Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001912 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001912
Unique NameTCONS_00001912
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length3740

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001912 ID=TCONS_00001912|Name=TCONS_00001912|organism=Clytia hemisphaerica|type=transcript|length=3740bp
CAATTATCACCGATTTAATTTTCGCGCCAATTAAATCGGGGaagtggttt
gttttgatttggtttcTAATGCCATCGCTATTTTGCAGAATGATTATTTT
ATCAGTAGGAGCCAGCCAAGCCTCTTGGTAAATATCGGTCCGCAAAATAT
ACATAACAGCACGTGCTAATTTTTTTCTCCGACCTCAAAAGCATGTTGTA
AAATTTGGTACTGTCACCTGATCTGATGACTTGACTTGGTCACATATCAG
CTGATAAGTACATTTCACCTATCATCCTCAAAACTGACTTGCTCAGAAGG
AAAACCGAAATGGCGACACTTATTCTTGATGATGGCACCAAATATCATGG
TCAAATTTTTGGTGATGAAAGAAGTATTGCAGGAGAAGTTGTCTTCCAAA
CTGGTATGGTTGGTTACCCAGAATCATTGACAGATCCTTCATACAACAGT
CAAATCTTGGTATTGACGTATCCACTGATTGGTAATTATGGTATACCAAA
CGATTCTCGTGATGAACATGGCAtgctcaaattttttgaatctgAAAAGA
TTTGGAACAATGGTATGATTGTAGGAGACTTGACTGAGGACTACAGCCAT
TGGTTGGCAACCAAATCACTTTCAGAGTGGCTGAAGGAACACAAAATACC
TGGAATTACTGGTATTGATACCAGAGCATTAACAAAGAAGTTGAGAGAAA
ATGGAACAATGTTAGGAAAGATTGTTTTGGATGGAGAGGATGAAGCAAGT
GTTCCATTTGATGATCCAAACAAAAGGAATTTGATTGCTGAAGTCTCTTG
CAAGGAACCTAAACTTTACAATCCTAAGGGTAAAATAAAGATGATTGCTG
TAGACTTTGGTATCAAATACAACCAGATCCGGTGTTTGATTGATTGTGAT
TGTCAGGTTCTAGTTGTTCCATGGGATTATGACTATAGTACATTGTTAAA
GAACAAAGAATATGATGGTCTGTTTATGAGCAATGGTCCTGGAGATCCTA
GCCTTTGTCAAGTTTCAATTGACACCCTCCGTAAAGTCATTACAGAATTG
CCAGATGTGCCAGTCTTTGGTATTTGCATGGGTCATCAGATCTTATCTCT
TGCTGCTGGATGTGGGTCCTACAAAATGAAATATGGTAACAGAGGACATA
ACCAACCTGCAACCCATTTGGAAACTCAACGTTGCTTCATCACTTGCCAA
AATCATGGCTTTGCAATTGACACAGACAGCTTACCAAAAGAATGgtctgt
tttgtttacaaatgaGAATGATGGCAGTAATGAAGGCATTGTTCACAACA
CAAAGCCAATCTTCTCAGTTCAGTTTCATCCTGAACATCAAGGAGGACCA
AGAGATTTGGAGCTTTTGTTTGGCTTTTTTGTGGATATTGTAAACAAACT
GAAAATCGATTCTAACCTCTGCTTACGAACCATGCTGAAAGAAACGTTGA
CTTTCCACCCAGCAGAAGAAACAAGATCCAGAGCATTCAAACCAAAGAAG
GTCTTGATTTTGGGATCTGGTGGCTTATCTATTGGTCAAGCCGGAGAATT
TGATTATTCTGGCTCTCAAGCTATCAAAGCATTAAAAGAAGAGAAGATTC
ACACAGTTTTGATCAATCCTAATATTGCTACAGTGCAAACTTCCAAAGGA
CTTGCAGATAAAACTTACTTCCTTCCTGTTAACTTTGAATTCACAAGCAA
GGTGATTGAAGTAGAAAGACCAGATGGCATTCTGTTATCATTTGGTGGAC
AAACAGCATTGAACTGTGGACTGCTATTGAAAGAGAGGGGAATTTTAGAG
AAATACAATGTTGCTGTTCTTGGTACACCTACCAAATCGATTGAATGGAC
AGAAGATAGGAAAATGTTTTCAGACAAGATGGGAGAGATTGGTGAGAAAG
TTGCACCAAGCTCAGTGGCTTATACTGTGGATGAGGCTATCACAGCAGCT
AACAGGCTAGGATATCCAGTGTTGTTACGTGCAGCATTTGCACTAGGTGG
ACTTGGATCTGGTTTTGCTTCCAATGACAATGAGCTCAAAAAGCTTGCAG
CATCGGCTTTTGCACATTCCAAACAGTGTCTAGTTGACAAGTCACTGAAA
GGATGGAAAGAAGTTGAATATGAAGTTGTTAGAGATGCTTATGACAACTG
TATCACTGTTTGTAATATGGAAAACTTTGACCCTTTGGGAATCCATACGG
GTGAATCAATTGTTGTTGCACCAAGTCAAACACTAACAAATGAGGAATAC
AATATGCTTAGAAGAACAGCCATCAAAGTCATCCGTAAACTTGGTGTTGT
TGGTGAATGTAACATCCAGTATGCTTTACACCCTGACTCAAAAGAGTTCT
ACATCATTGAGGTCAATGCTCGTCTCTCCAGAAGTTCAGCTCTTGCTTCC
AAAGCAACTGGATACCCATTGGCTTACGTTGCTGCTAAACTTGCACTTGG
TATTCCTCTACCAAAACTGAGAAATTCTGTCACCAATTCAACTACCGCTT
GTTTTGAGCCCTCTTTGGATTATTGTGTTGTGAAAGTTCCTCGATGGGAT
CTGGACAAATTTCAGAGGGTTTCAACAAAGATTGGATCTTCGATGAAGAG
TGTTGGTGAAGTAATGGCTATTGGAAGAAGTTTTGAGGAAGCCATTCAAA
AGAGTTTGAGAATGGTTGACGATTCAAACCTTGGTTTTGATGCAAACAAC
CTCGAGTTGGATGAACAGGTCTTAGTTGAGCCCTCTGACAAAAGAATCTT
TCATGTTGCTGCTGCACTCCGTAGAGGATATTCTATTGATCAGCTGTATG
AGCTCACTCGTATTGATAAGTGGTTTTTGAGCAAGCTAGCAAAAATAATC
AACTATGCAAAAATGCTGGAAGAGAAATACCCAAAGGTTGGAGCTGGAAA
GGACACCATTCCATGCAATATCCTACTGAAGGGGAAGCAGCTTGGATTTT
CAGATAAGCAAATTGCTAACTGCGTTCAAAGTTCTGAACTGGTTATTCGC
AAGTACCGTTATGAATGCAACATTTTGCCCTGTTTCAAGCAAATTGACAC
TGTTGCTGCAGAATTCCCAGCTGAAGCTAACTATCTGTATTTAACTTACA
ATGGAGattgtgatgacgtcacatacGCAGAAAGCCAAAACAAAGTCATG
GTTATTGGGTCAGGTGTCTACAGAATCGGAAGCAGTGTTGAATTTGATGC
ATGTGCTGTTGGATGTATTCGAGAATTGAAGAGGCTTGGTAAGAGCACAA
TTATGGTGAATTACAATCCTGAAACTGTCAGTACAGACTATGATGAATGT
GATCGATTGTACTTCGATGAAATCACATTTGAGACAATCATGGATATCTA
CCATAAAGAAGACCCAGAAGGTATTATCTTATCAATGGGAGGACAGGTTG
CCAACAACATTGCTATGCATCTCCACAGACAGGAAGTGAGGATCCTTGGC
ACATCGCCAGAAATGATTGACAACGCTGAAAACAGATTCAAATTCTCTCG
TATGCTAGACAACATTGGAATCCTACAACCAACATGGAAAGAGTTGACCA
CGATGGAGGAAGCCTATCAATTCTGCACCAAAGTTGGTTACCCAGTGCTG
GTACGACCTTCATACGTGTTGAGTGGAGCTGCCATGAATGTTGTTTATGC
TGAAGATGATTTAGAATCATATCTTGGATCTGCTGTCTCCATCTCTAAGG
AGCATCCAGTTGTCATCTCCAAATTTATATCCAATGCTAA
Run BLAST on NCBI

transcript from alignment at sc0000012:100209..121470-

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001912 ID=TCONS_00001912|Name=TCONS_00001912|organism=Clytia hemisphaerica|type=transcript|length=21262bp|location=Sequence derived from alignment at sc0000012:100209..121470- (Clytia hemisphaerica)
CAATTATCACCGATTTAATTTTCGCGCCAATTAAATCGGGGAAGTGGTTT GTTTTGATTTGGTTTCTAATGCCATCGCTATTTTGCAGAATGATTATTTT ATCAGTAGGAGCCAGCCAAGCCTCTTGGTAAATATCGGTCCGCAAAATAT ACATAACAGCACGTGCTAATTTTTTTCTCCGACCTCAAAAGCATGTTGTA AAATTTGGTACTGTCACCTGATCTGATGACTTGACTTGGTCACATATCAG CTGATAAGTACATTTCACCTATCATCCTCAAAACTGACTTGCTCAGAAGG GTAAGTTTTCTATTATTTCTCTTTGTCTCTTGTGGTTCTTTTCGCGTTAA AATTATGAATAATTTATTAAAGTAAAAACTGTTATGTTAAAAACTTCAGG GGTTACTATTTACTATACCATGCTTTCCATGTCATTTTCCTTAAAATACA GCCAGACAGCCTTGCATTCTTACAAAAACAATAGTGAGGTCAGGTAGCAC ATAAAAACGTAAGAATACTTCAGATGGTGATTAAAGTATGAAATTTGGCA CAGATGATCCTTAGAGGGTCTAAAACTTAATTTTAAACAGTAACACCAAA TTTTGCCACCTGGCCACCTGCCAGATGGAAAGATCTAGTTTTAATCACCA ATTCCAGACGGTGTCAATCCAACAACTTCGAACAAAAATCGCAATCGAAC CAATCGAACGTAGTAATCGAATGCAATATAATTGCAATTCGATTGTCGAA CGTAATCGAATCTTAATCGAACGGCCGATTCCTGGGTAATATTCGATTGT GTTCGATTGCGTTCGAGTAATGTTCGATTGATAGTTGACTATGTTCGATC GGTTCGATTGATTGTCAATTATATTGGATTAATGTTCGATTACGATTATG TGCGATGAGTTTGATTTTGCGATTAAATCAAATTGGATCACTCTGTTAGA GCTTTTTAGCGTGGGCGGCAGAGTGCTTAAGTACCATACCAAAGCGAATA AAATCTAATACAATCGAATACAATCTAACGTAATTGAATACAATCGAAAG TAATCAAAGTAATCGAACAGTAAATCCTGGGTAATATTCGATTGCGATTC GATTGCGTTCGACAATCGAATTTCAATTATTCGATTGCGTTCAATTGCGT TCGATTGATTCGGCGTTCGATTCGTTCGATTGACACCGTCTGGCCAATTC CGCCCTTCTCCTCTTTTTCTCTATTTCCTAACTCTTACTTTGTTTTTTCT GATTTCTGGACTTAGTTTTTCTGAATTTGACTATTTGACGCTATTTTGCT AATTCTGAAACTATACTCCCACACCTCGGTTCGAACCACCAAATGCAAGC AACCTTGGTTTCCAAACCCGACGCCTTACCACTTGCACTATTGTCGCACA GCAAAATCACGCAATTCATAACATATTATACCGAACTGGCAAAAAACGGG GGTAATGTTATTATAATATGAGTAAAAGTACCCCTTTTTTAAACCTGACT GAAATTATTCGAGCCGTTACTAGCAACCCTGCGGGGCCCAAGGCACCGAG TATGCACCCAGCACAGTGACAAGCCGTTACTAGCAACCCTGACCCTAACT AACTGACAATAATCGAATCCTGACCCCGGAAAATTACCACGGACTAGAAA GAACGAAAAAAATTGAAGGGGCGGAATTGCTGATTGAAACTAGTTTTCAC CCTGCCAGATGACGTCATCAGGTGGCTGGGCAAAAAATTATTTTTTTGAA AATATTCAAAATCTGATGGTTCCAGCGGAAAGAGCATGAAATGCTGATAA AAATTGAGGTATAAAACATGCCTTGAAAATCTTCCTATCAAAAGTTATAG ATGTTGTCCGATGTTCAAATTGAATTAAAAGCTTTAAATCAGGAGCACAG TGTACAACCAACTAATTTTTTTTTGCTGTTTTAAGCCTTCCAATTTTTTT TGACCCAAGCATCAGATGGAACTTCAAATTTTGACATGGATTCATGTATA AGACACTAAATTTGGTCAACTAGTTCCGTTATTACGGGATTTTAGGTTTT GCCTGGAAAGGCTTGCGATGACGTCATCACAAAACTTTAAGCCTTCATAA CTTTTGATAGGAAGATTTTGAAGGCATGTTTTATACCTCGATTTTCATCA GCATTTCATGCTCTTTCCGCTGATACCATCAGATTTTAAATATTTTCAAA AAAATAAATTTTTGCTAAGCCAATTGATGACGTCATCTGACAGGTGGCCG GGTGGCAAAATTTGGTGTTACTGTTTAAAATTAAGTTTTAGACCCTCTAA GGATCATCTGTGCCAAATTTCATGCTTTAATCACCATCTGAAGTATTTTG GTGCTAACAGACCTCACTACCTACAATGCAGAATATTTATTTCCCCAGTC AGAAATGTAGAACACAGACATGTGCTTACTTCTGAAGTCTTCTATTATCC AAGACATGCTAACTCTCTACAGAAAAAAATAGTACTTTTTTGAATTGGTC TACAAAATGCACATGATTTTTAGAGACCTTGTTTGTCAACTTGCAACCCC GTTCTTGATTCAAAGTCAAGCGTTGTCAAGTTTTATAGCAGATAAGCTTC AATATTTGAAAATTTTGTGGAATTAGACTTGAAAATTATAGTTTTTCTTG ACAAATTTAAGATTAAAATTTTCATGTGGACAAAATTTTGTGAATCTATC TTCTCTTTGTGCTAATTTTTTCATTTTCTATAAAATCCTGTTATTCAAAA AAAATTGTGAGGACTAATTTTGGCAATTTTTTTTTGAATAATAGTATTTT TGAGAAAAGCTCAAAAAATAAAGAAATTAGCCTAAATAGAAAATGGATTC TCCCAGACGGTGTCAATCGAATTAATCAAACGCCGATTTGATTGTCGAAC GCAATCAAATATTACAGTACCCAGGATTTGCAGTTTGATTGCAACGATTT TGTTCGATTACATTCGATTGATTCAATTGTATTCAATTTTATTCACTCTC GTACCATATTACGCGCTCAGCCATCCAGGCTAAAAAAGCTCTTAGAAAGG AGTGATTAAATTTAATTTCATCGCAATCAAACTTATCAAACACAATCGTA ATCAAGGCGGATCTCTAAAAATTGTTTGGTTCCCGTCATCCGACCGACCC TGATTTTTACTCTGAAGTTAGAGTCAAACTTACAATGCAGGTACCTACAA TGAACAAAGATGGTATGTATGTACAAAAAAATATTTTTGACCGACCGACC GACTGACCGACCGATCCACTTTGTAAAGTCGAAATGACGGGAACCAAACA ATTTTTAAAGATCCGCCCAAACATAATCGAAGATCAATCGAAGGTAATTT ACAATCAATCGAACCAATCAAACGTTACTCAAACGCAATCGAACACAATA GAATATTACCCAAGAGGCCATTCGATTGAGATTCGATTGCGTTTGATTGA GATTTGATTGCGTTCCATTGAGATACGATTTCATTCGATTGAGATTCGAC TGCGTTCCATAATCGAATCGCAATTATTTGATCTTGTTTGATTACGTTCG ATTCGTTCGATTGCGATTTTTCTTTGAAGTTTGACACCGTCTGGATTCTC TGAAGCACCAGCCATGAATATCTGTTATCAAATTAAGAAAACTTTTACCA CTGTTTTTACTGGACAGTTTGGTGTGGGTTTAAATTTATCAATGATTTCT TGCTCATTTTTAATTTTTGTTAACATTTTTCCTATTTTCAAATCGGCATT GGTAAAATAGCGAAAAAGTTGGACAAAGATTACCCAGAGAAGTATTTCTT TTCAATAAAAGTAAGTAAACAATGATTAGGAAAAGTTGATCTGAAATGAT CATATCGGTTAGACACAACCATTATGGACACTGGCATGTGTCATCCAGCT CAGAGTGACTTTCATACAGTAAATGGATTTTCCAATTTTTCTATTCTAAA ACAGTCTGGAATTGGTGTACCTGTCTGGAAAAATATGGAATTTGAAGGAA ATAGTCCTTAATGAAGTCTAAAAAACTTCCCGGAGATTGGAAACTTTTAT CTTGACATTAGAATTTTCCAACAACTTCTGTTTTAAAACTGAAAACCTTC CTAATGGATGAAATGTCTAGAATATTTTTGGCATTTTTAGGAAAAAATTA ACAATTTGGCTTTCCAGACTAAAAGTCTGGAACTTTCTGTATGAAACACC CTTATCTCAGCAAAAAACAGTAAAAGAACATGTATTGGTAAAGAATTATC ATTTTGCTATATAAAGATAAACAAGATTAATTAGGATAGAGCAATCGACT AAATTAACTTTGAATTCTTCTGGTCTAATAATGACGCTTCAAACGTTATC AAGATAACAATAGCCATTTTTTGAACTTTTAGTACACAGATCTCAGTTGT TCCCCTAATGAGCATTCACAGATTTGAATGTTCTTTTTTCATAACTAGGA TTCAAGTTTTCTCCTTGGTATTCAAGTGACTTCAGTACACTCATTTTGTT TTATAAGCATAACGTTTATAAGCATATGCTAAGCATACCTTGAGGCTCAG CCAAAGAAATTTTTAGAATCATAATTTCCAAAACTTCAGAAAATAACAGA AGAAAGAATCATATATCATATATCATATGGTAAACATTCGAAAACAATAG AATGTCTTCATTTCTCTCAAGATTAAAGAGAGGGGAAAATGCGCGAAAAA TCTTACCACAGAAAAGTTTAGTTTTGTATTATTTGTAAGAAAGATAAAAT TATACATAAATAGTTTTACCAATTATGTATTGAAACTTTTCGAAAGTGCC TACAAATTAAACAACCTTATATTATTATTGGTGTTTAGACAAAGGCACCC AAAAGTTAACCTCAGGCAATTATTTCCACCCCAAAAAGATTTGTAGGATG TACGGACGGATGGACGCAGAAGGCTACCGTAATACTTTAGCTGGGCAAAA TTAAAGGTCAAGTTTGAAGTTTTAGATATATAACCCTGTCTTAGTAAGAG TATTTTTTAGATAAAAGGGAAGACAAAAAGTCCAACAAATTTGACTTTGC CAGACAAAAGTTTACAAAAAATAAAAGCTTTTCTACCAAGAAAGTTAAAA AGCTACAGTAAGAAAATATTGTACAGTTCGAAAGAGAGCATCAGTAAGTC TTCGTCAATTTCAAGATCCACAATCANCTTTTCTACCAAGAAAGTTAAAA AGCTACAGTAAGAAAATATTGTACAGTTCGAAAGAGAGCATCAGTAAGTC TTCGTCAATTTCAAGATCCCCAATCATAGAATGCCCCCCCCCCCTTGAGC TTAGGGGGGGGGGCTAAACTATTTTTGCTTGATTGGGGGCTGTATTTTTC AAAAAATACTGGGGGCTAGCTTGCTAGGGGAGGCTGAGTGTTGTGTAATA GAACCAGGGGCAGAGCTGATAGGTTGAAGATATTTTAAATTATGTTAAAA ATCTATGCTGTGGGGAAGGTTTTATCCCTCTTGAAAAAAGATTTTTCCTT GCAGCGCAATCAATTTATTGAGAATTTCCATGCAAAATTTCTTTGATATT TTGCTTTGTGAAGGTGGGGGCTATGTTTCTAGAATTTAGCCTGGGGCTAT TTTCCTTTGCCTCTTCCCCCTGAAAAATCCTGGGGGCTGGACCCCTCTGC ACACTATGGTCACAAGATCTGACATTATCAATCCCGTTTTCCATTGTAAT TTTTTTTGTGATTTCATTGTGAAATCGCAAAATGCCATACTTTAATCCGA TCCCTGATTTACTTGTATAATACTGGTCCTCATTTTAGCAAACCCTTTAA AATCTTAAATAATATTATTGAAAAGATTTTTCAGATTGCAATCTTTTATT TAATGGTATTCAAATATCATATCAATATGAATGTAATGACTAGAGATTTA TTTTCAAAAGATTTTTTCAGCCTAGGGTTTTTGCTGACCTAATTTGTTTA CCATTGTTTTGTATAGAAAACCGAAATGGCGACACTTATTCTTGATGATG GCACCAAATATCATGGTCAAATTTTTGGTGATGAAAGAAGTATTGCAGGA GAAGTTGGTAAGCTTGATAAACTTTATGTTTAATTTTTGCTGACGCTGTT GCAAAAAACTTAAATATAATTTTTAAATGAAGAGCTGGATTGTAACAAAA GCATAAAAGGAATAAGTTTTTTACTCTTCTAGTTATGATTTTCCTTTTCA ACTGGTTTGGACAGCCTTTTTTCAAAGTAGTGTAATTTCAATTCATATTT GTTTTATTAGTCNCTGACGCTGTTGCAAAAAACTTAAATATAATTTTTAA ATGAAGAGCTGGATTGTAACAAAAGCATAAAAGGAATAAGTTTTTTACTC TTCTAGTTATGATTTTCCTTTTCAACTGGTTTGGACAGCCTTTTTTCAAA GTAGTGTAATTTCAATTCATATTTGTTGTATTAGTCTTCCAAACTGGTAT GGTTGGTTACCCAGAATCATTGACAGATCCTTCATACAACAGTCAAATCT TGGTATTGACGTATCCACTGATTGGTAATTATGGTATACCAAACGATTCT CGTGATGAACATGGCATGCTCAAATTTTTTGAATCTGAAAAGATTTGGAA CAATGGTATGATTGTAGGAGACTTGACTGAGGACTACAGCCATTGGTTGG CAACCAAATCACTTTCAGAGTGGCTGAAGGAACACAAAATACCTGGAATT ACTGGTAAGTTTAGTTCTTGATATTTGAAATTAAGATTTTTTAGTATTAC AAACCTCAAAGGTTTCAATTTTCGGAAGCTTTGTGTCACCTTCAACAAAA TCAGCAGAGATAAGATAAAGAAAGTGGAATAAGATTTCCAATGAAAATCT GTTACTCCTTTTCTAAAAAAAATTATGAAAGAGCAAACATCTATCCACAG ACACACATTTTGTCCTTCCCAGGACTCCGTGCGGCTTGGGTAAGTGAGCA TAGACTGCTTTTGTCACTAGAGTGCTCAAAACACTAAGCAACAGAGTGTA TTGAGTGCTCAAAGAACCAAAGTTCTGAAAAAGCAAACATAAACAAAAGA GGATGATGGGCCTATCTTCAATCATGATTATGGCTTAGATATTGATTTCA AAAGGCACACCTTTTTAAATTGTCTTACTAAACACTGAAAGTTTGCTTTA TTTTGAAGGTATTGATACCAGAGCATTAACAAAGAAGTTGAGAGAAAATG GAACAATGTTAGGAAAGGTAAAAATTACATACTTCTGCGGCGGACATCAT GAATTCAAGACTTCCAATGCTTGTGGTCCAACATTGCAGTGATTAGTTGT TGTGTTGTACTGCAGCTTGTGTCGTGGTGCAATGTGTGTAAAAATTAAAA TTCTTCAAAGAGATTCTTTTCCACACTTTCGATAGAATTTGGAAAGTATT GTCCCTGATTGAACAATTTCAGATTTAATTTTTTGCTTTTCATATTCAAT AACCTTTTATCATTGTGGCTAAAAAGTTAAGTTTAGTTGTTCTCCTTTTT TGATTTTCCAAGTTATTATTGTCATTGCTATAGATTGTTTTGGATGGAGA GGATGAAGCAAGTGTTCCATTTGATGATCCAAACAAAAGGAATTTGATTG CTGAAGTCTCTTGCAAGGTACTATATCCTTTTCTTTTCAAAACTTTTGAT ATTCACGTTTTAGTGCGCCTAGCAAAATCAAGGCGTTTATGTGTGTCTAA GTGCGCTTAAGTGCGTTAGTGAACGTACTCACTAGAAAGCAAAAATGTGT CCGATGCACTTAGACGCACTTAAACGTGATTTTTTGCACAAGTGAGTACC AAGCTTCACTGATGTAATAACATTTTCATCAAATAGAAAAACTTATACAC AGTAACAAATTATTTTTGGTAATAAAACCTTTAAAACATATGTTCTTCCA GATTTATAAGATTATTATTCCTTCCTTTTTTGCTTCTAGGAACCTAAACT TTACAATCCTAAGGGTAAAATAAAGATGATTGCTGTAGACTTTGGTATCA AATACAACCAGATCCGGTGTTTGATTGATTGTGATTGTCAGGTTCTAGTT GTTCCATGGGATTATGACTATAGTACATTGTTAAAGAACAAAGGTAAGAG GTAGAAAATGTCTTTTAGAATTATTTTCACTTTCTTATTTAAATATTAGT TGAATTTTCATTTGTTCACAAAAACATCTTTCATGTTTTACAACTTCTGT ATTACACTTCCGTATTATATAACTAACCAAGTATTTAATGCGGGGAAAAT GAATGTCGTAGTGGTGTGGTGGTCATTGCTCTTAACTCCCGTCTGGGAGG TCCAAGTTCGATTCCACTGTAGTACTACGGTTCACTTGGAAAATGGACGT ACCTTCGCCCAGGTAAACCCATACCATGTGAGGGGAATTGGGTACCACTA CTCTGATACAAGAGTGTGGGTGATATGTCAGACATTGTGGTGTGTAGTGT GGTGTCACTCACCGCGTTCTGCGCCTAGCTCGAGTGTCGCCACTATGCAT CATAGTATCTGTGTCTCGCTTGCACAGAACCAGCGGTGTCTGGACAACGC TAAGCGCTCCAACTTGAAAAAAAAGGAATTCCTACTTTGTAAGGAGTAGG ACCCATTCAGTGGGAAGGGCTGATATCATCAAATGAATGCAACAATTAAC GCAAAAGGCAGGGTTTTCAAAAATTACCACATTTTTGTTAAACAATTTAA TTTAATTGAAGCGAGGGTAACGGATTTGCCTTAATAAAGGTTGCTACCCA CTCAGCATTTTATGGTTCGTAAAACAAGGTGCGCTGCTTAATTATTGCAT AAATTACATAAATCAAGCCTTCAAAGGCTGTCGCTTTGAGCGCAACAAGA GTTGAAACTTTTCAACTTTTTTCGCTGAGCTGTGCAGCTTCCCTATTATT CTTTTTTAATTAGCCATCAGAAGAGACATTTAACTCTCTTGTACTGTGTG CAAAAAATATCAACAATAGAAGAAAGAAATAATGTGCAGCATATCTCCCC TTTATTTTGGATCAGTGGAATGAGAAAAACGTTCAGCGCCGAACATAAAA TGCTGAGTGGGTAGCATCCTTATTGAGTAGTTATATAAGTGTAATAAGGT AACCTTCAACAATCTCTAATTTCACTTTTGTTTTTTGCTACTCTTCTAGA ATATGATGGTCTGTTTATGAGCAATGGTCCTGGAGATCCTAGCCTTTGTC AAGTTTCAATTGACACCCTCCGTAAAGTCATTACAGAATTGCCAGATGTG CCAGTCTTTGGTATTTGCATGGGTCATCAGATCTTATCTCTTGCTGCTGG ATGTGGGTCCTACAAAATGAAGTAAGGTTTTCGTCATTTTTTCTTGTAAT GGTGAGCATAAATTGTAAATTCTATTAAATGACATTTAAAGAATCTTTTG TGGTAAGCATCCCACTTATCTTATCCTACTTATATTATCCTACTCAGTTT TTTAACTGTGTTTGTTTCTTATCTCCCCATTCTATTCCTTTTTCTAATCA GATATGGTAACAGAGGACATAACCAACCTGCAACCCATTTGGAAACTCAA CGTTGCTTCATCACTTGCCAAAATCATGGCTTTGCAATTGACACAGACAG CTTACCAAAAGAATGGTCTGTTTTGTTTACAAATGAGAATGATGGCAGTA ATGAAGGCATTGTTCACAACACAAAGCCAATCTTCTCAGTTCAGTTTCAT CCTGAACATCAAGGAGGACCAAGAGATTTGGAGCTTTTGTTTGGCTTTTT TGTGGATATTGTAAACAAACTGAAAATCGATTCTAACCTCTGCTTACGAA CCATGCTGAAAGAAACGTTGACTTTCCACCCAGCAGAAGAAACAAGATCC AGAGCATGTAAGAATTTTAAATTTTTTATGAATACTGTATGACTTCAAAT ACACCCTTCAGGTGGCATTTATTTAGGGGACTTTTTAAAAAGAAGGGGTT GATTAAAAAGGGGGTCGTTTGAAAGAAGCATGTCTATTCAAAGTTAGGTT AAATAAATTCNAGAAGGGGTTGATTAAAAAAGGGGGTCGTTTGGAAGAAG CATGTCTATTAAAGTTAAGTTACATACATAAGTATGCAAGAATCATTTAG TTAACTTTTACCTTCTATTTTTACTTAAGTTTTTCAAGATGTTCTTTTTG TATTTTTATTACAGTCAAACCAAAGAAGGTCTTGATTTTGGGATCTGGTG GCTTATCTATTGGTCAAGCCGGAGAATTTGATTATTCTGGCTCTCAAGCT ATCAAAGCATTAAAAGAAGAGAAGATTCACACAGTTTTGATCAATCCTAA TATTGCTACAGTGCAAACTTCCAAAGGACTTGCAGATAAAACTTACTTCC TTCCTGTTAACTTTGAATTCACAAGCAAGGTATGGAATTGCTTTTCACAG TTATTTACAGTTCTTATTTCATTGTATGTTTAGCTTTTTAGTCACTGATC ACCAACAATGTTATCAAAACATTTTGTAGTAGAATTGTATTTAATTGATA CAAACCAATACTCTAGTACCTGATTCAGCATTTAATGCAAGAAGAACTAC AAATCAGGATGAATCATTTGAGACGTGGCACACACCTTCATACACCTAAC CCCTTTAAGGAATGCTATCAACCACACACCATAAATTTAGACTTTACTAC TAAAAAAAGCGGTGGATAGCACGCCTTATCACACGTCTAAATTAGCAATA CTTAGTTTTTAGGAGTGATTGAATTTTCCAAATTAGAAAGCCTGACAAAC GCTGNATCTAAATTAGCAAAACTTAGTTTTTAGGAGTGATTGAATTTTCC AAATTAGAAAGCCTGACAAATAAATATTGTGAAGACTGCTATTATTATGA TTTTTTTATAATTTTGTAGGTGATTGAAGTAGAAAGACCAGATGGCATTC TGTTATCATTTGGTGGACAAACAGCATTGAACTGTGGACTGCTATTGAAA GAGAGGGGAATTTTAGAGAAATACAATGTTGCTGTTCTTGGTACACCTAC CAAATCGATTGAATGGACAGAAGATAGGAAAATGTTTTCAGACAAGATGG GAGAGATTGGTGAGAAAGTTGCACCAAGCTCAGTGGCTTATACTGTGGAT GAGGTGAGTAATTTCTTTTGAAAAAAATAGAAAAAATAGTTATTCATAAT TTCTTATGTTTGCTTTATAAAAAAATTCAAAGGTTGCATTTTTTGGTTCT CAGAAAGTCTCCTTCTTATAAAAATATAGTTGATTCAATGATCCTCACTC TCTGATCCACAGCCAAGCCACCAGTTGAGCATGCTCAATTCAGTTGCTTA CTATAGAAATATGCTCTTGGTTTTCATATGCTTTTCATTATATTTTTAGG CTATCACAGCAGCTAACAGGCTAGGATATCCAGTGTTGTTACGTGCAGCA TTTGCACTAGGTGGACTTGGATCTGGTTTTGCTTCCAATGACAATGAGCT CAAAAAGCTTGCAGCATCGGCTTTTGCACATTCCAAACAGTGTCTAGTTG ACAAGTCACTGAAAGGATGGAAAGAAGTTGAATATGAAGTTGTTAGAGAT GCTTATGACAACTGTATCACTGTAAGTTATTCTTTTGAAGGAGTTTCAAT TAAACAGCGTTTGTCTTTTGGAAATTAATGCATTCTTTTAGGAAGTATAT GTGACTCCTCAAGCGATTTGGAGTACACAAAAGACCGATCGGCCCAAAGC GGGTAAAATCCCGGTCTTAAAGCAGCCGAAGTAAAATCTTTAGCGGCCCA TCATTCATGAAAATCGGCCTCAAAGCGGGCGAGAGAATTTTTGAAAGGTC CGCTTGAGGCCGCTCTTTTAGCGGCCCTTCTTGAGCAAGAGACTTCCAAG CGGCGTCNATAGGCTATTTTGTATCGATAAGGAAGTTCTATGAAATATAT CATTGGAAAATCTTTCTCGATAAAGTTTTATTGTTAAAAAATTCTATCGA TAAATTCTATCGCTAAAAATGATAAGGTTGTACCGAAGCAATTGGTCGCA AGACGTTTGTAAAAGTTACAAAGAAAGCGATTTGATAAAACTAAGCATAA GGGATGCTCGTAAAAATTACGGAGAAAGCGAGTTGATAAAACTAAGCGAG TTGATAAAACTAAGGAAAAAAGACGTTCGTGAAAATTACGAAGAAAGCGA GTTGATAAAACTAAGCATAAAAGACGCTCGTTAAAATTACGAAGAAAGCG AGTTGATAAAACTAAGCATAAGAGACGTTCGTGAAAATTACGAAGAAAGT GAGTTGATAAAACTAAGCATAACAGACGCATTTAAACTATACAAAGAAAT CAAATTCAGAAAAACTAAGCATGATAGATGCTTGTGGAAGCAATGTAAAA AACGAGCTAATATTAGTTGACTATTCTTGTTAAAACATACGAAGAAAAAC AAGTTGATAAAAGTATGCATAAGAAACTCGAATGAAATTTATGAAAAATG GATCGGCTCAAACAAAAGTTGTGGCTAAGAGACAGGGGTGTTCTGTTTCT TAAAAAGTCTGTTGACGTACCCATGCAACCTACTATGTCTTTAGACATTT TTATTTGTAAAATTTCGGACCCTTAAAAACAGTATAATGACTTCTAAGTT GAATCGATAAAGTTTTATCACTAATTTTCTATTGCTACTTTTGTTATCGT TATCGATTAGTTTCTATCGCTAAATTGCACTGCAATGACTTCATTCATGG ATCATCTATCGTTAAACTTTTATAGATAAAGCTCCCATCGCTTATTTGGG ATCATTAAATTCTTATCGATAAAAGTCTATCGATAAAGTGTTGAGAGCGG TTGTTAAAAATGTCTACCATATCAAAATAAAATCCAAACGATTTAAAATT ACAAGAAGAAAATCTTACTTTCCAATTTCACAACACACGACAACTCGTTT TCCAAGAAACGAACTCAATGTTTACATTTTCGAAAACGAGGCTAAGTAAA AGTAAGTAAGTAAAGAAATCAATAGCGGCCATCGGGACGAAGCGTACCGG GCATTGGACCCCTCAGGCCCCTTTAGCGGCCTCAAAGCCTCTTCGTTATG GCCGCTTTACATGATCGGCCATGCATCGGCCTCTTTCAATTTTTGAACGG CCTTAGCGGTAAAAAGACCGGTCCAATAGAGGCCAAAGAGGAACGGTAAT TAGACCGATCGGACTTTTGTGTACTCCAGATTGCTTGGGGAGTCACATAT TCGTAATAATGTCAATAGTGGGCTTCCCCATTTTTGATTTTCTGCTTTTT GAAAAAAGGTTTGGGTTCGAGGTGGTGATGTCCCAATTTAAATATTCTGC CCAAACAAAATAAGTTTACAATACGAATTTGAAGATGATGCCCATAATTT GTGAAATAGAGGNTATTGAAAGAGAGGGGAATTTTAGAGAAATACAATGT TGCTGTTCTTGGTACACCTACCAAATCGATTGAATGGACAGAAGATAGGA AAATGTTTTCAGACAAGATGGGAGAGATTGGTGAGAAAGTTGCACCAAGC TCAGTGGCTTATACTGTGGATGAGGTGAGTAATTTCTTTTGAAAAAAATA GAAAAAATAGTTATTCATAATTTCTTATGTTTGCTTTATAAAAAAATTCA AAGGTTGCATTTTTTGGTTCTCAGAAAGTCTCCTTCTTATAAAAATATAG TTGATTCAATGATCCTCACTCTCTGATCCACAGCCAAGCCACCAGTTGAG CATGCTCAATTCAGTTGCTTACTATAGAAATATGCTCTTGGTTTTCATAT GCTTTTCATTATATTTTTAGGCTATCACAGCAGCTAACAGGCTAGGATAT CCAGTGTTGTTACGTGCAGCATTTGCACTAGGTGGACTTGGATCTGGTTT TGCTTCCAATGACAATGAGCTCAAAAAGCTTGCAGCATCGGCTTTTGCAC ATTCCAAACAGTGTCTAGTTGACAAGTCACTGAAAGGATGGAAAGAAGTT GAATATGAAGTTGTTAGAGATGCTTATGACAACTGTATCACTGTAAGTTA TTCTTTTGAAGGAGTTTCAATTAGTTATTCTATTCTATTCTTTGTCTGTA AACAGCGTTTGTCTTTTGGAAATTAATGCATTCTTTTAGGAAGTATATTC GTAATAATTTCAATAGTGGGCTTCCCCATTTTTGATTTTCTGCTTTTTGA AAAAAGGTTCGGGTTGGAGGTGGTGATGTCCCAATTTAAATATTCTGCCC AAACAAAATAAGTTTACAATACGAATTTGAAGATGATGCCCATAATTTGT GAAATATCTTAGGAAGGGTATATTCTCTGTTACTTAAAAGCCCTCAGCTT TAAACTTGTGTTTGATTACAAATAAGCTATATGTTTTCCAGGTTTGTAAT ATGGAAAACTTTGACCCTTTGGGAATCCATACGGGTGAATCAATTGTTGT TGCACCAAGTCAAACACTAACAAATGAGGAATACAATATGCTTAGAAGAA CAGCCATCAAAGTCATCCGTAAACTTGGTGTTGTTGGTGAATGTAACATC CAGTATGCTTTACACCCTGACTCAAAAGAGGTACAAGTACTTGACCACTT GAGCAGACTGGAACACTTTTACCCCTTTACCCCAATGAAACCTTCTTTTA TACATTTGCTTGTTACAGCATCTCAAAAAGACTTGTTTTGTGGTGACTCA ATTTTCCTTTCTTTGTCTTTATTTTGTTCAATTTCTTCAATCCCAGAAGA GAAACACTTGCTGATTATCAATTTATCTTTATTTGTTTTTGTCAATCAGA CTTTGATTAGACACTTAGACACAAAAACCTTTTGCATCATTGGTAAATGA ATTTCTAATTTTTGGTTTTGAAACAAAGAATTAAAGCATAATATTTCTGA ATCTTAATATTGCATCAACCTTTTTTATAGTTCTACATCATTGAGGTCAA TGCTCGTCTCTCCAGAAGTTCAGCTCTTGCTTCCAAAGCAACTGGATACC CATTGGCTTACGTTGCTGCTAAACTTGCACTTGGTATTCCTCTACCAAAA CTGAGAAATTCTGTCACCAATTCAACTACCGCTTGTTTTGAGCCCTCTTT GGATTATTGTGTTGTGAAAGTTCCTCGATGGGATCTGGACAAATTTCAGA GGGTTTCAACAAAGGTGATTTGATTGTTTTGATATCGTGTACCAAAATCC ATATTATATGAAAGGAGATTTGTTTTTGACTGAACCAGTAGTTGATTAAC ATCCAATGCATATGGAAAAGTTTGACAGTTGATATAGATCTATTCTGGTT AAACCAAAGCCAAAATTGTAGCAGCCTTTCGATTTATAAATTTATCTTGG AATCAGGTGTGAAGTTTTGTACCTTTTTCTTTTCTAATGCCATTTGTGTT TTTTAGATTGGATCTTCGATGAAGAGTGTTGGTGAAGTAATGGCTATTGG AAGAAGTTTTGAGGAAGCCATTCAAAAGAGTTTGAGAATGGTTGACGATT CAAACCTTGGTTTTGATGCAAACAACCTCGAGTTGGATGAACAGGTATCT CCTGAAGTTTATCAGTCAATTTCTTTTTTAGTCTATTATATTACAGCTTA AAAACAGGCTTAATCTTTTTCTCACAAGATTCGAACAAAATGTAAGAGTT GGTCCAATAAGGTTCTCCAGTGTCTGGTGCTTGTTACCTAATCTAGGAAG ATACCTTTTTCTTCGACTAATAGAAAAATCTTTACTGTAATTGTCACTAC AATTTATCTTTTGAAAAAAAAATCACATAATGTATCCTTTAAAGCAGTTC TAGTTATTATACTTACCTTGCTTCAATTTTCGGTCATTTGTTTCTCAATC AAAATTTGGTTAAATGCCTAGGTATCTAAAAATTATCTGCAATGGTTTAC AATGTGACGTTTCCAATGGAATATATATGATTGGAAGATTTATGATTAAC TTGACTTTCTGCCAATTCTCTTAGGTCTTAGTTGAGCCCTCTGACAAAAG AATCTTTCATGTTGCTGCTGCACTCCGTAGAGGATATTCTATTGATCAGC TGTATGAGCTCACTCGTATTGATAAGTGGTTTTTGAGCAAGCTAGCAAAA ATAATCAACTATGCAAAAATGCTGGAAGAGAAATACCCAAAGGTAAAAGT TTTTATGAAATTTGACTTTTTTGTCCTAGGTTCTCTGTAACTCTTCTTTT TTGGCAGGGTTTGGAAGCTTAGTTGAGTTTGTCTGCGGTCATTCATTATC ATGATTTTAACAGAAAAAAACAGTATTTCGGAATAAAAGCAGGTAAACCA ATTGCTTAATTTGGTTACTAACATAAGCTGAAAATGATTTTCTTCTTCAG AAAATCACGATAAATATTCTTTATTGTTTTTAGGTTGGAGCTGGAAAGGA CACCATTCCATGCAATATCCTACTGAAGGGGAAGCAGCTTGGATTTTCAG ATAAGCAAATTGCTAACTGCGTTCAAAGGTTGTGACTTTATCTTTTAGAT TTTACTACTTGACCATTTTATGTACTTAAACTTAGATTGAGTCAGATTAA TTAAATTTTCTAGACTTTACAAATAAAACTTCTTTAAAGAGTTCTTCAAC GTCTTAGCCTAGTGAATCGGCGATGCCAGGATCAAACCGCTACTTCATCT TCTTGCTCTACTCTGATAACCGAACTTAATACTCTGCAAAAGAGTAGTCC AAAGTGAGTGGATTATGAGTTCAACATTATGGAATGCAGACTAAGATTTA TCAACTTGAACTTGAATGTTTTTCTCTTCAGTTCTGAACTGGTTATTCGC AAGTACCGTTATGAATGCAACATTTTGCCCTGTTTCAAGCAAATTGACAC TGTTGCTGCAGAATTCCCAGCTGAAGCTAACTATCTGTATTTAACTTACA ATGGAGATTGTGATGACGTCACATACGCAGAAAGCCAAAACAAAGTCATG GTTATTGGGTCAGGTGTCTACAGAATCGGAAGCAGTGTTGAATTTGATGC ATGTGCTGTTGGATGTATTCGAGAATTGAAGAGGGTAAGTATAGAAATGA TTCTTAAGTCAAATCAACTCAACGACTTAAGCTACCAAAATTACTTTGAA AAGTTCCTAAAGTTTGACCGAAGATATTCCTCCAATGTTACTTGCTCTTG AGTAATTGACCGTGCATTCCCCTGTAATGTACATTGGGCTCCAGTCTTCC CCATCATATTTCTTGCAGTTACATTATTAGCTATTCAACTTTCCACCCTA CATATTCTCTATTTCAGCTTGGTAAGAGCACAATTATGGTGAATTACAAT CCTGAAACTGTCAGTACAGACTATGATGAATGTGATCGATTGTACTTCGA TGAAATCACATTTGAGGTAATTCTTTATCAACCGATAATTCAAATTGTCA TTTTNTTCTGCGGTCATTCATTATCATGATTTTAACAGAAAAAAACAGTA TTTCGGAATAAAAGCAGGTAAACCAATAGCTTAATTTGGTTACTAACATA AGCTGAAAATGATTTTCTTCTTCAGAAAATCACGATAAATATTCTTTATT GTTTTTAGGTTGGAGCTGGAAAGGACACCATTCCATGCAATATCCTACTG AAGGGGAAGCAGCTTGGATTTTCAGATAAGCAAATTGCTAACTGCGTTCA AAGGTTGTGACTTTATCTTTAGACTTAGACTTAAACTTAGATTGAGTCAG ATTAATTAAATTTTCTAGACTTTACAAATAAAATTTCTTTAAAGAGTTCT TCAACGTCTTAGCCTAGTGAATCGGCGATGCCAGGATCAAACCGCTACTT CATCTTCTTGCTCTACTCTGATAACCGAACTTAATACGCTGCAAAAGAGT AGTCCAAAGTAAGTGGATTATGAGTTCAACATTATGGAATGCAGACTAAG ATTTATCAACTTGAACTTGAATGTTTTTCTCTTCAGTTCTGAACTGGTTA TCCGCAAGTACCGTTATGAATGCAACATTTTGCCCTGTTTCAAGCAAATT GACACTGTTGCTGCAGAATTCCCAGCTGAAGCTAACTATCTGTATTTAAC TTACAATGGAGATTGTGATGACGTCACATACGCAGAAAGCCAAAACAAAG TCATGGTTATTGGGTCAGGTGTCTACAGAATCGGAAGCAGTGTTGAATTT GATGCATGTGCTGTTGGATGTATTCGAGAATTGAAGAGGGTAAGTATAGA AATGATTCTTAAGTCAAATCAACTCAACGACTTAAGCTACCAAAATTACT TTGAAAAGTTCCTAAAGTTTGACCGAAGATATTCCTCCAATGTTACTTGC TCTTGAGTAATTGACCGTGCATTCCCCTGTAATGTACATTGGGCTCCAGT CTTCCCCATCATATTTCTTGCAGTTACATTATTAGCTATTCAACTTTCCA CCCTACATATTCTCTATTTCAGCTTGGTAAGAGCACAATTATGGTGAATT ACAATCCTGAAACTGTCAGTACAGACTATGATGAATGTGATCGATTGTAC TTCGATGAAATCACATTTGAGGTAATTCTTTATCAACCGATAATTCAAAT TGTCATTTTTCTGTTAACCCTGAAAGCTGACAAGGTATTTGCTAATTTTA GTCCTAACTATTTCAAAGAGTCCCTGTGACTAATTCAACCTGCCTTCAAA CCAAACAGATGACCTAAACAGATTGAACAGAACTTTAGAAATCATCAAAA CACGACTTGTCTTTTTTCCAGACAATCATGGATATCTACCATAAAGAAGA CCCAGAAGGTATTATCTTATCAATGGGAGGACAGGTTGCCAACAACATTG CTATGCATCTCCACAGACAGGAAGTAAGGCTTTAACATCTGAAAACATTT ACCAGAGTTCAGAAATTATCCAAATAATATTCACATTCCTCATGTTTACT TTAATCTTCTTGCTACCCCCAATGTTTGTTTATAATTTGGAAAGTTCCCC TGGATGTTTGTCTATTTTTAAGAGTTTCCTTACAATCTTCATGTAATTGT AATGGAAATGGTAATGTCTTGGAAAAATATTATGACCAAAAACGTCATGT CATTTTTACTAAGATATTTGTTTTTCCATTAGGTGAGGATCCTTGGCACA TCGCCAGAAATGATTGACAACGCTGAAAACAGATTCAAATTCTCTCGTAT GCTAGACAACATTGGAATCCTACAACCAACATGGAAAGAGTTGACCACGA TGGAGGTGAGCTCATCAGTTATTCATAATGCACCTATCAAACCTTGAACT TTGGTCTTACTTACTTAAAATGGATGTCTGTGTTTATTGCTTTTTATTGC TGATATGCCATCAAATACAGAATATCTAACCCTGANAATATTATGGTCTT GGAAAAATATTATGACCAAAAACGTCACGTCATTTTTACTAAGATATTTG TTTTTCCATTAGGTGAGGATCCTTGGCACATCGCCAGAAATGATTGACAA CGCTGAAAACAGATTCAAATTCTCTCGTATGCTAGACAACATTGGAATCC TACAACCAACATGGAAAGAGTTGACCACGATGGAGGTGAGCTCATCAGTT ATTCATAATGCACCTATCAAACCTTGAACTTTGGTCTTACTTACTTAAAA TGGATGTCTGTGTTTATTGCTTTTNTGATCGATTGTACTTCGATGAGATC ACATTTGAGGTAATTCTTTATCAACCGATAATTCAAATTGTCATTTTTCT GTTAACCCTGAAAGCTGACATGGTATTTGCTAATTTTAGTCCTAACTATT TCAAAGAGTCCCTGTGACTAATTCAACCTGCCTTCAAACCAAACAGATGA CCTAAACAGATTGAACAGAACTTTAGAAATCATCAAAACACGACTTGTCT TTTTTCCAGACAATCATGGATATCTACCATAAAGAAGACCCAGAAGGTAT TATCTTATCAATGGGAGGACAGGTTGCCAACAACATTGCTATGCATCTCC ACAGACAGGAAGTAAGGCTTTAACATCTGAAAACATTTACCAGAGTTCAG AAATTATCCAAATAATATTCACATTCCTCATGTTTACTTTAATCTTCTTG CTACCCCCAATGTTTGTTTATAATTTGGAAAGTTCCCCTGGATGTTTGTC TATTTTTAAGAGTTTCCTTACAATCTTCATGTAATTGTAATGGAAATGGT AAAATATTATGGTCTTGGAAAAATATTATGACCAAAAACGTCACGTCATT TTTACTAAGATATTTGTTTTTCCATTAGGTGAGGATCCTTGGCACATCGC CAGAAATGATTGACAACGCTGAAAACAGATTCAAATTCTCTCGTATGCTA GACAACATTGGAATCCTACAACCAACATGGAAAGAGTTGACCACGATGGA GGTGAGCTCATCAGTTATTCATAATGCACCTATCAAACCTTGAACTTTGG TCTTACTTACTTAAAATGGATGTCTGTGTTTATTGTATGGATATGCCATC AAATATAGAATATCTAACCCTGATAAATTCAAACCCAAATCTCTTTGATG GAGTTTGTTACTGTCAACCTTGGTTTGTGTTAGTTAAGTTTCTAATCCCA GATTTTCATTGCATCCTTATTTAAGTTCTTCACGATTTGCTCTTAGCTAT TTTGGATATTCAAACTCTGAATTTACAGATTTTGCCCGGGGGGACGGTAT GTGAGGCAAAAAAAATGGCTTTTAGAATCGCACCCTTACAGTGCAGAAAA AATCGGTGAAATTCATACCCTTACAGTGCATTTTTTCACATTTTAAACTC GTTTAGAGCATGAAAAGATTTTCGAGAAAAAATTAGCAATTTTTCCTAGA TTTGCTGAAATTTTCACCCATACAGTGCATTTATCAAAAGTCCACCCTTA CAGTGCATTTCTGATATTTTGAAAAACATACCCTTAACCACCGCACATAC CCGTCGGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNCCCCCCCCCCCCACGAGATTTTGCAGACAAAATAATTTACTATTC AGTCATTACCATTTCTGCATTTTGTTTAAGGAAGCCTATCAATTCTGCAC CAAAGTTGGTTACCCAGTGCTGGTACGACCTTCATACGTGTTGAGTGGAG CTGCCATGAATGTTGTTTATGCTGAAGATGATTTAGAATCATATCTTGGA TCTGCTGTCTCCATCTCTAAGGAGCATCCAGTTGTCATCTCCAAATTTAT ATCCAATGCTAA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000986XLOC_000986Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001912-exon-sc0000012-1575043694:121171..121470TCONS_00001912-exon-sc0000012-1575043694:121171..121470Clytia hemisphaericaexon
TCONS_00001912-exon-sc0000012-1575043694:115414..115504TCONS_00001912-exon-sc0000012-1575043694:115414..115504Clytia hemisphaericaexon
TCONS_00001912-exon-sc0000012-1575043694:114767..115036TCONS_00001912-exon-sc0000012-1575043694:114767..115036Clytia hemisphaericaexon
TCONS_00001912-exon-sc0000012-1575043694:114254..114312TCONS_00001912-exon-sc0000012-1575043694:114254..114312Clytia hemisphaericaexon
TCONS_00001912-exon-sc0000012-1575043694:113854..113937TCONS_00001912-exon-sc0000012-1575043694:113854..113937Clytia hemisphaericaexon
TCONS_00001912-exon-sc0000012-1575043694:113378..113531TCONS_00001912-exon-sc0000012-1575043694:113378..113531Clytia hemisphaericaexon
TCONS_00001912-exon-sc0000012-1575043694:112150..112321TCONS_00001912-exon-sc0000012-1575043694:112150..112321Clytia hemisphaericaexon
TCONS_00001912-exon-sc0000012-1575043694:111614..111969TCONS_00001912-exon-sc0000012-1575043694:111614..111969Clytia hemisphaericaexon
TCONS_00001912-exon-sc0000012-1575043694:111092..111306TCONS_00001912-exon-sc0000012-1575043694:111092..111306Clytia hemisphaericaexon
TCONS_00001912-exon-sc0000012-1575043694:110368..110601TCONS_00001912-exon-sc0000012-1575043694:110368..110601Clytia hemisphaericaexon
TCONS_00001912-exon-sc0000012-1575043694:107479..107700TCONS_00001912-exon-sc0000012-1575043694:107479..107700Clytia hemisphaericaexon
TCONS_00001912-exon-sc0000012-1575043694:106941..107129TCONS_00001912-exon-sc0000012-1575043694:106941..107129Clytia hemisphaericaexon
TCONS_00001912-exon-sc0000012-1575043694:106357..106590TCONS_00001912-exon-sc0000012-1575043694:106357..106590Clytia hemisphaericaexon
TCONS_00001912-exon-sc0000012-1575043694:105977..106114TCONS_00001912-exon-sc0000012-1575043694:105977..106114Clytia hemisphaericaexon
TCONS_00001912-exon-sc0000012-1575043694:105379..105546TCONS_00001912-exon-sc0000012-1575043694:105379..105546Clytia hemisphaericaexon
TCONS_00001912-exon-sc0000012-1575043694:105043..105137TCONS_00001912-exon-sc0000012-1575043694:105043..105137Clytia hemisphaericaexon
TCONS_00001912-exon-sc0000012-1575043694:104487..104739TCONS_00001912-exon-sc0000012-1575043694:104487..104739Clytia hemisphaericaexon
TCONS_00001912-exon-sc0000012-1575043694:104155..104253TCONS_00001912-exon-sc0000012-1575043694:104155..104253Clytia hemisphaericaexon
TCONS_00001912-exon-sc0000012-1575043694:102698..102799TCONS_00001912-exon-sc0000012-1575043694:102698..102799Clytia hemisphaericaexon
TCONS_00001912-exon-sc0000012-1575043694:101986..102108TCONS_00001912-exon-sc0000012-1575043694:101986..102108Clytia hemisphaericaexon
TCONS_00001912-exon-sc0000012-1575043694:100209..100390TCONS_00001912-exon-sc0000012-1575043694:100209..100390Clytia hemisphaericaexon
TCONS_00001912-exon-sc0000012-1510915933:121171..121470TCONS_00001912-exon-sc0000012-1510915933:121171..121470Clytia hemisphaericaexon
TCONS_00001912-exon-sc0000012-1510915933:115414..115504TCONS_00001912-exon-sc0000012-1510915933:115414..115504Clytia hemisphaericaexon
TCONS_00001912-exon-sc0000012-1510915933:114767..115036TCONS_00001912-exon-sc0000012-1510915933:114767..115036Clytia hemisphaericaexon
TCONS_00001912-exon-sc0000012-1510915933:114254..114312TCONS_00001912-exon-sc0000012-1510915933:114254..114312Clytia hemisphaericaexon
TCONS_00001912-exon-sc0000012-1510915933:113854..113937TCONS_00001912-exon-sc0000012-1510915933:113854..113937Clytia hemisphaericaexon
TCONS_00001912-exon-sc0000012-1510915933:113378..113531TCONS_00001912-exon-sc0000012-1510915933:113378..113531Clytia hemisphaericaexon
TCONS_00001912-exon-sc0000012-1510915933:112150..112321TCONS_00001912-exon-sc0000012-1510915933:112150..112321Clytia hemisphaericaexon
TCONS_00001912-exon-sc0000012-1510915933:111614..111969TCONS_00001912-exon-sc0000012-1510915933:111614..111969Clytia hemisphaericaexon
TCONS_00001912-exon-sc0000012-1510915933:111092..111306TCONS_00001912-exon-sc0000012-1510915933:111092..111306Clytia hemisphaericaexon
TCONS_00001912-exon-sc0000012-1510915933:110368..110601TCONS_00001912-exon-sc0000012-1510915933:110368..110601Clytia hemisphaericaexon
TCONS_00001912-exon-sc0000012-1510915933:107479..107700TCONS_00001912-exon-sc0000012-1510915933:107479..107700Clytia hemisphaericaexon
TCONS_00001912-exon-sc0000012-1510915933:106941..107129TCONS_00001912-exon-sc0000012-1510915933:106941..107129Clytia hemisphaericaexon
TCONS_00001912-exon-sc0000012-1510915933:106357..106590TCONS_00001912-exon-sc0000012-1510915933:106357..106590Clytia hemisphaericaexon
TCONS_00001912-exon-sc0000012-1510915933:105977..106114TCONS_00001912-exon-sc0000012-1510915933:105977..106114Clytia hemisphaericaexon
TCONS_00001912-exon-sc0000012-1510915933:105379..105546TCONS_00001912-exon-sc0000012-1510915933:105379..105546Clytia hemisphaericaexon
TCONS_00001912-exon-sc0000012-1510915933:105043..105137TCONS_00001912-exon-sc0000012-1510915933:105043..105137Clytia hemisphaericaexon
TCONS_00001912-exon-sc0000012-1510915933:104487..104739TCONS_00001912-exon-sc0000012-1510915933:104487..104739Clytia hemisphaericaexon
TCONS_00001912-exon-sc0000012-1510915933:104155..104253TCONS_00001912-exon-sc0000012-1510915933:104155..104253Clytia hemisphaericaexon
TCONS_00001912-exon-sc0000012-1510915933:102698..102799TCONS_00001912-exon-sc0000012-1510915933:102698..102799Clytia hemisphaericaexon
TCONS_00001912-exon-sc0000012-1510915933:101986..102108TCONS_00001912-exon-sc0000012-1510915933:101986..102108Clytia hemisphaericaexon
TCONS_00001912-exon-sc0000012-1510915933:100209..100390TCONS_00001912-exon-sc0000012-1510915933:100209..100390Clytia hemisphaericaexon
TCONS_00001912-exon-sc0000012-1491911889:121171..121470TCONS_00001912-exon-sc0000012-1491911889:121171..121470Clytia hemisphaericaexon
TCONS_00001912-exon-sc0000012-1491911889:115414..115504TCONS_00001912-exon-sc0000012-1491911889:115414..115504Clytia hemisphaericaexon
TCONS_00001912-exon-sc0000012-1491911889:114767..115036TCONS_00001912-exon-sc0000012-1491911889:114767..115036Clytia hemisphaericaexon
TCONS_00001912-exon-sc0000012-1491911889:114254..114312TCONS_00001912-exon-sc0000012-1491911889:114254..114312Clytia hemisphaericaexon
TCONS_00001912-exon-sc0000012-1491911889:113854..113937TCONS_00001912-exon-sc0000012-1491911889:113854..113937Clytia hemisphaericaexon
TCONS_00001912-exon-sc0000012-1491911889:113378..113531TCONS_00001912-exon-sc0000012-1491911889:113378..113531Clytia hemisphaericaexon
TCONS_00001912-exon-sc0000012-1491911889:112150..112321TCONS_00001912-exon-sc0000012-1491911889:112150..112321Clytia hemisphaericaexon
TCONS_00001912-exon-sc0000012-1491911889:111614..111969TCONS_00001912-exon-sc0000012-1491911889:111614..111969Clytia hemisphaericaexon
TCONS_00001912-exon-sc0000012-1491911889:111092..111306TCONS_00001912-exon-sc0000012-1491911889:111092..111306Clytia hemisphaericaexon
TCONS_00001912-exon-sc0000012-1491911889:110368..110601TCONS_00001912-exon-sc0000012-1491911889:110368..110601Clytia hemisphaericaexon
TCONS_00001912-exon-sc0000012-1491911889:107479..107700TCONS_00001912-exon-sc0000012-1491911889:107479..107700Clytia hemisphaericaexon
TCONS_00001912-exon-sc0000012-1491911889:106941..107129TCONS_00001912-exon-sc0000012-1491911889:106941..107129Clytia hemisphaericaexon
TCONS_00001912-exon-sc0000012-1491911889:106357..106590TCONS_00001912-exon-sc0000012-1491911889:106357..106590Clytia hemisphaericaexon
TCONS_00001912-exon-sc0000012-1491911889:105977..106114TCONS_00001912-exon-sc0000012-1491911889:105977..106114Clytia hemisphaericaexon
TCONS_00001912-exon-sc0000012-1491911889:105379..105546TCONS_00001912-exon-sc0000012-1491911889:105379..105546Clytia hemisphaericaexon
TCONS_00001912-exon-sc0000012-1491911889:105043..105137TCONS_00001912-exon-sc0000012-1491911889:105043..105137Clytia hemisphaericaexon
TCONS_00001912-exon-sc0000012-1491911889:104487..104739TCONS_00001912-exon-sc0000012-1491911889:104487..104739Clytia hemisphaericaexon
TCONS_00001912-exon-sc0000012-1491911889:104155..104253TCONS_00001912-exon-sc0000012-1491911889:104155..104253Clytia hemisphaericaexon
TCONS_00001912-exon-sc0000012-1491911889:102698..102799TCONS_00001912-exon-sc0000012-1491911889:102698..102799Clytia hemisphaericaexon
TCONS_00001912-exon-sc0000012-1491911889:101986..102108TCONS_00001912-exon-sc0000012-1491911889:101986..102108Clytia hemisphaericaexon
TCONS_00001912-exon-sc0000012-1491911889:100209..100390TCONS_00001912-exon-sc0000012-1491911889:100209..100390Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000012supercontigsc0000012:100209..121470 -
Expression
No biomaterial libraries express this feature.
Blast
BLAST of TCONS_00001912 vs. Swiss-Prot (Human)
Match: PYR1 (CAD protein OS=Homo sapiens GN=CAD PE=1 SV=3)

HSP 1 Score: 1456.04 bits (3768), Expect = 0.000e+0
Identity = 743/1145 (64.89%), Postives = 897/1145 (78.34%), Query Frame = 1
Query:  310 MATLILDDGTKYHGQIFGDERSIAGEVVFQTGMVGYPESLTDPSYNSQILVLTYPLIGNYGIPNDSRDEHGMLKFFESEKIWNNGMIVGDLTEDYSHWLATKSLSEWLKEHKIPGITGIDTRALTKKLRENGTMLGKIVLDGEDEASVPFDDPNKRNLIAEVSCKEPKLYNPKGKIKMIAVDFGIKYNQIRCLIDCDCQVLVVPWDYDYSTLLKNKEYDGLFMSNGPGDPSLCQVSIDTLRKVITELPDVPVFGICMGHQILSLAAGCGSYKMKYGNRGHNQPATHLETQRCFITCQNHGFAIDTDSLPKEWSVLFTNENDGSNEGIVHNTKPIFSVQFHPEHQGGPRDLELLFGFFVDIVNKLKIDS--NLCLRTMLKETLTFHPAEETRSRAFKPKKVXXXXXXXXXXXQAGEFDYSGSQAIKALKEEKIHTVLINPNIATVQTSKGLADKTYFLPVNFEFTSKVIEVERPDGILLSFGGQTALNCGLLLKERGILEKYNVAVLGTPTKSIEWTEDRKMFSDKMGEIGEKVAPSSVAYTVDEAITAANRLGYPVXXXXXXXXXXXXXXXXXNDNELKKLAASAFAHSKQCLVDKSLKGWKEVEYEVVRDAYDNCITVCNMENFDPLGIHTGESIVVAPSQTLTNEEYNMLRRTAIKVIRKLGVVGECNIQYALHPDSKEFYIIEVNXXXXXXXXXXXXXTGYPLAYVAAKLALGIPLPKLRNSVTNSTTACFEPSLDYCVVKVPRWDLDKFQRVSTKIGSSMKSVGEVMAIGRSFEEAIQKSLRMVDDSNLGFDANNLELDEQVLVEPSDKRIFHVAAALRRGYSIDQLYELTRIDKWFLSKLAKIINYAKMLEEKYPKVGAGKDTIPCNILLKGKQLGFSDKQIANCVQSSELVIRKYRYECNILPCFKQIDTVAAEFPAEANYLYLTYNGDCDDVTYAESQNKVMVIGSGVYRIGSSVEFDACAVGCIRELKRLGKSTIMVNYNPETVSTDYDECDRLYFDEITFETIMDIYHKEDPEGIILSMGGQVANNIAMHLHRQEVRILGTSPEMIDNAENRFKFSRMLDNIGILQPTWKELTTMEEAYQFCTKVGYPVLVRPSYVLSGAAMNVVYAEDDLESYLGSAVSISKEHPVVISKFISNA 3738
            MA L+L+DG+   GQ FG   S AGEVVFQTGMVGYPE+LTDPSY +QILVLTYPLIGNYGIP D  DE G+ K+FES  I    ++VG+     SHW AT++L EWL++H IPG+ G+DTR LTKKLRE G++LGK+V +G + +S+PF DPN R L+ EVS K P+++N  G  +++A+D G+KYNQIRCL     +V VVPWD+     L ++EY+GLF+SNGPGDP+     + TL +V++E    PVFGIC+GHQ+L+LA G  +YKM+YGNRGHNQP   + + RCF+T QNHGFA++TDSLP +W+ LFTN NDGSNEGIVHN+ P FSVQFHPEHQ GP D+ELLF  F++ V +    +     +R  L E L         S    P+KVLILGSGGLSIGQAGEFDYSGSQAIKALKEE I T+LINPNIATVQTS+GLADK YFLP+   + ++VI  ERPDG+LL+FGGQTALNCG+ L + G+L +Y V VLGTP ++IE TEDR+ F+ +M EIGE VAPS  A ++++A  AA RLGYPVL+RAAFALGGLGSGFASN  EL  L A AFAH+ Q LVDKSLKGWKE+EYEVVRDAY NC+TVCNMEN DPLGIHTGESIVVAPSQTL + EY +LR+TAIKV + LG+VGECN+QYAL+P+S+++YIIEVNARLSRSSALASKATGYPLAYVAAKLALGIPLP+LRNSVT  T A FEPS+DYCVVK+PRWDL KF RVSTKIGS MKSVGEVM IGRSFEEA QK+LRMVD++ +GFD     + +  L  P+DKRIF VAAAL  GYS+D+LYELTRID+WFL ++ +II +A++LE+           +P ++L + K LGFSDKQIA  V S+EL +RK R E  I P  KQIDTVAAE+PA+ NYLYLTY G   D+T+      V+V+GSGVYRIGSSVEFD CAVGCI++L+++G  TIMVNYNPETVSTDYD CDRLYFDEI+FE +MDIY  E+PEG+ILSMGGQ+ NN+AM LHRQ+ R+LGTSPE ID+AENRFKFSR+LD IGI QP W+EL+ +E A QFC  VGYP +VRPSYVLSGAAMNV Y + DLE +L SA ++SKEHPVVISKFI  A
Sbjct:    1 MAALVLEDGSVLRGQPFGAAVSTAGEVVFQTGMVGYPEALTDPSYKAQILVLTYPLIGNYGIPPDEMDEFGLCKWFESSGIHVAALVVGECCPTPSHWSATRTLHEWLQQHGIPGLQGVDTRELTKKLREQGSLLGKLVQNGTEPSSLPFLDPNARPLVPEVSIKTPRVFNTGGAPRILALDCGLKYNQIRCLCQRGAEVTVVPWDHA----LDSQEYEGLFLSNGPGDPASYPSVVSTLSRVLSEPNPRPVFGICLGHQLLALAIGAKTYKMRYGNRGHNQPCLLVGSGRCFLTSQNHGFAVETDSLPADWAPLFTNANDGSNEGIVHNSLPFFSVQFHPEHQAGPSDMELLFDIFLETVKEATAGNPGGQTVRERLTERLCPPGIPTPGSGLPPPRKVLILGSGGLSIGQAGEFDYSGSQAIKALKEENIQTLLINPNIATVQTSQGLADKVYFLPITPHYVTQVIRNERPDGVLLTFGGQTALNCGVELTKAGVLARYGVRVLGTPVETIELTEDRRAFAARMAEIGEHVAPSEAANSLEQAQAAAERLGYPVLVRAAFALGGLGSGFASNREELSALVAPAFAHTSQVLVDKSLKGWKEIEYEVVRDAYGNCVTVCNMENLDPLGIHTGESIVVAPSQTLNDREYQLLRQTAIKVTQHLGIVGECNVQYALNPESEQYYIIEVNARLSRSSALASKATGYPLAYVAAKLALGIPLPELRNSVTGGT-AAFEPSVDYCVVKIPRWDLSKFLRVSTKIGSCMKSVGEVMGIGRSFEEAFQKALRMVDENCVGFDHTVKPVSDMELETPTDKRIFVVAAALWAGYSVDRLYELTRIDRWFLHRMKRIIAHAQLLEQHR------GQPLPPDLLQQAKCLGFSDKQIALAVLSTELAVRKLRQELGICPAVKQIDTVAAEWPAQTNYLYLTYWGTTHDLTFRTPH--VLVLGSGVYRIGSSVEFDWCAVGCIQQLRKMGYKTIMVNYNPETVSTDYDMCDRLYFDEISFEVVMDIYELENPEGVILSMGGQLPNNMAMALHRQQCRVLGTSPEAIDSAENRFKFSRLLDTIGISQPQWRELSDLESARQFCQTVGYPCVVRPSYVLSGAAMNVAYTDGDLERFLSSAAAVSKEHPVVISKFIQEA 1132          

HSP 2 Score: 113.62 bits (283), Expect = 5.162e-25
Identity = 104/374 (27.81%), Postives = 178/374 (47.59%), Query Frame = 1
Query: 1546 EFDYSGSQAIKALKEEKIHTVLINPNIATVQTSKGLADKTYFLPVNFEFTSKVIEVERPDGILLSFGGQTALNCGLLLKERGILEKYNVAVLGTPTKSIEWTEDRKMFSDKMGEIGEKVAPSSVAYTVDEAITAANRLGYPVXXXXXXXXXXXXXXXXXNDNELKKLAASAFAHSKQ--CLVDKSLKGWKEVEYEVVRDAYDNCITVCNM-ENFDPLGIHTGESIVVAPSQTLTNEEYNMLRRTAIKVIRKLGVVGECNIQYALHPDSKEFYIIEVNXXXXXXXXXXXXXTGYPLAYVAAKLALGIPLPKLRNSVTNSTTACFEPSLDYCVVKVPRWDLDKFQRVSTKIGSSMKSVGEVMAIGRSFEEAIQKSL 2658
            EFD+     I+ L++    T+++N N  TV T   + D+ YF  ++FE    + E+E P+G++LS GGQ   N  +       L +    VLGT  ++I+  E+R  FS  +  IG           ++ A      +GYP ++R ++ L G     A  D +L++  +SA A SK+   ++ K ++  KE++ + V  A D  +    + E+ +  G+H+G++ +V P Q +T +    ++     V ++L V G  N+Q     D  +  +IE N R+SRS    SK  G  L  +A ++ +G  +  +   +T S             VKVP++   +       +G  M S GEV   G S  EA  K++
Sbjct:  950 EFDWCAVGCIQQLRKMGYKTIMVNYNPETVSTDYDMCDRLYFDEISFEVVMDIYELENPEGVILSMGGQLPNNMAM------ALHRQQCRVLGTSPEAIDSAENRFKFSRLLDTIGISQPQWRELSDLESARQFCQTVGYPCVVRPSYVLSGAAMNVAYTDGDLERFLSSAAAVSKEHPVVISKFIQEAKEIDVDAV--ASDGVVAAIAISEHVENAGVHSGDATLVTPPQDITAKTLERIKAIVHAVGQELQVTGPFNLQLIAKDD--QLKVIECNVRVSRSFPFVSKTLGVDLVALATRVIMGEEVEPV-GLMTGSGVVG---------VKVPQFSFSRLAGADVVLGVEMTSTGEVAGFGESRCEAYLKAM 1303          
The following BLAST results are available for this feature:
BLAST of TCONS_00001912 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
PYR15.162e-2564.89CAD protein OS=Homo sapiens GN=CAD PE=1 SV=3[more]
back to top