGTCAGTATCGAAACTAAAAAGTG
GAGACGATCGGTGATGCATACATGGGTGTTTGCGGTATCCCACAACCAAT
CGAACACCATGCCAAACATGTGGTTGAAATGGCAATGGATATGTTAGAAT
GTGTACAAAATGTCATCTCACCTGTAGACGCCCACCCTGTCAAGGAATAC
CTTTGAATGACATTCTAGAAACATTTGGTAATCATTTCTACAAATACTGT
AAACAATCAGGATACGACCGAGTCTTGAAAATCCTTGGCCGAACTCTCCG
GGAATTTCTTTGCAATCTAGACGCATTGCATGATCATTTAGCGTCCATTT
ATCCAGGGATGAACGCACCTTCCTTTCGTGCCTCCGAAAGACCAGATGGT
GGCCTAGATTTACATTATTATTCAAATCGTGATGGTCTTGGCTATATCGT
GATTGGAATAATGAAAACGGTGGCCCGAGAGTGCTTGAATACGGAAATTG
AGATTTATATTGATAAAGAAAAAGAGAATAAAGATGACCACGTAGTTTTT
GCTGTGTTCGAGAAAACGGCCACACAATGTCCTTCAATACCGTCTATAAC
ATTCCCACCGGCTTCCAAATTCGAGCATCGTTCAAGTTCGATAACAAGTT
TTAAAGCATTATTTCGACGGAAGAAACATTTCATGAGTATCAAATCTTTC
ACGGAAGCGTTCCCTTTTCACGTTGTTTTTGATCGGAATTTGAATATCAA
ACAATGTGGTTCATCTATCAGTAAATATATTGAACAATCATATTTTGAAG
TGAATGGACAAACCAATAGGAAGAAGAAAGGCAAAATTAAGTATCCGTTT
ACTGATGCGTTTCGTTTGATTCGTCCAAAGATGAATTTCACTTTCCAGAA
CATTCTACATCACATCAATACTGTTTTTGTGGTTGCATCCAAACATCGTT
TAGAACTAATCCGTGAAGACTCAGATGGAAACATATCAACACCAAGACCT
GAGGACCTCAAAAAAGGACTCAATCGTGGCCGACACACTGGATCCGCATA
CTCGGCCATTCTCTCTGCAGCATCTGTCTGCACACCAAGTTTAGTCACAA
GCACAACAAGAGCAAGTGAATTGAGACTTAAAGGTCAAATGATCTATCTC
CCAAAAACAGACTGTCTATTATTCCTCTGCTCACCACGTGTTGGAAGTCT
GGAAGAATTAAGAAGGCGTGGTCTCTATTTATCAGATTTCCCTTTACACG
ACTCCACCAGAGAAGTCATTCTAACCAAGAAAGAACACCAACAAGATCGC
CAACTAGTCAAACGAATCGAAGACTCGAATAACGGACTCAAAATCTTGAA
AACCAAACTAGTACATAACAAAAACATTACCGATGAGCTTCTACATGAGT
TACTACCACCTATAGTTGCTCAACAATTACGTTTAAATTTACCAGTGTTG
GCAGAATCATATGATATGGTCACCATATTGTTTTCAGATTTGGTTGGTTT
TACAGCACTTTGTTCCAATGAACAGGTTGTACCGATGGATATTATCAAAT
TGCTGAATAAGCTGTATACCATGTTTGATGTCATTTCTCACATGCATAAT
GTTTTTAAGAAAAGAAGCAGGTGTCAACTTAGCTGGCGGTGAATATATTA
TCCATCGTGTATATTCTGATCAAGAAACAATGAAATTGGTCACTGTAGCT
CAGAAGCTCTCTGTATGGTTTTATTCACTGTTGTTTGCATGATTTGATTC
TCAAACAATTTGGTGAAGAAACATGGAACGCTATCATATGGTTTTTGAGT
AACGAGGAATGGTCTTTTGAAGAGAACGCCAATCCAAACCCAATGGAATG
TTATTTTATTAAGCCAAAAAAAATCCAACCAGAAAAATTAGCAGAAAAGA
AACAATTCTTAAAACAACTTGCTAATATGGAAACTCATCTGAAGGAAGGT
TCACCTGCTATGCAGCGGAAAGTGATTCGACCACTCTCCAAAGTGCTTGA
AACAAAAGAAATTTCGGCCACTGTTATTGATAATAACAACAGCTTACCTG
CACTCAATGAGGGTGTAACAACTAAGCTGACCATGAACGGAGGAGGTTGT
CCTTTTAGTCATGGTATGGTTAAGTGAATACGAGTTGGGTTGCACTCAGG
TTCATGCATGGCTGGTGTGGTGGGTAAAAAGACACCACGCTATTGTTTGT
TTGGAAAACACGTGACACTTGCCAATAAAATGGAATCTGGAAGCAGTCCC
GGAAAAGTCAATGTCAGTATCGAAACTAAAAAGTGGAGACGATCGGTGAT
GCATACATGGGTGTTTGCGGTATCCCACAACCAATCGAACACCATGCCAA
ACATGTGGTTGAAATGGCAATGGATATGTTAGAATGTGTACAAAATGTCA
TCTCACCTGTAGACGCCCACCCTGTCAAGGAATACCTTTGAATGACATTC
TAGAAACATTTGGTAATCATTTCTACAAATACTGTAAACAATCAGGATAC
GACCGAGTCTTGAAAATCCTTGGCCGAACTCTCCGGGAATTTCTTTGCAA
TCTAGACGCATTGCATGATCATTTAGCGTCCATTTATCCAGGGATGAACG
CACCTTCCTTTCGTGCCTCCGAAAGACCAGATGGTGGCCTAGATTTACAT
TATTATTCAAATCGTGATGGTCTTGGCTATATCGTGATTGGAATAATGAA
AACGGTGGCCCGAGAGTGCTTGAATACGGAAATTGAGATTTATATTGATA
AAGAAAAAGAGAATAAAGATGACCACGTAGTTTTTGCTGTGTTCGAGAAA
ACGGCCACACAATGTCCTTCAATACCGTCTATAACATTCCCACCGGCTTC
CAAATTCGAGCATCGTTCAAGTTCGATAACAAGTTTTAAAGCATTATTTC
GACGGAAGAAACATTTCATGAGTATCAAATCTTTCACGGAAGCGTTCCCT
TTTCACGTTGTTTTTGATCGGAATTTGAATATCAAACAATGTGGTTCATC
TATCAGTAAATATATTGAACAATCATATTTTGAAGTGAATGGACAAACCA
ATAGGAAGAAGAAAGGCAAAATTAAGTATCCGTTTACTGATGCGTTTCGT
TTGATTCGTCCAAAGATGAATTTCACTTTCCAGAACATTCTACATCACAT
CAATACTGTTTTTGTGGTTGCATCCAAACATCGTTTAGAACTAATCCGTG
AAGACTCAGATGGAAACATATCAACACCAAGACCTGAGGACCTCAAAAAA
GGACTCAATCGTGGCCGACACACTGGATCCGCATACTCGGCCATTCTCTC
TGCAGCATCTGTCTGCACACCAAGTTTAGTCACAAGCACAACAAGAGCAA
GTGAATTGAGACTTAAAGGTCAAATGATCTATCTCCCAAAAACAGACTGT
CTATTATTCCTCTGCTCACCACGTGTTGGAAGTCTGGAAGAATTAAGAAG
GCGTGGTCTCTATTTATCAGATTTCCCTTTACACGACTCCACCAGAGAAG
TCATTCTAACCAAGAAAGAACACCAACAAGATCGCCAACTAGTCAAACGA
ATCGAAGACTCGAATAACGGACTCAAAATCTTGAAAACCAAACTAGTACA
TAACAAAAACATTACCGATGAGCTTCTACATGAGTTACTACCACCTATAG
TTGCTCAACAATTACGTTTAAATTTACCAGTGTTGGCAGAATCATATGAT
ATGGTCACCATATTGTTTTCAGATTTGGTTGGTTTTACAGCACTTTGTTC
CAATGAACAGGTTGTACCGATGGATATTATCAAATTGCTGAATAAGCTGT
ATACCATGTTTGATGTCATTTCTCACATGCATAATGTTTTTAAGAAAAGA
AGCAGGTGTCAACTTAGCTGGCGGTGAATATATTATCCATCGTGTATATT
CTGATCAAGAAACAATGAAATTGGTCACTGTAGCTCAGAAGCTCTCTGTA
TGGTTTTATTCACTGTTGTTTGCATGATTTGATTCTCAAACAATTTGGTG
AAGAAACATGGAACGCTATCATATGGTTTTTGAGTAACGAGGAATGGTCT
TTTGAAGAGAACGCCAATCCAAACCCAATGGAATGTTATTTTATTAAGCC
AAAAAAAATCCAACCAGAAAAATTAGCAGAAAAGAAACAATTCTTAAAAC
AACTTGCTAATATGGAAACTCATCTGAAGGAAGGTTCACCTGCTATGCAG
CGGAAAGTGATTCGACCACTCTCCAAAGTGCTTGAAACAAAAGAAATTTC
GGCCACTGTTATTGATAATAACAACAGCTTACCTGCACTCAATGAGGGTG
TAACAACTAAGCTGACCATGAACGGAGGAGGTTGTCCTTTTAGTCATGGT
ATGGTTAAGTGAATACGAGTTGGGTTGCACTCAGGTTCATGCATGGCTGG
TGTGGTGGGTAAAAAGACACCACGCTATTGTTTGTTTGGAAAACACGTGA
CACTTGCCAATAAAATGGAATCTGGAAGCAGTCCCGGAAAAGTCAATGTC
AGTATCGAAACTAAAAAGTGGAGACGATCGGTGATGCATACATGGGTGTT
TGCGGTATCCCACAACCAATCGAACACCATGCCAAACATGTGGTTGAAAT
GGCAATGGATATGTTAGAATGTGTACAAAATGTCATCTCACCTGTAGACG
CCCACCCTGTCAAGGAATACCTTTGAATGACATTCTAGAAACATTTGGTA
ATCATTTCTACAAATACTGTAAACAATCAGGATACGACCGAGTCTTGAAA
ATCCTTGGCCGAACTCTCCGGGAATTTCTTTGCAATCTAGACGCATTGCA
TGATCATTTAGCGTCCATTTATCCAGGGATGAACGCACCTTCCTTTCGTG
CCTCCGAAAGACCAGATGGTGGCCTAGATTTACATTATTATTCAAATCGT
GATGGTCTTGGCTATATCGTGATTGGAATAATGAAAACGGTGGCCCGAGA
GTGCTTGAATACGGAAATTGAGATTTATATTGATAAAGAAAAAGAGAATA
AAGATGACCACGTAGTTTTTGCTGTGTTCGAGAAAACGGCCACACAATGT
CCTTCAATACCGTCTATAACATTCCCACCGGCTTCCAAATTCGAGCATCG
TTCAAGTTCGATAACAAGTTTTAAAGCATTATTTCGACGGAAGAAACATT
TCATGAGTATCAAATCTTTCACGGAAGCGTTCCCTTTTCACGTTGTTTTT
GATCGGAATTTGAATATCAAACAATGTGGTTCATCTATCAGTAAATATAT
TGAACAATCATATTTTGAAGTGAATGGACAAACCAATAGGAAGAAGAAAG
GCAAAATTAAGTATCCGTTTACTGATGCGTTTCGTTTGATTCGTCCAAAG
ATGAATTTCACTTTCCAGAACATTCTACATCACATCAATACTGTTTTTGT
GGTTGCATCCAAACATCGTTTAGAACTAATCCGTGAAGACTCAGATGGAA
ACATATCAACACCAAGACCTGAGGACCTCAAAAAAGGACTCAATCGTGGC
CGACACACTGGATCCGCATACTCGGCCATTCTCTCTGCAGCATCTGTCTG
CACACCAAGTTTAGTCACAAGCACAACAAGAGCAAGTGAATTGAGACTTA
AAGGTCAAATGATCTATCTCCCAAAAACAGACTGTCTATTATTCCTCTGC
TCACCACGTGTTGGAAGTCTGGAAGAATTAAGAAGGCGTGGTCTCTATTT
ATCAGATTTCCCTTTACACGACTCCACCAGAGAAGTCATTCTAACCAAGA
AAGAACACCAACAAGATCGCCAACTAGTCAAACGAATCGAAGACTCGAAT
AACGGACTCAAAATCTTGAAAACCAAACTAGTACATAACAAAAACATTAC
CGATGAGCTTCTACATGAGTTACTACCACCTATAGTTGCTCAACAATTAC
GTTTAAATTTACCAGTGTTGGCAGAATCATATGATATGGTCACCATATTG
TTTTCAGATTTGGTTGGTTTTACAGCACTTTGTTCCAATGAACAGGTTGT
ACCGATGGATATTATCAAATTGCTGAATAAGCTGTATACCATGTTTGATG
TCATTTCTCACATGCATAATGTTTTTAAGAAAAGAAGCAGGTGTCAACTT
AGCTGGCGGTGAATATATTATCCATCGTGTATATTCTGATCAAGAAACAA
TGAAATTGGTCACTGTAGCTCAGAAGCTCTCTGTATGGTTTTATTCACTG
TTGTTTGCATGATTTGATTCTCAAACAATTTGGTGAAGAAACATGGAACG
CTATCATATGGTTTTTGAGTAACGAGGAATGGTCTTTTGAAGAGAACGCC
AATCCAAACCCAATGGAATGTTATTTTATTAAGCCAAAAAAAATCCAACC
AGAAAAATTAGCAGAAAAGAAACAATTCTTAAAACAACTTGCTAATATGG
AAACTCATCTGAAGGAAGGTTCACCTGCTATGCAGCGGAAAGTGATTCGA
CCACTCTCCAAAGTGCTTGAAACAAAAGAAATTTCGGCCACTGTTATTGA
TAATAACAACAGCTTACCTGCACTCAATGAGGGTGTAACAACTAAGCTGA
CCATGAACGGAGGAGGTTGTCCTTTTAGTCATGGTATGGTTAAGTGAATA
CGAGTTGGGTTGCACTCAGGTTCATGCATGGCTGGTGTGGTGGGTAAAAA
GACACCACGCTATTGTTTGTTTGGAAAACACGTGACACTTGCCAATAAAA
TGGAATCTGGAAGCAGTCCCGGAAAAGTCAATGTCAGTATCGAAACTAAA
AAGTGGAGACGATCGGTGATGCATACATGGGTGTTTGCGGTATCCCACAA
CCAATCGAACACCATGCCAAACATGTGGTTGAAATGGCAATGGATATGTT
AGAATGTGTACAAAATGTCATCTCACCTGTAGACGCCCACCCTGTCAAGG
AATACCTTTGAATGACATTCTAGAAACATTTGGTAATCATTTCTACAAAT
ACTGTAAACAATCAGGATACGACCGAGTCTTGAAAATCCTTGGCCGAACT
CTCCGGGAATTTCTTTGCAATCTAGACGCATTGCATGATCATTTAGCGTC
CATTTATCCAGGGATGAACGCACCTTCCTTTCGTGCCTCCGAAAGACCAG
ATGGTGGCCTAGATTTACATTATTATTCAAATCGTGATGGTCTTGGCTAT
ATCGTGATTGGAATAATGAAAACGGTGGCCCGAGAGTGCTTGAATACGGA
AATTGAGATTTATATTGATAAAGAAAAAGAGAATAAAGATGACCACGTAG
TTTTTGCTGTGTTCGAGAAAACGGCCACACAATGTCCTTCAATACCGTCT
ATAACATTCCCACCGGCTTCCAAATTCGAGCATCGTTCAAGTTCGATAAC
AAGTTTTAAAGCATTATTTCGACGGAAGAAACATTTCATGAGTATCAAAT
CTTTCACGGAAGCGTTCCCTTTTCACGTTGTTTTTGATCGGAATTTGAAT
ATCAAACAATGTGGTTCATCTATCAGTAAATATATTGAACAATCATATTT
TGAAGTGAATGGACAAACCAATAGGAAGAAGAAAGGCAAAATTAAGTATC
CGTTTACTGATGCGTTTCGTTTGATTCGTCCAAAGATGAATTTCACTTTC
CAGAACATTCTACATCACATCAATACTGTTTTTGTGGTTGCATCCAAACA
TCGTTTAGAACTAATCCGTGAAGACTCAGATGGAAACATATCAACACCAA
GACCTGAGGACCTCAAAAAAGGACTCAATCGTGGCCGACACACTGGATCC
GCATACTCGGCCATTCTCTCTGCAGCATCTGTCTGCACACCAAGTTTAGT
CACAAGCACAACAAGAGCAAGTGAATTGAGACTTAAAGGTCAAATGATCT
ATCTCCCAAAAACAGACTGTCTATTATTCCTCTGCTCACCACGTGTTGGA
AGTCTGGAAGAATTAAGAAGGCGTGGTCTCTATTTATCAGATTTCCCTTT
ACACGACTCCACCAGAGAAGTCATTCTAACCAAGAAAGAACACCAACAAG
ATCGCCAACTAGTCAAACGAATCGAAGACTCGAATAACGGACTCAAAATC
TTGAAAACCAAACTAGTACATAACAAAAACATTACCGATGAGCTTCTACA
TGAGTTACTACCACCTATAGTTGCTCAACAATTACGTTTAAATTTACCAG
TGTTGGCAGAATCATATGATATGGTCACCATATTGTTTTCAGATTTGGTT
GGTTTTACAGCACTTTGTTCCAATGAACAGGTTGTACCGATGGATATTAT
CAAATTGCTGAATAAGCTGTATACCATGTTTGATGTCATTTCTCACATGC
ATAATGTTTTTAAGAAAAGAAGCAGGTGTCAACTTAGCTGGCGGTGAATA
TATTATCCATCGTGTATATTCTGATCAAGAAACAATGAAATTGGTCACTG
TAGCTCAGAAGCTCTCTGTATGGTTTTATTCACTGTTGTTTGCATGATTT
GATTCTCAAACAATTTGGTGAAGAAACATGGAACGCTATCATATG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_001000XLOC_001000Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001934-proteinTCONS_00001934-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001934-exon-sc0000012-1575043694:429824..429980TCONS_00001934-exon-sc0000012-1575043694:429824..429980Clytia hemisphaericaexon
TCONS_00001934-exon-sc0000012-1575043694:403591..403664TCONS_00001934-exon-sc0000012-1575043694:403591..403664Clytia hemisphaericaexon
TCONS_00001934-exon-sc0000012-1575043694:402499..402572TCONS_00001934-exon-sc0000012-1575043694:402499..402572Clytia hemisphaericaexon
TCONS_00001934-exon-sc0000012-1575043694:401739..401842TCONS_00001934-exon-sc0000012-1575043694:401739..401842Clytia hemisphaericaexon
TCONS_00001934-exon-sc0000012-1575043694:400041..401455TCONS_00001934-exon-sc0000012-1575043694:400041..401455Clytia hemisphaericaexon
TCONS_00001934-exon-sc0000012-1575043694:398908..399054TCONS_00001934-exon-sc0000012-1575043694:398908..399054Clytia hemisphaericaexon
TCONS_00001934-exon-sc0000012-1575043694:398381..398535TCONS_00001934-exon-sc0000012-1575043694:398381..398535Clytia hemisphaericaexon
TCONS_00001934-exon-sc0000012-1575043694:397481..398013TCONS_00001934-exon-sc0000012-1575043694:397481..398013Clytia hemisphaericaexon
TCONS_00001934-exon-sc0000012-1510915933:429824..429980TCONS_00001934-exon-sc0000012-1510915933:429824..429980Clytia hemisphaericaexon
TCONS_00001934-exon-sc0000012-1510915933:403591..403664TCONS_00001934-exon-sc0000012-1510915933:403591..403664Clytia hemisphaericaexon
TCONS_00001934-exon-sc0000012-1510915933:402499..402572TCONS_00001934-exon-sc0000012-1510915933:402499..402572Clytia hemisphaericaexon
TCONS_00001934-exon-sc0000012-1510915933:401739..401842TCONS_00001934-exon-sc0000012-1510915933:401739..401842Clytia hemisphaericaexon
TCONS_00001934-exon-sc0000012-1510915933:400041..401455TCONS_00001934-exon-sc0000012-1510915933:400041..401455Clytia hemisphaericaexon
TCONS_00001934-exon-sc0000012-1510915933:398908..399054TCONS_00001934-exon-sc0000012-1510915933:398908..399054Clytia hemisphaericaexon
TCONS_00001934-exon-sc0000012-1510915933:398381..398535TCONS_00001934-exon-sc0000012-1510915933:398381..398535Clytia hemisphaericaexon
TCONS_00001934-exon-sc0000012-1510915933:397481..398013TCONS_00001934-exon-sc0000012-1510915933:397481..398013Clytia hemisphaericaexon
TCONS_00001934-exon-sc0000012-1491911889:429824..429980TCONS_00001934-exon-sc0000012-1491911889:429824..429980Clytia hemisphaericaexon
TCONS_00001934-exon-sc0000012-1491911889:403591..403664TCONS_00001934-exon-sc0000012-1491911889:403591..403664Clytia hemisphaericaexon
TCONS_00001934-exon-sc0000012-1491911889:402499..402572TCONS_00001934-exon-sc0000012-1491911889:402499..402572Clytia hemisphaericaexon
TCONS_00001934-exon-sc0000012-1491911889:401739..401842TCONS_00001934-exon-sc0000012-1491911889:401739..401842Clytia hemisphaericaexon
TCONS_00001934-exon-sc0000012-1491911889:400041..401455TCONS_00001934-exon-sc0000012-1491911889:400041..401455Clytia hemisphaericaexon
TCONS_00001934-exon-sc0000012-1491911889:398908..399054TCONS_00001934-exon-sc0000012-1491911889:398908..399054Clytia hemisphaericaexon
TCONS_00001934-exon-sc0000012-1491911889:398381..398535TCONS_00001934-exon-sc0000012-1491911889:398381..398535Clytia hemisphaericaexon
TCONS_00001934-exon-sc0000012-1491911889:397481..398013TCONS_00001934-exon-sc0000012-1491911889:397481..398013Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000012supercontigsc0000012:397481..429980 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0 0 0 0 0.312449 0.169745 2.97876 3.60785 1.53753 2.46373 0.748216 1.09942 10.5167 8.36129 1.01138 1.35009 10.0553 11.5989 22.659 26.7393 14.4908 14.8328 5.5621 7.80402 6.68534 9.81004 1.44948 0.211908 0.0642898 0
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR001054A/G_cyclase
IPR011644Heme_NO-bd
IPR011645HNOB_dom_associated
IPR029787Nucleotide_cyclase
IPR024096NO_sig/Golgi_transp_ligand-bd
Vocabulary: Biological Process
TermDefinition
GO:0009190cyclic nucleotide biosynthetic process
GO:0035556intracellular signal transduction
GO:0006182cGMP biosynthetic process
Vocabulary: Molecular Function
TermDefinition
GO:0016849phosphorus-oxygen lyase activity
GO:0020037heme binding
GO:0004383guanylate cyclase activity
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006182 cGMP biosynthetic process
biological_process GO:0009190 cyclic nucleotide biosynthetic process
biological_process GO:0035556 intracellular signal transduction
molecular_function GO:0004383 guanylate cyclase activity
molecular_function GO:0020037 heme binding
molecular_function GO:0016849 phosphorus-oxygen lyase activity
Blast
BLAST of TCONS_00001934 vs. Swiss-Prot (Human)
Match: GCYB1 (Guanylate cyclase soluble subunit beta-1 OS=Homo sapiens GN=GUCY1B3 PE=1 SV=1)

HSP 1 Score: 458.759 bits (1179), Expect = 1.515e-149
Identity = 261/682 (38.27%), Postives = 387/682 (56.74%), Query Frame = 1
Query:  229 MYGFIHCCLHDLILKQFGEETWNAIIKEAGVNLAGGEYIIHRVYSDQETMKLVTVAQKLSGIPLNDILETFGNHFYKYCKQSGYDRVLKILGRTLREFLCNLDALHDHLASIYPGMNAPSFRASERPDG-GLDLHYYSNRDGLGYIVIGIMKTVARECLNTEIEIYIDKEKENKDDHVVFAVFEKTATQCPSIPSITFPPASKFEHRSSSITSFKALFRRKKHFMSIKSFTEAFPFHVVFDRNLNIKQCGSSISKYIEQSYFEVNGQTNRKKKGKIKYPFTDAFRLIRPKMNFTFQNILHHINTVFVVASKHRLELIREDSDGNISTPRPEDLKKGLNRGRHTGSAYSAILSAASVCTPSLVTSTTRASELRLKGQMIYLPKTDCLLFLCSPRVGSLEELRRRGLYLSDFPLHDSTREVILTKKEHQQDRQLVKRIEDSNNGLKILKTKLVHNKNITDELLHELLPPIVAQQLRLNLPVLAESYDMVTILFSDLVGFTALCSNEQV--VPMDIIKLLNKLYTMFDVISHMHN---VFKVETIGDAYMGVCGIPQPIEHHAKHVVEMAMDMLECVQNVISPVDAHPVKIRVGLHSGSCMAGVVGKKTPRYCLFGKHVTLANKMESGSSPGKVNVSIETKKFL-----SNEEWSFEE------NANPNPMECYFIKPKKIQPEK 2223
            MYGF++  L  L+++ +G E W  I KEA ++   G++++  +Y D +T  LV  A K+  +   +IL+ FG  F+ +C++SGYD +L++LG  +REFL NLDALHDHLA+IYPGM APSFR ++   G GL LHYYS R+GL  IVIGI+KTVA++   TEI++ + +++  + DH  F + EK + +        +    +FE   +           ++  +S  +F +AFPFH++FDR+L + QCG++I + + Q            + G         F L+RP ++ +F  IL HINTVFV+ SK          +G +   + E                         C   L  + T  S LRLKGQMIYLP+ D +LFLCSP V +L++L RRGLYLSD PLHD+TR+++L  ++ +++ +L + +E   + L++    L   K  TD LL+ +LPP VA +LR   PV A+ YD VTILFS +VGF A CS        M I+ LLN LYT FD ++       V+KVET+GD YM V G+P+P  HHA+ +  +A+DM+E    V   VD   V+I +G+H+G  + GV+G++ PRYCLFG  V L ++ E+    GK+NVS  T + L     S+ ++  E            PM+ +F+  K    E+
Sbjct:    1 MYGFVNHALELLVIRNYGPEVWEDIKKEAQLD-EEGQFLVRIIYDDSKTYDLVAAASKVLNLNAGEILQMFGKMFFVFCQESGYDTILRVLGSNVREFLQNLDALHDHLATIYPGMRAPSFRCTDAEKGKGLILHYYSEREGLQDIVIGIIKTVAQQIHGTEIDMKVIQQRNEECDHTQFLIEEKESKE-----EDFYEDLDRFEENGT-----------QESRISPYTFCKAFPFHIIFDRDLVVTQCGNAIYRVLPQL-----------QPGNCS--LLSVFSLVRPHIDISFHGILSHINTVFVLRSK----------EGLLDVEKLE-------------------------CEDEL--TGTEISCLRLKGQMIYLPEADSILFLCSPSVMNLDDLTRRGLYLSDIPLHDATRDLVLLGEQFREEYKLTQELEILTDRLQLTLRALEDEKKKTDTLLYSVLPPSVANELRHKRPVPAKRYDNVTILFSGIVGFNAFCSKHASGEGAMKIVNLLNDLYTRFDTLTDSRKNPFVYKVETVGDKYMTVSGLPEPCIHHARSICHLALDMMEIAGQV--QVDGESVQITIGIHTGEVVTGVIGQRMPRYCLFGNTVNLTSRTETTGEKGKINVSEYTYRCLMSPENSDPQFHLEHRGPVSMKGKKEPMQVWFLSRKNTGTEE 613          
The following BLAST results are available for this feature:
BLAST of TCONS_00001934 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
GCYB11.515e-14938.27Guanylate cyclase soluble subunit beta-1 OS=Homo s... [more]
back to top