Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001904 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001904
Unique NameTCONS_00001904
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length501

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001904 ID=TCONS_00001904|Name=TCONS_00001904|organism=Clytia hemisphaerica|type=transcript|length=501bp
TAAGAGCACAATTATGGTGAATTACAATCCTGAAACTGTCAGTACAGACT
ATGATGAATGTGATCGATTGTACTTCGATGAAATCACATTTGAGACAATC
ATGGATATCTACCATAAAGAAGACCCAGAAGGTATTATCTTATCAATGGG
AGGACAGGTTGCCAACAACATTGCTATGCATCTCCACAGACAGGAAGTGA
GGATCCTTGGCACATCGCCAGAAATGATTGACAACGCTGAAAACAGATTC
AAATTCTCTCGTATGCTAGACAACATTGGAATCCTACAACCAACATGGAA
AGAGTTGACCACGATGGAGGAAGCCTATCAATTCTGCACCAAAGTTGGTT
ACCCAGTGCTGGTACGACCTTCATACGTGTTGAGTGGAGCTGCCATGAAT
GTTGTTTATGCTGAAGATGATTTAGAATCATATCTTGGATCTGCTGTCTC
CATCTCTAAGGAGCATCCAGTTGTCATCTCCAAATTTATATCCAATGCTA
A
Run BLAST on NCBI

transcript from alignment at sc0000012:100209..104248-

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001904 ID=TCONS_00001904|Name=TCONS_00001904|organism=Clytia hemisphaerica|type=transcript|length=4040bp|location=Sequence derived from alignment at sc0000012:100209..104248- (Clytia hemisphaerica)
TAAGAGCACAATTATGGTGAATTACAATCCTGAAACTGTCAGTACAGACT ATGATGAATGTGATCGATTGTACTTCGATGAAATCACATTTGAGGTAATT CTTTATCAACCGATAATTCAAATTGTCATTTTNTTCTGCGGTCATTCATT ATCATGATTTTAACAGAAAAAAACAGTATTTCGGAATAAAAGCAGGTAAA CCAATAGCTTAATTTGGTTACTAACATAAGCTGAAAATGATTTTCTTCTT CAGAAAATCACGATAAATATTCTTTATTGTTTTTAGGTTGGAGCTGGAAA GGACACCATTCCATGCAATATCCTACTGAAGGGGAAGCAGCTTGGATTTT CAGATAAGCAAATTGCTAACTGCGTTCAAAGGTTGTGACTTTATCTTTAG ACTTAGACTTAAACTTAGATTGAGTCAGATTAATTAAATTTTCTAGACTT TACAAATAAAATTTCTTTAAAGAGTTCTTCAACGTCTTAGCCTAGTGAAT CGGCGATGCCAGGATCAAACCGCTACTTCATCTTCTTGCTCTACTCTGAT AACCGAACTTAATACGCTGCAAAAGAGTAGTCCAAAGTAAGTGGATTATG AGTTCAACATTATGGAATGCAGACTAAGATTTATCAACTTGAACTTGAAT GTTTTTCTCTTCAGTTCTGAACTGGTTATCCGCAAGTACCGTTATGAATG CAACATTTTGCCCTGTTTCAAGCAAATTGACACTGTTGCTGCAGAATTCC CAGCTGAAGCTAACTATCTGTATTTAACTTACAATGGAGATTGTGATGAC GTCACATACGCAGAAAGCCAAAACAAAGTCATGGTTATTGGGTCAGGTGT CTACAGAATCGGAAGCAGTGTTGAATTTGATGCATGTGCTGTTGGATGTA TTCGAGAATTGAAGAGGGTAAGTATAGAAATGATTCTTAAGTCAAATCAA CTCAACGACTTAAGCTACCAAAATTACTTTGAAAAGTTCCTAAAGTTTGA CCGAAGATATTCCTCCAATGTTACTTGCTCTTGAGTAATTGACCGTGCAT TCCCCTGTAATGTACATTGGGCTCCAGTCTTCCCCATCATATTTCTTGCA GTTACATTATTAGCTATTCAACTTTCCACCCTACATATTCTCTATTTCAG CTTGGTAAGAGCACAATTATGGTGAATTACAATCCTGAAACTGTCAGTAC AGACTATGATGAATGTGATCGATTGTACTTCGATGAAATCACATTTGAGG TAATTCTTTATCAACCGATAATTCAAATTGTCATTTTTCTGTTAACCCTG AAAGCTGACAAGGTATTTGCTAATTTTAGTCCTAACTATTTCAAAGAGTC CCTGTGACTAATTCAACCTGCCTTCAAACCAAACAGATGACCTAAACAGA TTGAACAGAACTTTAGAAATCATCAAAACACGACTTGTCTTTTTTCCAGA CAATCATGGATATCTACCATAAAGAAGACCCAGAAGGTATTATCTTATCA ATGGGAGGACAGGTTGCCAACAACATTGCTATGCATCTCCACAGACAGGA AGTAAGGCTTTAACATCTGAAAACATTTACCAGAGTTCAGAAATTATCCA AATAATATTCACATTCCTCATGTTTACTTTAATCTTCTTGCTACCCCCAA TGTTTGTTTATAATTTGGAAAGTTCCCCTGGATGTTTGTCTATTTTTAAG AGTTTCCTTACAATCTTCATGTAATTGTAATGGAAATGGTAATGTCTTGG AAAAATATTATGACCAAAAACGTCATGTCATTTTTACTAAGATATTTGTT TTTCCATTAGGTGAGGATCCTTGGCACATCGCCAGAAATGATTGACAACG CTGAAAACAGATTCAAATTCTCTCGTATGCTAGACAACATTGGAATCCTA CAACCAACATGGAAAGAGTTGACCACGATGGAGGTGAGCTCATCAGTTAT TCATAATGCACCTATCAAACCTTGAACTTTGGTCTTACTTACTTAAAATG GATGTCTGTGTTTATTGCTTTTTATTGCTGATATGCCATCAAATACAGAA TATCTAACCCTGANAATATTATGGTCTTGGAAAAATATTATGACCAAAAA CGTCACGTCATTTTTACTAAGATATTTGTTTTTCCATTAGGTGAGGATCC TTGGCACATCGCCAGAAATGATTGACAACGCTGAAAACAGATTCAAATTC TCTCGTATGCTAGACAACATTGGAATCCTACAACCAACATGGAAAGAGTT GACCACGATGGAGGTGAGCTCATCAGTTATTCATAATGCACCTATCAAAC CTTGAACTTTGGTCTTACTTACTTAAAATGGATGTCTGTGTTTATTGCTT TTNTGATCGATTGTACTTCGATGAGATCACATTTGAGGTAATTCTTTATC AACCGATAATTCAAATTGTCATTTTTCTGTTAACCCTGAAAGCTGACATG GTATTTGCTAATTTTAGTCCTAACTATTTCAAAGAGTCCCTGTGACTAAT TCAACCTGCCTTCAAACCAAACAGATGACCTAAACAGATTGAACAGAACT TTAGAAATCATCAAAACACGACTTGTCTTTTTTCCAGACAATCATGGATA TCTACCATAAAGAAGACCCAGAAGGTATTATCTTATCAATGGGAGGACAG GTTGCCAACAACATTGCTATGCATCTCCACAGACAGGAAGTAAGGCTTTA ACATCTGAAAACATTTACCAGAGTTCAGAAATTATCCAAATAATATTCAC ATTCCTCATGTTTACTTTAATCTTCTTGCTACCCCCAATGTTTGTTTATA ATTTGGAAAGTTCCCCTGGATGTTTGTCTATTTTTAAGAGTTTCCTTACA ATCTTCATGTAATTGTAATGGAAATGGTAAAATATTATGGTCTTGGAAAA ATATTATGACCAAAAACGTCACGTCATTTTTACTAAGATATTTGTTTTTC CATTAGGTGAGGATCCTTGGCACATCGCCAGAAATGATTGACAACGCTGA AAACAGATTCAAATTCTCTCGTATGCTAGACAACATTGGAATCCTACAAC CAACATGGAAAGAGTTGACCACGATGGAGGTGAGCTCATCAGTTATTCAT AATGCACCTATCAAACCTTGAACTTTGGTCTTACTTACTTAAAATGGATG TCTGTGTTTATTGTATGGATATGCCATCAAATATAGAATATCTAACCCTG ATAAATTCAAACCCAAATCTCTTTGATGGAGTTTGTTACTGTCAACCTTG GTTTGTGTTAGTTAAGTTTCTAATCCCAGATTTTCATTGCATCCTTATTT AAGTTCTTCACGATTTGCTCTTAGCTATTTTGGATATTCAAACTCTGAAT TTACAGATTTTGCCCGGGGGGACGGTATGTGAGGCAAAAAAAATGGCTTT TAGAATCGCACCCTTACAGTGCAGAAAAAATCGGTGAAATTCATACCCTT ACAGTGCATTTTTTCACATTTTAAACTCGTTTAGAGCATGAAAAGATTTT CGAGAAAAAATTAGCAATTTTTCCTAGATTTGCTGAAATTTTCACCCATA CAGTGCATTTATCAAAAGTCCACCCTTACAGTGCATTTCTGATATTTTGA AAAACATACCCTTAACCACCGCACATACCCGTCGGNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCCCCCCCCCCCCACGAG ATTTTGCAGACAAAATAATTTACTATTCAGTCATTACCATTTCTGCATTT TGTTTAAGGAAGCCTATCAATTCTGCACCAAAGTTGGTTACCCAGTGCTG GTACGACCTTCATACGTGTTGAGTGGAGCTGCCATGAATGTTGTTTATGC TGAAGATGATTTAGAATCATATCTTGGATCTGCTGTCTCCATCTCTAAGG AGCATCCAGTTGTCATCTCCAAATTTATATCCAATGCTAA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000986XLOC_000986Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001904-exon-sc0000012-1575043694:104155..104248TCONS_00001904-exon-sc0000012-1575043694:104155..104248Clytia hemisphaericaexon
TCONS_00001904-exon-sc0000012-1575043694:102698..102799TCONS_00001904-exon-sc0000012-1575043694:102698..102799Clytia hemisphaericaexon
TCONS_00001904-exon-sc0000012-1575043694:102316..102438TCONS_00001904-exon-sc0000012-1575043694:102316..102438Clytia hemisphaericaexon
TCONS_00001904-exon-sc0000012-1575043694:100209..100390TCONS_00001904-exon-sc0000012-1575043694:100209..100390Clytia hemisphaericaexon
TCONS_00001904-exon-sc0000012-1510915933:104155..104248TCONS_00001904-exon-sc0000012-1510915933:104155..104248Clytia hemisphaericaexon
TCONS_00001904-exon-sc0000012-1510915933:102698..102799TCONS_00001904-exon-sc0000012-1510915933:102698..102799Clytia hemisphaericaexon
TCONS_00001904-exon-sc0000012-1510915933:102316..102438TCONS_00001904-exon-sc0000012-1510915933:102316..102438Clytia hemisphaericaexon
TCONS_00001904-exon-sc0000012-1510915933:100209..100390TCONS_00001904-exon-sc0000012-1510915933:100209..100390Clytia hemisphaericaexon
TCONS_00001904-exon-sc0000012-1491911889:104155..104248TCONS_00001904-exon-sc0000012-1491911889:104155..104248Clytia hemisphaericaexon
TCONS_00001904-exon-sc0000012-1491911889:102698..102799TCONS_00001904-exon-sc0000012-1491911889:102698..102799Clytia hemisphaericaexon
TCONS_00001904-exon-sc0000012-1491911889:102316..102438TCONS_00001904-exon-sc0000012-1491911889:102316..102438Clytia hemisphaericaexon
TCONS_00001904-exon-sc0000012-1491911889:100209..100390TCONS_00001904-exon-sc0000012-1491911889:100209..100390Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000012supercontigsc0000012:100209..104248 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0 0 0.753665 3.08594 74.6021 47.961 12.5907 10.2415 0.54448 7.15931 2.27988 1.71006 4.59871 9.86534 1.96924 1.10414 1.48039 1.8608 0 0.838798 0 0 0 0 17.7525 9.58626 0 2.96584 0 0
Blast
BLAST of TCONS_00001904 vs. Swiss-Prot (Human)
Match: PYR1 (CAD protein OS=Homo sapiens GN=CAD PE=1 SV=3)

HSP 1 Score: 268.855 bits (686), Expect = 1.543e-82
Identity = 121/164 (73.78%), Postives = 139/164 (84.76%), Query Frame = 2
Query:    8 TIMVNYNPETVSTDYDECDRLYFDEITFETIMDIYHKEDPEGIILSMGGQVANNIAMHLHRQEVRILGTSPEMIDNAENRFKFSRMLDNIGILQPTWKELTTMEEAYQFCTKVGYPVLVRPSYVLSGAAMNVVYAEDDLESYLGSAVSISKEHPVVISKFISNA 499
            TIMVNYNPETVSTDYD CDRLYFDEI+FE +MDIY  E+PEG+ILSMGGQ+ NN+AM LHRQ+ R+LGTSPE ID+AENRFKFSR+LD IGI QP W+EL+ +E A QFC  VGYP +VRPSYVLSGAAMNV Y + DLE +L SA ++SKEHPVVISKFI  A
Sbjct:  969 TIMVNYNPETVSTDYDMCDRLYFDEISFEVVMDIYELENPEGVILSMGGQLPNNMAMALHRQQCRVLGTSPEAIDSAENRFKFSRLLDTIGISQPQWRELSDLESARQFCQTVGYPCVVRPSYVLSGAAMNVAYTDGDLERFLSSAAAVSKEHPVVISKFIQEA 1132          

HSP 2 Score: 82.8037 bits (203), Expect = 3.399e-18
Identity = 47/154 (30.52%), Postives = 77/154 (50.00%), Query Frame = 2
Query:    8 TIMVNYNPETVSTDYDECDRLYFDEITFETIMDIYHKEDPEGIILSMGGQVANNIAMHL------HRQEVRILGTSPEMIDNAENRFKFSRMLDNIGILQPTWKELTTMEEAYQFCTKVGYPVLVRPSYVLSGAAMNVVYAEDDLESYLGSAVS 451
            T+++N N  TV T     D++YF  IT   +  +   E P+G++L+ GGQ A N  + L       R  VR+LGT  E I+  E+R  F+  +  IG      +   ++E+A     ++GYPVLVR ++ L G         ++L + +  A +
Sbjct:  430 TLLINPNIATVQTSQGLADKVYFLPITPHYVTQVIRNERPDGVLLTFGGQTALNCGVELTKAGVLARYGVRVLGTPVETIELTEDRRAFAARMAEIGEHVAPSEAANSLEQAQAAAERLGYPVLVRAAFALGGLGSGFASNREELSALVAPAFA 583          
The following BLAST results are available for this feature:
BLAST of TCONS_00001904 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
PYR11.543e-8273.78CAD protein OS=Homo sapiens GN=CAD PE=1 SV=3[more]
back to top