Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001925 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001925
Unique NameTCONS_00001925
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length2491

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001925 ID=TCONS_00001925|Name=TCONS_00001925|organism=Clytia hemisphaerica|type=transcript|length=2491bp
aaaacattgctgTAGTCTTTAAACAACTTTGCCAACCTATAATGAAGCTC
AGATCGGCATTGCCGATCTAAAAACAAGTCTAGGTTGGCAGAATTTTCAC
GATTTGCTTCTACTTGAAATTCAAGGGCTgagttttagcctcaaaacaAT
TGACACAAGTTAACTAATGATGAGGCAGTGCAGAGAGGTGGTTCTCTTgt
aaattagactttaactctaatgTAGGTACTGAAAGAAAATGCAAGGTTTG
AACACAAATATCCAGGCATTCAAAGACAGCCcattattttcaacattttt
accCAAGTCTACCAAAGATCAGAGTCAAAATTATGGTCAAGATAAGAAGA
CAGAACATTATAATGCATCATCTTGTTTGCCACTCGATGCTTCAtttgaa
tttgatcaatttttcaatacCCACGTGTTCACTTCTGGACTGACGGACAA
TGGTAAAACTTTGGCCATCTTTGAACAAGATGATAAAGGAAATTTAAACA
TGCATAAATATTGCTATCATAAAGGCCAGATTGNTTAACATTTCTGAAGG
TTTTTTGGATTAGTTTTCAGCCCTCGAATTTCAGGTCAGCATTATGCAGT
GCAGACCTAAAAGCCAACCAAAGAATGTGTATGATTGGCAGTTCATTGCC
GACCATAATCATCAATTCTTTTGGCAGCAGACCATAAgtgataattgaaa
aaaaaacattgctgTAGTCTTTAAACAACTTTGCCAACCTATAATGAAGC
TCAGATCGGCATTGCCGATCTAAAAACAAGTCTAGGTTGGCAGAATTTTC
ACGATTTGCTTCTACTTGAAATTCAAGGGCTgagttttagcctcaaaaca
ATTGACACAAGTTAACTAATGATGAGGCAGTGCAGAGAGGTGGTTCTCTT
gtaaattagactttaactctaatgTAGGTACTGAAAGAAAATGCAAGGTT
TGAACACAAATATCCAGGCATTCAAAGACAGCCcattattttcaacattt
ttaccCAAGTCTACCAAAGATCAGAGTCAAAATTATGGTCAAGATAAGAA
GACAGAACATTATAATGCATCATCTTGTTTGCCACTCGATGCTTCAtttg
aatttgatcaatttttcaatacCCACGTGTTCACTTCTGGACTGATGGAC
AATGGTAAAACTTTGGCCATCTTTGAACAAGATGATAAAGGAAATTTAAA
CATGCATAAATATTGCTATCATAAAGGCCAGATTCAAAGTCTTCATTCCA
GACACTTTAACACATGGTTGATTCGAGATTATGATTATCTTGTCAGTTAT
GATGGCTTATTTGTTGTAATGTTTAATTCTGAAGAACTTGCACATGAAAG
AGACCATCGAAGGAGACGAAAACGTGGCTATGGCCTGGGAGAGAAAGTTT
ACATTTCTTTGCTAGTTTATGACCATGATTTTGAAAATGGTCGAAGTGCA
ATGGGGAAATTTTTCCCGAATTCCTTTGTACTTACCATGTCTGACAAGGA
TGATTCATTGTTTTGGAAATATAAACATGGATATGCTATTGGGGTTGATG
GCACCATAATTGTCTCCTCATGGGGCGTGACTAGAGACACTTTAGATGAA
CAAGATACGGGTGGGACTGCTTTATATTTGAATTATTTCAAAGTTCAACA
AACAAGCTCTAAAATTGCTGTCAAACATTGTGGTTTTACAGATTTGAGTG
GTGCGTTGACTGGCAAACCGTTACCAACAGCTTTCAACGATCCTGAACAT
TACTAAAGTCTTCTTTTTGAGTCATAATATGGTTTACAACGTGATGACGC
ACTCAATGAGTACATTATCCGAACAAGCTTTCCAACATAATGTATGGGTT
ATTCATAGACGGTACGGTGAAATACTGATAACCATAGACAGGCCAACTTT
CTCGCTACTCAATGTCAAAATATTCAAAGAGAACGACAAAGGCGAGTATG
ATCtagtaaacaaattcaaaacaagTCGAATTATAAGAccaaatgataat
tttatggaagAGCCTACAATGCATTGTCATGGTATAAACAATGGAGAGAC
TCGACTATTTGTAGAACCAACTCAATCATCACGCACGATCTTTGCTGTCA
ATCCGTTCACTTTAAACATTGATTTCATTTTGGGCATTCCTGCAAAGCTT
GAGGAACCATTTGTGCGTAAAGTCCTTCAGAGTGGTGATGAAATTACAGT
CCTTGTTACCAGTAATTCTGCTGAGTATCTGGTCTCTTATAACATTAACA
AATGCACTGAACTGAAAAGTCTCAAGGAGCTTTCAGCTTTGGTGGTACTT
AGAAACTTTTCAATGGATGACATATTGCAGTATAATATtccaaaattatt
gaaaacCTATTTAGAGAATAATATTTTTTACCTCTgattatgaaatgttt
tatTAACGTTTGTTTGTCTGTTTCATTCTACTGTTCTGTGtgttttaatg
tttatttttcatgttgttttttatttttccattatCTGTGC
Run BLAST on NCBI

protein sequence of TCONS_00001925-protein

>TCONS_00001925-protein ID=TCONS_00001925-protein|Name=TCONS_00001925-protein|organism=Clytia hemisphaerica|type=polypeptide|length=271bp
MQGLNTNIQAFKDSPLFSTFLPKSTKDQSQNYGQDKKTEHYNASSCLPLD
ASFEFDQFFNTHVFTSGLMDNGKTLAIFEQDDKGNLNMHKYCYHKGQIQS
LHSRHFNTWLIRDYDYLVSYDGLFVVMFNSEELAHERDHRRRRKRGYGLG
EKVYISLLVYDHDFENGRSAMGKFFPNSFVLTMSDKDDSLFWKYKHGYAI
GVDGTIIVSSWGVTRDTLDEQDTGGTALYLNYFKVQQTSSKIAVKHCGFT
DLSGALTGKPLPTAFNDPEHY
Run BLAST on NCBI

transcript from alignment at sc0000012:204713..207625-

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001925 ID=TCONS_00001925|Name=TCONS_00001925|organism=Clytia hemisphaerica|type=transcript|length=2913bp|location=Sequence derived from alignment at sc0000012:204713..207625- (Clytia hemisphaerica)
AAAACATTGCTGTAGTCTTTAAACAACTTTGCCAACCTATAATGAAGCTC AGATCGGCATTGCCGATCTAAAAACAAGTCTAGGTTGGCAGAATTTTCAC GATTTGCTTCTACTTGAAATTCAAGGGCTGAGTTTTAGCCTCAAAACAAT TGACACAAGTTAACTAATGATGAGGCAGTGCAGAGAGGTGGTTCTCTTGT AAATTAGACTTTAACTCTAATGTAGGTACTGAAAGAAAATGCAAGGTTTG AACACAAATATCCAGGCATTCAAAGACAGCCCATTATTTTCAACATTTTT ACCCAAGTCTACCAAAGATCAGAGTCAAAATTATGGTCAAGATAAGAAGA CAGAACATTATAATGCATCATCTTGTTTGCCACTCGATGCTTCATTTGAA TTTGATCAATTTTTCAATACCCACGTGTTCACTTCTGGACTGACGGACAA TGGTAAAACTTTGGCCATCTTTGAACAAGATGATAAAGGAAATTTAAACA TGCATAAATATTGCTATCATAAAGGCCAGATTGNTTAACATTTCTGAAGG TTTTTTGGATTAGTTTTCAGCCCTCGAATTTCAGGTCAGCATTATGCAGT GCAGACCTAAAAGCCAACCAAAGAATGTGTATGATTGGCAGTTCATTGCC GACCATAATCATCAATTCTTTTGGCAGCAGACCATAAGTGATAATTGAAA AAAAAACATTGCTGTAGTCTTTAAACAACTTTGCCAACCTATAATGAAGC TCAGATCGGCATTGCCGATCTAAAAACAAGTCTAGGTTGGCAGAATTTTC ACGATTTGCTTCTACTTGAAATTCAAGGGCTGAGTTTTAGCCTCAAAACA ATTGACACAAGTTAACTAATGATGAGGCAGTGCAGAGAGGTGGTTCTCTT GTAAATTAGACTTTAACTCTAATGTAGGTACTGAAAGAAAATGCAAGGTT TGAACACAAATATCCAGGCATTCAAAGACAGCCCATTATTTTCAACATTT TTACCCAAGTCTACCAAAGATCAGAGTCAAAATTATGGTCAAGATAAGAA GACAGAACATTATAATGCATCATCTTGTTTGCCACTCGATGCTTCATTTG AATTTGATCAATTTTTCAATACCCACGTGTTCACTTCTGGACTGATGGAC AATGGTAAAACTTTGGCCATCTTTGAACAAGATGATAAAGGAAATTTAAA CATGCATAAATATTGCTATCATAAAGGCCAGATTCAAAGTCTTCATTCCA GACACTTTAACACATGGTTGATTCGAGATTATGATTATCTTGTCAGTTAT GATGGCTTATTTGTTGTAATGTTTAATTCTGAAGAACTTGCACATGAAAG AGACCATCGAAGGAGACGAAAACGTGGCTATGGCCTGGGAGAGAAAGTTT ACATTTCTTTGCTAGTTTATGACCATGATTTTGAAAATGGTCGAAGTGCA ATGGGGAAATTTTTCCCGAATTCCTTTGTACTTACCATGTCTGACAAGGA TGATTCATTGTTTTGGAAATATAAACATGGATATGCTATTGGGGTTGATG GCACCATAATTGTCTCCTCATGGGGCGTGACTAGAGACACTTTAGATGAA CAAGATACGGGTGGGACTGCTTTATATTTGAATTATTTCAAAGTTCAACA AACAAGCTCTAAAATTGCTGTCAAACATTGTGGTTTTACAGATTTGAGTG GTGCGTTGACTGGCAAACCGTTACCAACAGCTTTCAACGATCCTGAACAN GAAAGAGACCATCGAAGGAGACGAAAACGTGGCTATGGCCTGGGAGAGAA AGTTTACATTTCTTTGCTAGTTTATGACCATGATTTTGAAAATGGTCGAA GTGCAATGGGGAAATTTTTCCCTAATTCCTTTGTACTTACCATGTCTGAC AAGGATGATTCATTGTTTTGGAAATATAAACATGGATATGCTATTGGCGT TGATGGCACCATAATTGTCTCCTCGTGGGGCGTGACTAGAGACACTTTAG ATGAACAAGATACGGGTGGGACTGCTTTATATTTGAATTATTTCAAAGTT CAACAAACAAGCTCTAAAATTGCTGTCAAACATTGTGGTTGTACAGATTT GAGTGGTGCGTTGACTGGCAAACCGTTACCAACAGCTTTCAACGATCCTG CTATTGTATGCAACCAAAACATTACTAAAGTCTTCTTTTTGAGTCATAAT ATGGTTTACAACGTGATGACGCACTCAATGAGTACATTATCCGAACAAGC TTTCCAACATAATGTATGGGTTATTCATAGACGGTACGGTGAAATACTGA TAACCATAGACAGGCCAACTTTCTCGCTACTCAATGTCAAAATATTCAAA GAGAACGACAAAGGCGAGTATGATCTAGTAAACAAATTCAAAACAAGTCG AATTATAAGACCAAATGATAATTTTATGGAAGAGCCTACAATGCATTGTC ATGGTATAAACAATGGAGAGACTCGACTATTTGTAGAACCAACTCAATCA TCACGCACGATCTTTGCTGTCAATCCGTTCACTTTAAACATTGATTTCAT TTTGGGCATTCCTGCAAAGCTTGAGGAACCATTTGTGCGTAAAGTCCTTC AGAGTGGTGATGAAATTACAGTCCTTGTTACCAGTAATTCTGCTGAGTAT CTGGTCTCTTATAACATTAACAAATGCACTGAACTGAAAAGTCTCAAGGA GCTTTCAGCTTTGGTGGTACTTAGAAACTTTTCAATGGATGACATATTGC AGTATAATATTCCAAAATTATTGAAAACCTATTTAGAGAATAATATTTTT TACCTCTGATTATGAAATGTTTTATTAACGTTTGTTTGTCTGTTTCATTC TACTGTTCTGTGTGTTTTAATGTTTATTTTTCATGTTGTTTTTTATTTTT CCATTATCTGTGC

Coding sequence (CDS) from alignment at sc0000012:204713..207625-

>TCONS_00001925 ID=TCONS_00001925|Name=TCONS_00001925|organism=Clytia hemisphaerica|type=CDS|length=1632bp|location=Sequence derived from alignment at sc0000012:204713..207625- (Clytia hemisphaerica)
ATTACTAAATGCAAGGTTTGAACACAAATATCCAGGCATTCAAAGACAGC
CCATTATTTTCAACATTTTTACCCAAGTCTACCAAAGATCAGAGTCAAAA
TTATGGTCAAGATAAGAAGACAGAACATTATAATGCATCATCTTGTTTGC
CACTCGATGCTTCATTTGAATTTGATCAATTTTTCAATACCCACGTGTTC
ACTTCTGGACTGATGGACAATGGTAAAACTTTGGCCATCTTTGAACAAGA
TGATAAAGGAAATTTAAACATGCATAAATATTGCTATCATAAAGGCCAGA
TTCAAAGTCTTCATTCCAGACACTTTAACACATGGTTGATTCGAGATTAT
GATTATCTTGTCAGTTATGATGGCTTATTTGTTGTAATGTTTAATTCTGA
AGAACTTGCACATGAAAGAGACCATCGAAGGAGACGAAAACGTGGCTATG
GCCTGGGAGAGAAAGTTTACATTTCTTTGCTAGTTTATGACCATGATTTT
GAAAATGGTCGAAGTGCAATGGGGAAATTTTTCCCGAATTCCTTTGTACT
TACCATGTCTGACAAGGATGATTCATTGTTTTGGAAATATAAACATGGAT
ATGCTATTGGGGTTGATGGCACCATAATTGTCTCCTCATGGGGCGTGACT
AGAGACACTTTAGATGAACAAGATACGGGTGGGACTGCTTTATATTTGAA
TTATTTCAAAGTTCAACAAACAAGCTCTAAAATTGCTGTCAAACATTGTG
GTTTTACAGATTTGAGTGGTGCGTTGACTGGCAAACCGTTACCAACAGCT
TTCAACGATCCTGAACATTACTAAATGCAAGGTTTGAACACAAATATCCA
GGCATTCAAAGACAGCCCATTATTTTCAACATTTTTACCCAAGTCTACCA
AAGATCAGAGTCAAAATTATGGTCAAGATAAGAAGACAGAACATTATAAT
GCATCATCTTGTTTGCCACTCGATGCTTCATTTGAATTTGATCAATTTTT
CAATACCCACGTGTTCACTTCTGGACTGATGGACAATGGTAAAACTTTGG
CCATCTTTGAACAAGATGATAAAGGAAATTTAAACATGCATAAATATTGC
TATCATAAAGGCCAGATTCAAAGTCTTCATTCCAGACACTTTAACACATG
GTTGATTCGAGATTATGATTATCTTGTCAGTTATGATGGCTTATTTGTTG
TAATGTTTAATTCTGAAGAACTTGCACATGAAAGAGACCATCGAAGGAGA
CGAAAACGTGGCTATGGCCTGGGAGAGAAAGTTTACATTTCTTTGCTAGT
TTATGACCATGATTTTGAAAATGGTCGAAGTGCAATGGGGAAATTTTTCC
CGAATTCCTTTGTACTTACCATGTCTGACAAGGATGATTCATTGTTTTGG
AAATATAAACATGGATATGCTATTGGGGTTGATGGCACCATAATTGTCTC
CTCATGGGGCGTGACTAGAGACACTTTAGATGAACAAGATACGGGTGGGA
CTGCTTTATATTTGAATTATTTCAAAGTTCAACAAACAAGCTCTAAAATT
GCTGTCAAACATTGTGGTTTTACAGATTTGAGTGGTGCGTTGACTGGCAA
ACCGTTACCAACAGCTTTCAACGATCCTGAAC
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000993XLOC_000993Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001925-proteinTCONS_00001925-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001925-exon-sc0000012-1575043694:205878..207625TCONS_00001925-exon-sc0000012-1575043694:205878..207625Clytia hemisphaericaexon
TCONS_00001925-exon-sc0000012-1575043694:204713..205455TCONS_00001925-exon-sc0000012-1575043694:204713..205455Clytia hemisphaericaexon
TCONS_00001925-exon-sc0000012-1510915933:205878..207625TCONS_00001925-exon-sc0000012-1510915933:205878..207625Clytia hemisphaericaexon
TCONS_00001925-exon-sc0000012-1510915933:204713..205455TCONS_00001925-exon-sc0000012-1510915933:204713..205455Clytia hemisphaericaexon
TCONS_00001925-exon-sc0000012-1491911889:205878..207625TCONS_00001925-exon-sc0000012-1491911889:205878..207625Clytia hemisphaericaexon
TCONS_00001925-exon-sc0000012-1491911889:204713..205455TCONS_00001925-exon-sc0000012-1491911889:204713..205455Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000012supercontigsc0000012:204713..207625 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
9.31912 7.08154 5.31667 3.93548 1.48171 1.7943 1.52579 2.69143 2.63112 2.07239 2.20171 1.16593 2.28333 0.868844 0.737041 1.87751 0.910882 1.21655e-08 1.19502 0.206265 1.03963 0.295665 6.62654 4.58361 2.39649 3.43527 0.964329 0.778899 4.85678 2.59895
Blast
The following BLAST results are available for this feature:
BLAST of TCONS_00001925 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 0
Match NameE-valueIdentityDescription
back to top