Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001908 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001908
Unique NameTCONS_00001908
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1959

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001908 ID=TCONS_00001908|Name=TCONS_00001908|organism=Clytia hemisphaerica|type=transcript|length=1959bp
AGAGAGGGGAATTTTAGAGAAATACAATGTTGCTGTTCTTGGTACACCTA
CCAAATCGATTGAATGGACAGAAGATAGGAAAATGTTTTCAGACAAGATG
GGAGAGATTGGTGAGAAAGTTGCACCAAGCTCAGTGGCTTATACTGTGGA
TGAGGCTATCACAGCAGCTAACAGGCTAGGATATCCAGTGTTGTTACGTG
CAGCATTTGCACTAGGTGGACTTGGATCTGGTTTTGCTTCCAATGACAAT
GAGCTCAAAAAGCTTGCAGCATCGGCTTTTGCACATTCCAAACAGTGTCT
AGTTGACAAGTCACTGAAAGGATGGAAAGAAGTTGAATATGAAGTTGTTA
GAGATGCTTATGACAACTGTATCACTGTTTGTAATATGGAAAACTTTGAC
CCTTTGGGAATCCATACGGGTGAATCAATTGTTGTTGCACCAAGTCAAAC
ACTAACAAATGAGGAATACAATATGCTTAGAAGAACAGCCATCAAAGTCA
TCCGTAAACTTGGTGTTGTTGGTGAATGTAACATCCAGTATGCTTTACAC
CCTGACTCAAAAGAGTTCTACATCATTGAGGTCAATGCTCGTCTCTCCAG
AAGTTCAGCTCTTGCTTCCAAAGCAACTGGATACCCATTGGCTTACGTTG
CTGCTAAACTTGCACTTGGTATTCCTCTACCAAAACTGAGAAATTCTGTC
ACCAATTCAACTACCGCTTGTTTTGAGCCCTCTTTGGATTATTGTGTTGT
GAAAGTTCCTCGATGGGATCTGGACAAATTTCAGAGGGTTTCAACAAAGA
TTGGATCTTCGATGAAGAGTGTTGGTGAAGTAATGGCTATTGGAAGAAGT
TTTGAGGAAGCCATTCAAAAGAGTTTGAGAATGGTTGACGATTCAAACCT
TGGTTTTGATGCAAACAACCTCGAGTTGGATGAACAGGTCTTAGTTGAGC
CCTCTGACAAAAGAATCTTTCATGTTGCTGCTGCACTCCGTAGAGGATAT
TCTATTGATCAGCTGTATGAGCTCACTCGTATTGATAAGTGGTTTTTGAG
CAAGCTAGCAAAAATAATCAACTATGCAAAAATGCTGGAAGAGAAATACC
CAAAGGTTGGAGCTGGAAAGGACACCATTCCATGCAATATCCTACTGAAG
GGGAAGCAGCTTGGATTTTCAGATAAGCAAATTGCTAACTGCGTTCAAAG
TTCTGAACTGGTTATCCGCAAGTACCGTTATGAATGCAACATTTTGCCCT
GTTTCAAGCAAATTGACACTGTTGCTGCAGAATTCCCAGCTGAAGCTAAC
TATCTGTATTTAACTTACAATGGAGattgtgatgacgtcacatacGCAGA
AAGCCAAAACAAAGTCATGGTTATTGGGTCAGGTGTCTACAGAATCGGAA
GCAGTGTTGAATTTGATGCATGTGCTGTTGGATGTATTCGAGAATTGAAG
AGGCTTGGTAAGAGCACAATTATGGTGAATTACAATCCTGAAACTGTCAG
TACAGACTATGATGAATGTGATCGATTGTACTTCGATGAAATCACATTTG
AGACAATCATGGATATCTACCATAAAGAAGACCCAGAAGGTATTATCTTA
TCAATGGGAGGACAGGTTGCCAACAACATTGCTATGCATCTCCACAGACA
GGAAGTGAGGATCCTTGGCACATCGCCAGAAATGATTGACAACGCTGAAA
ACAGATTCAAATTCTCTCGTATGCTAGACAACATTGGAATCCTACAACCA
ACATGGAAAGAGTTGACCACGATGGAGGAAGCCTATCAATTCTGCACCAA
AGTTGGTTACCCAGTGCTGGTACGACCTTCATACGTGTTGAGTGGAGCTG
CCATGAATGTTGTTTATGCTGAAGATGATTTAGAATCATATCTTGGATCT
GCTGTCTCCATCTCTAAGGAGCATCCAGTTGTCATCTCCAAATTTATATC
CAATGCTAA
Run BLAST on NCBI

transcript from alignment at sc0000012:100209..108100-

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001908 ID=TCONS_00001908|Name=TCONS_00001908|organism=Clytia hemisphaerica|type=transcript|length=7892bp|location=Sequence derived from alignment at sc0000012:100209..108100- (Clytia hemisphaerica)
AGAGAGGGGAATTTTAGAGAAATACAATGTTGCTGTTCTTGGTACACCTA CCAAATCGATTGAATGGACAGAAGATAGGAAAATGTTTTCAGACAAGATG GGAGAGATTGGTGAGAAAGTTGCACCAAGCTCAGTGGCTTATACTGTGGA TGAGGTGAGTAATTTCTTTTGAAAAAAATAGAAAAAATAGTTATTCATAA TTTCTTATGTTTGCTTTATAAAAAAATTCAAAGGTTGCATTTTTTGGTTC TCAGAAAGTCTCCTTCTTATAAAAATATAGTTGATTCAATGATCCTCACT CTCTGATCCACAGCCAAGCCACCAGTTGAGCATGCTCAATTCAGTTGCTT ACTATAGAAATATGCTCTTGGTTTTCATATGCTTTTCATTATATTTTTAG GCTATCACAGCAGCTAACAGGCTAGGATATCCAGTGTTGTTACGTGCAGC ATTTGCACTAGGTGGACTTGGATCTGGTTTTGCTTCCAATGACAATGAGC TCAAAAAGCTTGCAGCATCGGCTTTTGCACATTCCAAACAGTGTCTAGTT GACAAGTCACTGAAAGGATGGAAAGAAGTTGAATATGAAGTTGTTAGAGA TGCTTATGACAACTGTATCACTGTAAGTTATTCTTTTGAAGGAGTTTCAA TTAGTTATTCTATTCTATTCTTTGTCTGTAAACAGCGTTTGTCTTTTGGA AATTAATGCATTCTTTTAGGAAGTATATTCGTAATAATTTCAATAGTGGG CTTCCCCATTTTTGATTTTCTGCTTTTTGAAAAAAGGTTCGGGTTGGAGG TGGTGATGTCCCAATTTAAATATTCTGCCCAAACAAAATAAGTTTACAAT ACGAATTTGAAGATGATGCCCATAATTTGTGAAATATCTTAGGAAGGGTA TATTCTCTGTTACTTAAAAGCCCTCAGCTTTAAACTTGTGTTTGATTACA AATAAGCTATATGTTTTCCAGGTTTGTAATATGGAAAACTTTGACCCTTT GGGAATCCATACGGGTGAATCAATTGTTGTTGCACCAAGTCAAACACTAA CAAATGAGGAATACAATATGCTTAGAAGAACAGCCATCAAAGTCATCCGT AAACTTGGTGTTGTTGGTGAATGTAACATCCAGTATGCTTTACACCCTGA CTCAAAAGAGGTACAAGTACTTGACCACTTGAGCAGACTGGAACACTTTT ACCCCTTTACCCCAATGAAACCTTCTTTTATACATTTGCTTGTTACAGCA TCTCAAAAAGACTTGTTTTGTGGTGACTCAATTTTCCTTTCTTTGTCTTT ATTTTGTTCAATTTCTTCAATCCCAGAAGAGAAACACTTGCTGATTATCA ATTTATCTTTATTTGTTTTTGTCAATCAGACTTTGATTAGACACTTAGAC ACAAAAACCTTTTGCATCATTGGTAAATGAATTTCTAATTTTTGGTTTTG AAACAAAGAATTAAAGCATAATATTTCTGAATCTTAATATTGCATCAACC TTTTTTATAGTTCTACATCATTGAGGTCAATGCTCGTCTCTCCAGAAGTT CAGCTCTTGCTTCCAAAGCAACTGGATACCCATTGGCTTACGTTGCTGCT AAACTTGCACTTGGTATTCCTCTACCAAAACTGAGAAATTCTGTCACCAA TTCAACTACCGCTTGTTTTGAGCCCTCTTTGGATTATTGTGTTGTGAAAG TTCCTCGATGGGATCTGGACAAATTTCAGAGGGTTTCAACAAAGGTGATT TGATTGTTTTGATATCGTGTACCAAAATCCATATTATATGAAAGGAGATT TGTTTTTGACTGAACCAGTAGTTGATTAACATCCAATGCATATGGAAAAG TTTGACAGTTGATATAGATCTATTCTGGTTAAACCAAAGCCAAAATTGTA GCAGCCTTTCGATTTATAAATTTATCTTGGAATCAGGTGTGAAGTTTTGT ACCTTTTTCTTTTCTAATGCCATTTGTGTTTTTTAGATTGGATCTTCGAT GAAGAGTGTTGGTGAAGTAATGGCTATTGGAAGAAGTTTTGAGGAAGCCA TTCAAAAGAGTTTGAGAATGGTTGACGATTCAAACCTTGGTTTTGATGCA AACAACCTCGAGTTGGATGAACAGGTATCTCCTGAAGTTTATCAGTCAAT TTCTTTTTTAGTCTATTATATTACAGCTTAAAAACAGGCTTAATCTTTTT CTCACAAGATTCGAACAAAATGTAAGAGTTGGTCCAATAAGGTTCTCCAG TGTCTGGTGCTTGTTACCTAATCTAGGAAGATACCTTTTTCTTCGACTAA TAGAAAAATCTTTACTGTAATTGTCACTACAATTTATCTTTTGAAAAAAA AATCACATAATGTATCCTTTAAAGCAGTTCTAGTTATTATACTTACCTTG CTTCAATTTTCGGTCATTTGTTTCTCAATCAAAATTTGGTTAAATGCCTA GGTATCTAAAAATTATCTGCAATGGTTTACAATGTGACGTTTCCAATGGA ATATATATGATTGGAAGATTTATGATTAACTTGACTTTCTGCCAATTCTC TTAGGTCTTAGTTGAGCCCTCTGACAAAAGAATCTTTCATGTTGCTGCTG CACTCCGTAGAGGATATTCTATTGATCAGCTGTATGAGCTCACTCGTATT GATAAGTGGTTTTTGAGCAAGCTAGCAAAAATAATCAACTATGCAAAAAT GCTGGAAGAGAAATACCCAAAGGTAAAAGTTTTTATGAAATTTGACTTTT TTGTCCTAGGTTCTCTGTAACTCTTCTTTTTTGGCAGGGTTTGGAAGCTT AGTTGAGTTTGTCTGCGGTCATTCATTATCATGATTTTAACAGAAAAAAA CAGTATTTCGGAATAAAAGCAGGTAAACCAATTGCTTAATTTGGTTACTA ACATAAGCTGAAAATGATTTTCTTCTTCAGAAAATCACGATAAATATTCT TTATTGTTTTTAGGTTGGAGCTGGAAAGGACACCATTCCATGCAATATCC TACTGAAGGGGAAGCAGCTTGGATTTTCAGATAAGCAAATTGCTAACTGC GTTCAAAGGTTGTGACTTTATCTTTTAGATTTTACTACTTGACCATTTTA TGTACTTAAACTTAGATTGAGTCAGATTAATTAAATTTTCTAGACTTTAC AAATAAAACTTCTTTAAAGAGTTCTTCAACGTCTTAGCCTAGTGAATCGG CGATGCCAGGATCAAACCGCTACTTCATCTTCTTGCTCTACTCTGATAAC CGAACTTAATACTCTGCAAAAGAGTAGTCCAAAGTGAGTGGATTATGAGT TCAACATTATGGAATGCAGACTAAGATTTATCAACTTGAACTTGAATGTT TTTCTCTTCAGTTCTGAACTGGTTATTCGCAAGTACCGTTATGAATGCAA CATTTTGCCCTGTTTCAAGCAAATTGACACTGTTGCTGCAGAATTCCCAG CTGAAGCTAACTATCTGTATTTAACTTACAATGGAGATTGTGATGACGTC ACATACGCAGAAAGCCAAAACAAAGTCATGGTTATTGGGTCAGGTGTCTA CAGAATCGGAAGCAGTGTTGAATTTGATGCATGTGCTGTTGGATGTATTC GAGAATTGAAGAGGGTAAGTATAGAAATGATTCTTAAGTCAAATCAACTC AACGACTTAAGCTACCAAAATTACTTTGAAAAGTTCCTAAAGTTTGACCG AAGATATTCCTCCAATGTTACTTGCTCTTGAGTAATTGACCGTGCATTCC CCTGTAATGTACATTGGGCTCCAGTCTTCCCCATCATATTTCTTGCAGTT ACATTATTAGCTATTCAACTTTCCACCCTACATATTCTCTATTTCAGCTT GGTAAGAGCACAATTATGGTGAATTACAATCCTGAAACTGTCAGTACAGA CTATGATGAATGTGATCGATTGTACTTCGATGAAATCACATTTGAGGTAA TTCTTTATCAACCGATAATTCAAATTGTCATTTTNTTCTGCGGTCATTCA TTATCATGATTTTAACAGAAAAAAACAGTATTTCGGAATAAAAGCAGGTA AACCAATAGCTTAATTTGGTTACTAACATAAGCTGAAAATGATTTTCTTC TTCAGAAAATCACGATAAATATTCTTTATTGTTTTTAGGTTGGAGCTGGA AAGGACACCATTCCATGCAATATCCTACTGAAGGGGAAGCAGCTTGGATT TTCAGATAAGCAAATTGCTAACTGCGTTCAAAGGTTGTGACTTTATCTTT AGACTTAGACTTAAACTTAGATTGAGTCAGATTAATTAAATTTTCTAGAC TTTACAAATAAAATTTCTTTAAAGAGTTCTTCAACGTCTTAGCCTAGTGA ATCGGCGATGCCAGGATCAAACCGCTACTTCATCTTCTTGCTCTACTCTG ATAACCGAACTTAATACGCTGCAAAAGAGTAGTCCAAAGTAAGTGGATTA TGAGTTCAACATTATGGAATGCAGACTAAGATTTATCAACTTGAACTTGA ATGTTTTTCTCTTCAGTTCTGAACTGGTTATCCGCAAGTACCGTTATGAA TGCAACATTTTGCCCTGTTTCAAGCAAATTGACACTGTTGCTGCAGAATT CCCAGCTGAAGCTAACTATCTGTATTTAACTTACAATGGAGATTGTGATG ACGTCACATACGCAGAAAGCCAAAACAAAGTCATGGTTATTGGGTCAGGT GTCTACAGAATCGGAAGCAGTGTTGAATTTGATGCATGTGCTGTTGGATG TATTCGAGAATTGAAGAGGGTAAGTATAGAAATGATTCTTAAGTCAAATC AACTCAACGACTTAAGCTACCAAAATTACTTTGAAAAGTTCCTAAAGTTT GACCGAAGATATTCCTCCAATGTTACTTGCTCTTGAGTAATTGACCGTGC ATTCCCCTGTAATGTACATTGGGCTCCAGTCTTCCCCATCATATTTCTTG CAGTTACATTATTAGCTATTCAACTTTCCACCCTACATATTCTCTATTTC AGCTTGGTAAGAGCACAATTATGGTGAATTACAATCCTGAAACTGTCAGT ACAGACTATGATGAATGTGATCGATTGTACTTCGATGAAATCACATTTGA GGTAATTCTTTATCAACCGATAATTCAAATTGTCATTTTTCTGTTAACCC TGAAAGCTGACAAGGTATTTGCTAATTTTAGTCCTAACTATTTCAAAGAG TCCCTGTGACTAATTCAACCTGCCTTCAAACCAAACAGATGACCTAAACA GATTGAACAGAACTTTAGAAATCATCAAAACACGACTTGTCTTTTTTCCA GACAATCATGGATATCTACCATAAAGAAGACCCAGAAGGTATTATCTTAT CAATGGGAGGACAGGTTGCCAACAACATTGCTATGCATCTCCACAGACAG GAAGTAAGGCTTTAACATCTGAAAACATTTACCAGAGTTCAGAAATTATC CAAATAATATTCACATTCCTCATGTTTACTTTAATCTTCTTGCTACCCCC AATGTTTGTTTATAATTTGGAAAGTTCCCCTGGATGTTTGTCTATTTTTA AGAGTTTCCTTACAATCTTCATGTAATTGTAATGGAAATGGTAATGTCTT GGAAAAATATTATGACCAAAAACGTCATGTCATTTTTACTAAGATATTTG TTTTTCCATTAGGTGAGGATCCTTGGCACATCGCCAGAAATGATTGACAA CGCTGAAAACAGATTCAAATTCTCTCGTATGCTAGACAACATTGGAATCC TACAACCAACATGGAAAGAGTTGACCACGATGGAGGTGAGCTCATCAGTT ATTCATAATGCACCTATCAAACCTTGAACTTTGGTCTTACTTACTTAAAA TGGATGTCTGTGTTTATTGCTTTTTATTGCTGATATGCCATCAAATACAG AATATCTAACCCTGANAATATTATGGTCTTGGAAAAATATTATGACCAAA AACGTCACGTCATTTTTACTAAGATATTTGTTTTTCCATTAGGTGAGGAT CCTTGGCACATCGCCAGAAATGATTGACAACGCTGAAAACAGATTCAAAT TCTCTCGTATGCTAGACAACATTGGAATCCTACAACCAACATGGAAAGAG TTGACCACGATGGAGGTGAGCTCATCAGTTATTCATAATGCACCTATCAA ACCTTGAACTTTGGTCTTACTTACTTAAAATGGATGTCTGTGTTTATTGC TTTTNTGATCGATTGTACTTCGATGAGATCACATTTGAGGTAATTCTTTA TCAACCGATAATTCAAATTGTCATTTTTCTGTTAACCCTGAAAGCTGACA TGGTATTTGCTAATTTTAGTCCTAACTATTTCAAAGAGTCCCTGTGACTA ATTCAACCTGCCTTCAAACCAAACAGATGACCTAAACAGATTGAACAGAA CTTTAGAAATCATCAAAACACGACTTGTCTTTTTTCCAGACAATCATGGA TATCTACCATAAAGAAGACCCAGAAGGTATTATCTTATCAATGGGAGGAC AGGTTGCCAACAACATTGCTATGCATCTCCACAGACAGGAAGTAAGGCTT TAACATCTGAAAACATTTACCAGAGTTCAGAAATTATCCAAATAATATTC ACATTCCTCATGTTTACTTTAATCTTCTTGCTACCCCCAATGTTTGTTTA TAATTTGGAAAGTTCCCCTGGATGTTTGTCTATTTTTAAGAGTTTCCTTA CAATCTTCATGTAATTGTAATGGAAATGGTAAAATATTATGGTCTTGGAA AAATATTATGACCAAAAACGTCACGTCATTTTTACTAAGATATTTGTTTT TCCATTAGGTGAGGATCCTTGGCACATCGCCAGAAATGATTGACAACGCT GAAAACAGATTCAAATTCTCTCGTATGCTAGACAACATTGGAATCCTACA ACCAACATGGAAAGAGTTGACCACGATGGAGGTGAGCTCATCAGTTATTC ATAATGCACCTATCAAACCTTGAACTTTGGTCTTACTTACTTAAAATGGA TGTCTGTGTTTATTGTATGGATATGCCATCAAATATAGAATATCTAACCC TGATAAATTCAAACCCAAATCTCTTTGATGGAGTTTGTTACTGTCAACCT TGGTTTGTGTTAGTTAAGTTTCTAATCCCAGATTTTCATTGCATCCTTAT TTAAGTTCTTCACGATTTGCTCTTAGCTATTTTGGATATTCAAACTCTGA ATTTACAGATTTTGCCCGGGGGGACGGTATGTGAGGCAAAAAAAATGGCT TTTAGAATCGCACCCTTACAGTGCAGAAAAAATCGGTGAAATTCATACCC TTACAGTGCATTTTTTCACATTTTAAACTCGTTTAGAGCATGAAAAGATT TTCGAGAAAAAATTAGCAATTTTTCCTAGATTTGCTGAAATTTTCACCCA TACAGTGCATTTATCAAAAGTCCACCCTTACAGTGCATTTCTGATATTTT GAAAAACATACCCTTAACCACCGCACATACCCGTCGGNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCCCCCCCCCCCCACG AGATTTTGCAGACAAAATAATTTACTATTCAGTCATTACCATTTCTGCAT TTTGTTTAAGGAAGCCTATCAATTCTGCACCAAAGTTGGTTACCCAGTGC TGGTACGACCTTCATACGTGTTGAGTGGAGCTGCCATGAATGTTGTTTAT GCTGAAGATGATTTAGAATCATATCTTGGATCTGCTGTCTCCATCTCTAA GGAGCATCCAGTTGTCATCTCCAAATTTATATCCAATGCTAA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000986XLOC_000986Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001908-exon-sc0000012-1575043694:107947..108100TCONS_00001908-exon-sc0000012-1575043694:107947..108100Clytia hemisphaericaexon
TCONS_00001908-exon-sc0000012-1575043694:107479..107700TCONS_00001908-exon-sc0000012-1575043694:107479..107700Clytia hemisphaericaexon
TCONS_00001908-exon-sc0000012-1575043694:106941..107129TCONS_00001908-exon-sc0000012-1575043694:106941..107129Clytia hemisphaericaexon
TCONS_00001908-exon-sc0000012-1575043694:106357..106590TCONS_00001908-exon-sc0000012-1575043694:106357..106590Clytia hemisphaericaexon
TCONS_00001908-exon-sc0000012-1575043694:105977..106114TCONS_00001908-exon-sc0000012-1575043694:105977..106114Clytia hemisphaericaexon
TCONS_00001908-exon-sc0000012-1575043694:105379..105546TCONS_00001908-exon-sc0000012-1575043694:105379..105546Clytia hemisphaericaexon
TCONS_00001908-exon-sc0000012-1575043694:105043..105137TCONS_00001908-exon-sc0000012-1575043694:105043..105137Clytia hemisphaericaexon
TCONS_00001908-exon-sc0000012-1575043694:103332..103584TCONS_00001908-exon-sc0000012-1575043694:103332..103584Clytia hemisphaericaexon
TCONS_00001908-exon-sc0000012-1575043694:103000..103098TCONS_00001908-exon-sc0000012-1575043694:103000..103098Clytia hemisphaericaexon
TCONS_00001908-exon-sc0000012-1575043694:102698..102799TCONS_00001908-exon-sc0000012-1575043694:102698..102799Clytia hemisphaericaexon
TCONS_00001908-exon-sc0000012-1575043694:102341..102438TCONS_00001908-exon-sc0000012-1575043694:102341..102438Clytia hemisphaericaexon
TCONS_00001908-exon-sc0000012-1575043694:101170..101194TCONS_00001908-exon-sc0000012-1575043694:101170..101194Clytia hemisphaericaexon
TCONS_00001908-exon-sc0000012-1575043694:100209..100390TCONS_00001908-exon-sc0000012-1575043694:100209..100390Clytia hemisphaericaexon
TCONS_00001908-exon-sc0000012-1510915933:107947..108100TCONS_00001908-exon-sc0000012-1510915933:107947..108100Clytia hemisphaericaexon
TCONS_00001908-exon-sc0000012-1510915933:107479..107700TCONS_00001908-exon-sc0000012-1510915933:107479..107700Clytia hemisphaericaexon
TCONS_00001908-exon-sc0000012-1510915933:106941..107129TCONS_00001908-exon-sc0000012-1510915933:106941..107129Clytia hemisphaericaexon
TCONS_00001908-exon-sc0000012-1510915933:106357..106590TCONS_00001908-exon-sc0000012-1510915933:106357..106590Clytia hemisphaericaexon
TCONS_00001908-exon-sc0000012-1510915933:105977..106114TCONS_00001908-exon-sc0000012-1510915933:105977..106114Clytia hemisphaericaexon
TCONS_00001908-exon-sc0000012-1510915933:105379..105546TCONS_00001908-exon-sc0000012-1510915933:105379..105546Clytia hemisphaericaexon
TCONS_00001908-exon-sc0000012-1510915933:105043..105137TCONS_00001908-exon-sc0000012-1510915933:105043..105137Clytia hemisphaericaexon
TCONS_00001908-exon-sc0000012-1510915933:103332..103584TCONS_00001908-exon-sc0000012-1510915933:103332..103584Clytia hemisphaericaexon
TCONS_00001908-exon-sc0000012-1510915933:103000..103098TCONS_00001908-exon-sc0000012-1510915933:103000..103098Clytia hemisphaericaexon
TCONS_00001908-exon-sc0000012-1510915933:102698..102799TCONS_00001908-exon-sc0000012-1510915933:102698..102799Clytia hemisphaericaexon
TCONS_00001908-exon-sc0000012-1510915933:102341..102438TCONS_00001908-exon-sc0000012-1510915933:102341..102438Clytia hemisphaericaexon
TCONS_00001908-exon-sc0000012-1510915933:101170..101194TCONS_00001908-exon-sc0000012-1510915933:101170..101194Clytia hemisphaericaexon
TCONS_00001908-exon-sc0000012-1510915933:100209..100390TCONS_00001908-exon-sc0000012-1510915933:100209..100390Clytia hemisphaericaexon
TCONS_00001908-exon-sc0000012-1491911889:107947..108100TCONS_00001908-exon-sc0000012-1491911889:107947..108100Clytia hemisphaericaexon
TCONS_00001908-exon-sc0000012-1491911889:107479..107700TCONS_00001908-exon-sc0000012-1491911889:107479..107700Clytia hemisphaericaexon
TCONS_00001908-exon-sc0000012-1491911889:106941..107129TCONS_00001908-exon-sc0000012-1491911889:106941..107129Clytia hemisphaericaexon
TCONS_00001908-exon-sc0000012-1491911889:106357..106590TCONS_00001908-exon-sc0000012-1491911889:106357..106590Clytia hemisphaericaexon
TCONS_00001908-exon-sc0000012-1491911889:105977..106114TCONS_00001908-exon-sc0000012-1491911889:105977..106114Clytia hemisphaericaexon
TCONS_00001908-exon-sc0000012-1491911889:105379..105546TCONS_00001908-exon-sc0000012-1491911889:105379..105546Clytia hemisphaericaexon
TCONS_00001908-exon-sc0000012-1491911889:105043..105137TCONS_00001908-exon-sc0000012-1491911889:105043..105137Clytia hemisphaericaexon
TCONS_00001908-exon-sc0000012-1491911889:103332..103584TCONS_00001908-exon-sc0000012-1491911889:103332..103584Clytia hemisphaericaexon
TCONS_00001908-exon-sc0000012-1491911889:103000..103098TCONS_00001908-exon-sc0000012-1491911889:103000..103098Clytia hemisphaericaexon
TCONS_00001908-exon-sc0000012-1491911889:102698..102799TCONS_00001908-exon-sc0000012-1491911889:102698..102799Clytia hemisphaericaexon
TCONS_00001908-exon-sc0000012-1491911889:102341..102438TCONS_00001908-exon-sc0000012-1491911889:102341..102438Clytia hemisphaericaexon
TCONS_00001908-exon-sc0000012-1491911889:101170..101194TCONS_00001908-exon-sc0000012-1491911889:101170..101194Clytia hemisphaericaexon
TCONS_00001908-exon-sc0000012-1491911889:100209..100390TCONS_00001908-exon-sc0000012-1491911889:100209..100390Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000012supercontigsc0000012:100209..108100 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0.00470722 0 0 0 0 0 0 0 0 2.86662e-05 0 1.03873e-06 0 0.198605 1.40099e-07 0 1.38543 0 0.054339 0 0.00165877 0.000132489 2.69481e-09 0 0 0 0 6.77501e-05 5.69895e-09 0
Blast
BLAST of TCONS_00001908 vs. Swiss-Prot (Human)
Match: PYR1 (CAD protein OS=Homo sapiens GN=CAD PE=1 SV=3)

HSP 1 Score: 870.922 bits (2249), Expect = 0.000e+0
Identity = 448/650 (68.92%), Postives = 529/650 (81.38%), Query Frame = 2
Query:    8 GILEKYNVAVLGTPTKSIEWTEDRKMFSDKMGEIGEKVAPSSVAYTVDEAITAANRLGYPVXXXXXXXXXXXXXXXXXNDNELKKLAASAFAHSKQCLVDKSLKGWKEVEYEVVRDAYDNCITVCNMENFDPLGIHTGESIVVAPSQTLTNEEYNMLRRTAIKVIRKLGVVGECNIQYALHPDSKEFYIIEVNXXXXXXXXXXXXXTGYPLAYVAAKLALGIPLPKLRNSVTNSTTACFEPSLDYCVVKVPRWDLDKFQRVSTKIGSSMKSVGEVMAIGRSFEEAIQKSLRMVDDSNLGFDANNLELDEQVLVEPSDKRIFHVAAALRRGYSIDQLYELTRIDKWFLSKLAKIINYAKMLEEKYPKVGAGKDTIPCNILLKGKQLGFSDKQIANCVQSSELVIRKYRYECNILPCFKQIDTVAAEFPAEANYLYLTYNGDCDDVTYAESQNKVMVIGSGVYRIGSSVEFDACAVGCIRELKRLGKSTIMVNYNPETVSTDYDECDRLYFDEITFETIMDIYHKEDPEGIILSMGGQVANNIAMHLHRQEVRILGTSPEMIDNAENRFKFSRMLDNIGILQPTWKELTTMEEAYQFCTKVGYPVLVRPSYVLSGAAMNVVYAEDDLESYLGSAVSISKEHPVVISKFISNA 1957
            G+L +Y V VLGTP ++IE TEDR+ F+ +M EIGE VAPS  A ++++A  AA RLGYPVL+RAAFALGGLGSGFASN  EL  L A AFAH+ Q LVDKSLKGWKE+EYEVVRDAY NC+TVCNMEN DPLGIHTGESIVVAPSQTL + EY +LR+TAIKV + LG+VGECN+QYAL+P+S+++YIIEVNARLSRSSALASKATGYPLAYVAAKLALGIPLP+LRNSVT  T A FEPS+DYCVVK+PRWDL KF RVSTKIGS MKSVGEVM IGRSFEEA QK+LRMVD++ +GFD     + +  L  P+DKRIF VAAAL  GYS+D+LYELTRID+WFL ++ +II +A++LE+           +P ++L + K LGFSDKQIA  V S+EL +RK R E  I P  KQIDTVAAE+PA+ NYLYLTY G   D+T+      V+V+GSGVYRIGSSVEFD CAVGCI++L+++G  TIMVNYNPETVSTDYD CDRLYFDEI+FE +MDIY  E+PEG+ILSMGGQ+ NN+AM LHRQ+ R+LGTSPE ID+AENRFKFSR+LD IGI QP W+EL+ +E A QFC  VGYP +VRPSYVLSGAAMNV Y + DLE +L SA ++SKEHPVVISKFI  A
Sbjct:  492 GVLARYGVRVLGTPVETIELTEDRRAFAARMAEIGEHVAPSEAANSLEQAQAAAERLGYPVLVRAAFALGGLGSGFASNREELSALVAPAFAHTSQVLVDKSLKGWKEIEYEVVRDAYGNCVTVCNMENLDPLGIHTGESIVVAPSQTLNDREYQLLRQTAIKVTQHLGIVGECNVQYALNPESEQYYIIEVNARLSRSSALASKATGYPLAYVAAKLALGIPLPELRNSVTGGT-AAFEPSVDYCVVKIPRWDLSKFLRVSTKIGSCMKSVGEVMGIGRSFEEAFQKALRMVDENCVGFDHTVKPVSDMELETPTDKRIFVVAAALWAGYSVDRLYELTRIDRWFLHRMKRIIAHAQLLEQHR------GQPLPPDLLQQAKCLGFSDKQIALAVLSTELAVRKLRQELGICPAVKQIDTVAAEWPAQTNYLYLTYWGTTHDLTFRTPH--VLVLGSGVYRIGSSVEFDWCAVGCIQQLRKMGYKTIMVNYNPETVSTDYDMCDRLYFDEISFEVVMDIYELENPEGVILSMGGQLPNNMAMALHRQQCRVLGTSPEAIDSAENRFKFSRLLDTIGISQPQWRELSDLESARQFCQTVGYPCVVRPSYVLSGAAMNVAYTDGDLERFLSSAAAVSKEHPVVISKFIQEA 1132          

HSP 2 Score: 103.219 bits (256), Expect = 1.815e-22
Identity = 60/194 (30.93%), Postives = 97/194 (50.00%), Query Frame = 2
Query: 1358 NKVMVIGSGVYRIGSSVEFDACAVGCIRELKRLGKSTIMVNYNPETVSTDYDECDRLYFDEITFETIMDIYHKEDPEGIILSMGGQVANNIAMH------LHRQEVRILGTSPEMIDNAENRFKFSRMLDNIGILQPTWKELTTMEEAYQFCTKVGYPVLVRPSYVLSGAAMNVVYAEDDLESYLGSAVSISKE 1921
             KV+++GSG   IG + EFD      I+ LK     T+++N N  TV T     D++YF  IT   +  +   E P+G++L+ GGQ A N  +       L R  VR+LGT  E I+  E+R  F+  +  IG      +   ++E+A     ++GYPVLVR ++ L G         ++L + +  A + + +
Sbjct:  394 RKVLILGSGGLSIGQAGEFDYSGSQAIKALKEENIQTLLINPNIATVQTSQGLADKVYFLPITPHYVTQVIRNERPDGVLLTFGGQTALNCGVELTKAGVLARYGVRVLGTPVETIELTEDRRAFAARMAEIGEHVAPSEAANSLEQAQAAAERLGYPVLVRAAFALGGLGSGFASNREELSALVAPAFAHTSQ 587          
The following BLAST results are available for this feature:
BLAST of TCONS_00001908 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
PYR11.815e-2268.92CAD protein OS=Homo sapiens GN=CAD PE=1 SV=3[more]
back to top