Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001901 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001901
Unique NameTCONS_00001901
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length4697

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001901 ID=TCONS_00001901|Name=TCONS_00001901|organism=Clytia hemisphaerica|type=transcript|length=4697bp
ttgtcgtAATTGGGTCATAATTATCGTATGATTCCGGTTAACCCGTGAGC
CCAATTATCACCGATTTAATTTTCGCGCCAATTAAATCGGGGaagtggtt
tgttttgatttggtttcTAATGCCATCGCTATTTTGCAGAATGATTATTT
TATCAGTAGGAGCCAGCCAAGCCTCTTGGTAAATATCGGTCCGCAAAATA
TACATAACAGCACGTGCTAATTTTTTTCTCCGACCTCAAAAGCATGTTGT
AAAATTTGGTACTGTCACCTGATCTGATGACTTGACTTGGTCACATATCA
GCTGATAAGTACATTTCACCTATCATCCTCAAAACTGACTTGCTCAGAAG
GAAAACCGAAATGGCGACACTTATTCTTGATGATGGCACCAAATATCATG
GTCAAATTTTTGGTGATGAAAGAAGTATTGCAGGAGAAGTTGTCTTCCAA
ACTGGTATGGTTGGTTACCCAGAATCATTGACAGATCCTTCATACAACAG
TCAAATCTTGGTATTGACGTATCCACTGATTGGTAATTATGGTATACCAA
ACGATTCTCGTGATGAACATGGCAtgctcaaattttttgaatctgAAAAG
ATTTGGAACAATGGTATGATTGTAGGAGACTTGACTGAGGACTACAGCCA
TTGGTTGGCAACCAAATCACTTTCAGAGTGGCTGAAGGAACACAAAATAC
CTGGAATTACTGGTATTGATACCAGAGCATTAACAAAGAAGTTGAGAGAA
AATGGAACAATGTTAGGAAAGATTGTTTTGGATGGAGAGGATGAAGCAAG
TGTTCCATTTGATGATCCAAACAAAAGGAATTTGATTGCTGAAGTCTCTT
GCAAGGAACCTAAACTTTACAATCCTAAGGGTAAAATAAAGATGATTGCT
GTAGACTTTGGTATCAAATACAACCAGATCCGGTGTTTGATTGATTGTGA
TTGTCAGGTTCTAGTTGTTCCATGGGATTATGACTATAGTACATTGTTAA
AGAACAAAGAATATGATGGTCTGTTTATGAGCAATGGTCCTGGAGATCCT
AGCCTTTGTCAAGTTTCAATTGACACCCTCCGTAAAGTCATTACAGAATT
GCCAGATGTGCCAGTCTTTGGTATTTGCATGGGTCATCAGATCTTATCTC
TTGCTGCTGGATGTGGGTCCTACAAAATGAAATATGGTAACAGAGGACAT
AACCAACCTGCAACCCATTTGGAAACTCAACGTTGCTTCATCACTTGCCA
AAATCATGGCTTTGCAATTGACACAGACAGCTTACCAAAAGAATGgtctg
ttttgtttacaaatgaGAATGATGGCAGTAATGAAGGCATTGTTCACAAC
ACAAAGCCAATCTTCTCAGTTCAGTTTCATCCTGAACATCAAGGAGGACC
AAGAGATTTGGAGCTTTTGTTTGGCTTTTTTGTGGATATTGTAAACAAAC
TGAAAATCGATTCTAACCTCTGCTTACGAACCATGCTGAAAGAAACGTTG
ACTTTCCACCCAGCAGAAGAAACAAGATCCAGAGCATTCAAACCAAAGAA
GGTCTTGATTTTGGGATCTGGTGGCTTATCTATTGGTCAAGCCGGAGAAT
TTGATTATTCTGGCTCTCAAGCTATCAAAGCATTAAAAGAAGAGAAGATT
CACACAGTTTTGATCAATCCTAATATTGCTACAGTGCAAACTTCCAAAGG
ACTTGCAGATAAAACTTACTTCCTTCCTGTTAACTTTGAATTCACAAGCA
AGGTGATTGAAGTAGAAAGACCAGATGGCATTCTGTTATCATTTGGTGGA
CAAACAGCATTGAACTGTGGACTGCTATTGAAAGAGAGGGGAATTTTAGA
GAAATACAATGTTGCTGTTCTTGGTACACCTACCAAATCGATTGAATGGA
CAGAAGATAGGAAAATGTTTTCAGACAAGATGGGAGAGATTGGTGAGAAA
GTTGCACCAAGCTCAGTGGCTTATACTGTGGATGAGGCTATCACAGCAGC
TAACAGGCTAGGATATCCAGTGTTGTTACGTGCAGCATTTGCACTAGGTG
GACTTGGATCTGGTTTTGCTTCCAATGACAATGAGCTCAAAAAGCTTGCA
GCATCGGCTTTTGCACATTCCAAACAGTGTCTAGTTGACAAGTCACTGAA
AGGATGGAAAGAAGTTGAATATGAAGTTGTTAGAGATGCTTATGACAACT
GTATCACTGTTTGTAATATGGAAAACTTTGACCCTTTGGGAATCCATACG
GGTGAATCAATTGTTGTTGCACCAAGTCAAACACTAACAAATGAGGAATA
CAATATGCTTAGAAGAACAGCCATCAAAGTCATCCGTAAACTTGGTGTTG
TTGGTGAATGTAACATCCAGTATGCTTTACACCCTGACTCAAAAGAGTTC
TACATCATTGAGGTCAATGCTCGTCTCTCCAGAAGTTCAGCTCTTGCTTC
CAAAGCAACTGGATACCCATTGGCTTACGTTGCTGCTAAACTTGCACTTG
GTATTCCTCTACCAAAACTGAGAAATTCTGTCACCAATTCAACTACCGCT
TGTTTTGAGCCCTCTTTGGATTATTGTGTTGTGAAAGTTCCTCGATGGGA
TCTGGACAAATTTCAGAGGGTTTCAACAAAGATTGGATCTTCGATGAAGA
GTGTTGGTGAAGTAATGGCTATTGGAAGAAGTTTTGAGGAAGCCATTCAA
AAGAGTTTGAGAATGGTTGACGATTCAAACCTTGGTTTTGATGCAAACAA
CCTCGAGTTGGATGAACAGGTCTTAGTTGAGCCCTCTGACAAAAGAATCT
TTCATGTTGCTGCTGCACTCCGTAGAGGATATTCTATTGATCAGCTGTAT
GAGCTCACTCGTATTGATAAGTGGTTTTTGAGCAAGCTAGCAAAAATAAT
CAACTATGCAAAAATGCTGGAAGAGAAATACCCAAAGGTTGGAGCTGGAA
AGGACACCATTCCATGCAATATCCTACTGAAGGGGAAGCAGCTTGGATTT
TCAGATAAGCAAATTGCTAACTGCGTTCAAAGTTCTGAACTGGTTATCCG
CAAGTACCGTTATGAATGCAACATTTTGCCCTGTTTCAAGCAAATTGACA
CTGTTGCTGCAGAATTCCCAGCTGAAGCTAACTATCTGTATTTAACTTAC
AATGGAGattgtgatgacgtcacatacGCAGAAAGCCAAAACAAAGTCAT
GGTTATTGGGTCAGGTGTCTACAGAATCGGAAGCAGTGTTGAATTTGATG
CATGTGCTGTTGGATGTATTCGAGAATTGAAGAGGCTTGGTAAGAGCACA
ATTATGGTGAATTACAATCCTGAAACTGTCAGTACAGACTATGATGAATG
TGATCGATTGTACTTCGATGAAATCACATTTGAGACAATCATGGATATCT
ACCATAAAGAAGACCCAGAAGGTATTATCTTATCAATGGGAGGACAGGTT
GCCAACAACATTGCTATGCATCTCCACAGACAGGAAGTGAGGATCCTTGG
CACATCGCCAGAAATGATTGACAACGCTGAAAACAGATTCAAATTCTCTC
GTATGCTAGACAACATTGGAATCCTACAACCAACATGGAAAGAGTTGACC
ACGATGGAGGAAGCCTATCAATTCTGCACCAAAGTTGGTTACCCAGTGCT
GGTACGACCTTCATACGTGTTGAGTGGAGCTGCCATGAATGTTGTTTATG
CTGAAGATGATTTAGAATCATATCTTGGATCTGCTGTCTCCATCTCTAAG
GAGCATCCAGTTGTCATCTCCAAATTTATATCCAATGCTAAAGAAATTGA
CGTTGATGCCGTTGCCAACGACGGTGAAGTGATGGCCATGGTCGTCTCTG
AACACGTTGAAAACGCGGGTGTCCACTCTGGTGACGCAACCATGATCTGT
CCACCACAAGACATCAATACGGAAACCATGGGACGGATCAAACAGATCTG
TATTGCAGTTGGAAACGCCCTCAATGTGTCTGGTCCTTTCAATATGCAAC
TTATTGCTAAGGACAATCAATTGAAGGTGATCGAATGCAATTTACGGGTG
TCTCGGTCCTTCCCTTTTGTTTCCAAAACTCTAGATTGTGATTTGGTTGC
CTTGGCAACCAAAATCATCGTTGGTGCTCCTGCTGAACCTGCATTCAACA
TTATGGATAAGTGTGAGAAGATCGGCTGTAAGGTGccacaattttcattt
tcacgaCTTGCTGGAGCTGACGTTCAACTTGGAGTAGAGATGGCAAGCAC
AGGAGAAGTAGCATGCTTCGGTGAAAATAGATACGAAGCTTACTTGAAGG
CCTTGATGAGCACAGGTTTCAAATTACCCAAGAAAAACATACTGCTGACT
GTTGGTAGTTATAAGGCGAAGAAAGAAATGTTGCCAAGTGTTCGTTTACT
GGAGAAGATGGGATACGAATTGTATGCTAGCATGGGTACCGGTGACTTCT
ATCAAGAACATGGTGTACAGGTCCAAATCATTGATTGGCCTTTCGAGGAG
AATGGAACTGAGGGTCAGGAAGAGAGCATTCAAGACTACCTCACACAGAA
CAAATTTGATTTGGTCATCAACATTCCAATGAGGGGTAGTGGTACCAAGA
AGAAGTCTCATTTCATCACACATGGATATCGCACCCGACGAATGGCCATC
GATCATTCCGTCTCATTGATCACCAACATTAAGTGTGCCAAACTCTT
Run BLAST on NCBI

transcript from alignment at sc0000012:97205..121521-

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001901 ID=TCONS_00001901|Name=TCONS_00001901|organism=Clytia hemisphaerica|type=transcript|length=24317bp|location=Sequence derived from alignment at sc0000012:97205..121521- (Clytia hemisphaerica)
TTGTCGTAATTGGGTCATAATTATCGTATGATTCCGGTTAACCCGTGAGC CCAATTATCACCGATTTAATTTTCGCGCCAATTAAATCGGGGAAGTGGTT TGTTTTGATTTGGTTTCTAATGCCATCGCTATTTTGCAGAATGATTATTT TATCAGTAGGAGCCAGCCAAGCCTCTTGGTAAATATCGGTCCGCAAAATA TACATAACAGCACGTGCTAATTTTTTTCTCCGACCTCAAAAGCATGTTGT AAAATTTGGTACTGTCACCTGATCTGATGACTTGACTTGGTCACATATCA GCTGATAAGTACATTTCACCTATCATCCTCAAAACTGACTTGCTCAGAAG GGTAAGTTTTCTATTATTTCTCTTTGTCTCTTGTGGTTCTTTTCGCGTTA AAATTATGAATAATTTATTAAAGTAAAAACTGTTATGTTAAAAACTTCAG GGGTTACTATTTACTATACCATGCTTTCCATGTCATTTTCCTTAAAATAC AGCCAGACAGCCTTGCATTCTTACAAAAACAATAGTGAGGTCAGGTAGCA CATAAAAACGTAAGAATACTTCAGATGGTGATTAAAGTATGAAATTTGGC ACAGATGATCCTTAGAGGGTCTAAAACTTAATTTTAAACAGTAACACCAA ATTTTGCCACCTGGCCACCTGCCAGATGGAAAGATCTAGTTTTAATCACC AATTCCAGACGGTGTCAATCCAACAACTTCGAACAAAAATCGCAATCGAA CCAATCGAACGTAGTAATCGAATGCAATATAATTGCAATTCGATTGTCGA ACGTAATCGAATCTTAATCGAACGGCCGATTCCTGGGTAATATTCGATTG TGTTCGATTGCGTTCGAGTAATGTTCGATTGATAGTTGACTATGTTCGAT CGGTTCGATTGATTGTCAATTATATTGGATTAATGTTCGATTACGATTAT GTGCGATGAGTTTGATTTTGCGATTAAATCAAATTGGATCACTCTGTTAG AGCTTTTTAGCGTGGGCGGCAGAGTGCTTAAGTACCATACCAAAGCGAAT AAAATCTAATACAATCGAATACAATCTAACGTAATTGAATACAATCGAAA GTAATCAAAGTAATCGAACAGTAAATCCTGGGTAATATTCGATTGCGATT CGATTGCGTTCGACAATCGAATTTCAATTATTCGATTGCGTTCAATTGCG TTCGATTGATTCGGCGTTCGATTCGTTCGATTGACACCGTCTGGCCAATT CCGCCCTTCTCCTCTTTTTCTCTATTTCCTAACTCTTACTTTGTTTTTTC TGATTTCTGGACTTAGTTTTTCTGAATTTGACTATTTGACGCTATTTTGC TAATTCTGAAACTATACTCCCACACCTCGGTTCGAACCACCAAATGCAAG CAACCTTGGTTTCCAAACCCGACGCCTTACCACTTGCACTATTGTCGCAC AGCAAAATCACGCAATTCATAACATATTATACCGAACTGGCAAAAAACGG GGGTAATGTTATTATAATATGAGTAAAAGTACCCCTTTTTTAAACCTGAC TGAAATTATTCGAGCCGTTACTAGCAACCCTGCGGGGCCCAAGGCACCGA GTATGCACCCAGCACAGTGACAAGCCGTTACTAGCAACCCTGACCCTAAC TAACTGACAATAATCGAATCCTGACCCCGGAAAATTACCACGGACTAGAA AGAACGAAAAAAATTGAAGGGGCGGAATTGCTGATTGAAACTAGTTTTCA CCCTGCCAGATGACGTCATCAGGTGGCTGGGCAAAAAATTATTTTTTTGA AAATATTCAAAATCTGATGGTTCCAGCGGAAAGAGCATGAAATGCTGATA AAAATTGAGGTATAAAACATGCCTTGAAAATCTTCCTATCAAAAGTTATA GATGTTGTCCGATGTTCAAATTGAATTAAAAGCTTTAAATCAGGAGCACA GTGTACAACCAACTAATTTTTTTTTGCTGTTTTAAGCCTTCCAATTTTTT TTGACCCAAGCATCAGATGGAACTTCAAATTTTGACATGGATTCATGTAT AAGACACTAAATTTGGTCAACTAGTTCCGTTATTACGGGATTTTAGGTTT TGCCTGGAAAGGCTTGCGATGACGTCATCACAAAACTTTAAGCCTTCATA ACTTTTGATAGGAAGATTTTGAAGGCATGTTTTATACCTCGATTTTCATC AGCATTTCATGCTCTTTCCGCTGATACCATCAGATTTTAAATATTTTCAA AAAAATAAATTTTTGCTAAGCCAATTGATGACGTCATCTGACAGGTGGCC GGGTGGCAAAATTTGGTGTTACTGTTTAAAATTAAGTTTTAGACCCTCTA AGGATCATCTGTGCCAAATTTCATGCTTTAATCACCATCTGAAGTATTTT GGTGCTAACAGACCTCACTACCTACAATGCAGAATATTTATTTCCCCAGT CAGAAATGTAGAACACAGACATGTGCTTACTTCTGAAGTCTTCTATTATC CAAGACATGCTAACTCTCTACAGAAAAAAATAGTACTTTTTTGAATTGGT CTACAAAATGCACATGATTTTTAGAGACCTTGTTTGTCAACTTGCAACCC CGTTCTTGATTCAAAGTCAAGCGTTGTCAAGTTTTATAGCAGATAAGCTT CAATATTTGAAAATTTTGTGGAATTAGACTTGAAAATTATAGTTTTTCTT GACAAATTTAAGATTAAAATTTTCATGTGGACAAAATTTTGTGAATCTAT CTTCTCTTTGTGCTAATTTTTTCATTTTCTATAAAATCCTGTTATTCAAA AAAAATTGTGAGGACTAATTTTGGCAATTTTTTTTTGAATAATAGTATTT TTGAGAAAAGCTCAAAAAATAAAGAAATTAGCCTAAATAGAAAATGGATT CTCCCAGACGGTGTCAATCGAATTAATCAAACGCCGATTTGATTGTCGAA CGCAATCAAATATTACAGTACCCAGGATTTGCAGTTTGATTGCAACGATT TTGTTCGATTACATTCGATTGATTCAATTGTATTCAATTTTATTCACTCT CGTACCATATTACGCGCTCAGCCATCCAGGCTAAAAAAGCTCTTAGAAAG GAGTGATTAAATTTAATTTCATCGCAATCAAACTTATCAAACACAATCGT AATCAAGGCGGATCTCTAAAAATTGTTTGGTTCCCGTCATCCGACCGACC CTGATTTTTACTCTGAAGTTAGAGTCAAACTTACAATGCAGGTACCTACA ATGAACAAAGATGGTATGTATGTACAAAAAAATATTTTTGACCGACCGAC CGACTGACCGACCGATCCACTTTGTAAAGTCGAAATGACGGGAACCAAAC AATTTTTAAAGATCCGCCCAAACATAATCGAAGATCAATCGAAGGTAATT TACAATCAATCGAACCAATCAAACGTTACTCAAACGCAATCGAACACAAT AGAATATTACCCAAGAGGCCATTCGATTGAGATTCGATTGCGTTTGATTG AGATTTGATTGCGTTCCATTGAGATACGATTTCATTCGATTGAGATTCGA CTGCGTTCCATAATCGAATCGCAATTATTTGATCTTGTTTGATTACGTTC GATTCGTTCGATTGCGATTTTTCTTTGAAGTTTGACACCGTCTGGATTCT CTGAAGCACCAGCCATGAATATCTGTTATCAAATTAAGAAAACTTTTACC ACTGTTTTTACTGGACAGTTTGGTGTGGGTTTAAATTTATCAATGATTTC TTGCTCATTTTTAATTTTTGTTAACATTTTTCCTATTTTCAAATCGGCAT TGGTAAAATAGCGAAAAAGTTGGACAAAGATTACCCAGAGAAGTATTTCT TTTCAATAAAAGTAAGTAAACAATGATTAGGAAAAGTTGATCTGAAATGA TCATATCGGTTAGACACAACCATTATGGACACTGGCATGTGTCATCCAGC TCAGAGTGACTTTCATACAGTAAATGGATTTTCCAATTTTTCTATTCTAA AACAGTCTGGAATTGGTGTACCTGTCTGGAAAAATATGGAATTTGAAGGA AATAGTCCTTAATGAAGTCTAAAAAACTTCCCGGAGATTGGAAACTTTTA TCTTGACATTAGAATTTTCCAACAACTTCTGTTTTAAAACTGAAAACCTT CCTAATGGATGAAATGTCTAGAATATTTTTGGCATTTTTAGGAAAAAATT AACAATTTGGCTTTCCAGACTAAAAGTCTGGAACTTTCTGTATGAAACAC CCTTATCTCAGCAAAAAACAGTAAAAGAACATGTATTGGTAAAGAATTAT CATTTTGCTATATAAAGATAAACAAGATTAATTAGGATAGAGCAATCGAC TAAATTAACTTTGAATTCTTCTGGTCTAATAATGACGCTTCAAACGTTAT CAAGATAACAATAGCCATTTTTTGAACTTTTAGTACACAGATCTCAGTTG TTCCCCTAATGAGCATTCACAGATTTGAATGTTCTTTTTTCATAACTAGG ATTCAAGTTTTCTCCTTGGTATTCAAGTGACTTCAGTACACTCATTTTGT TTTATAAGCATAACGTTTATAAGCATATGCTAAGCATACCTTGAGGCTCA GCCAAAGAAATTTTTAGAATCATAATTTCCAAAACTTCAGAAAATAACAG AAGAAAGAATCATATATCATATATCATATGGTAAACATTCGAAAACAATA GAATGTCTTCATTTCTCTCAAGATTAAAGAGAGGGGAAAATGCGCGAAAA ATCTTACCACAGAAAAGTTTAGTTTTGTATTATTTGTAAGAAAGATAAAA TTATACATAAATAGTTTTACCAATTATGTATTGAAACTTTTCGAAAGTGC CTACAAATTAAACAACCTTATATTATTATTGGTGTTTAGACAAAGGCACC CAAAAGTTAACCTCAGGCAATTATTTCCACCCCAAAAAGATTTGTAGGAT GTACGGACGGATGGACGCAGAAGGCTACCGTAATACTTTAGCTGGGCAAA ATTAAAGGTCAAGTTTGAAGTTTTAGATATATAACCCTGTCTTAGTAAGA GTATTTTTTAGATAAAAGGGAAGACAAAAAGTCCAACAAATTTGACTTTG CCAGACAAAAGTTTACAAAAAATAAAAGCTTTTCTACCAAGAAAGTTAAA AAGCTACAGTAAGAAAATATTGTACAGTTCGAAAGAGAGCATCAGTAAGT CTTCGTCAATTTCAAGATCCACAATCANCTTTTCTACCAAGAAAGTTAAA AAGCTACAGTAAGAAAATATTGTACAGTTCGAAAGAGAGCATCAGTAAGT CTTCGTCAATTTCAAGATCCCCAATCATAGAATGCCCCCCCCCCCTTGAG CTTAGGGGGGGGGGCTAAACTATTTTTGCTTGATTGGGGGCTGTATTTTT CAAAAAATACTGGGGGCTAGCTTGCTAGGGGAGGCTGAGTGTTGTGTAAT AGAACCAGGGGCAGAGCTGATAGGTTGAAGATATTTTAAATTATGTTAAA AATCTATGCTGTGGGGAAGGTTTTATCCCTCTTGAAAAAAGATTTTTCCT TGCAGCGCAATCAATTTATTGAGAATTTCCATGCAAAATTTCTTTGATAT TTTGCTTTGTGAAGGTGGGGGCTATGTTTCTAGAATTTAGCCTGGGGCTA TTTTCCTTTGCCTCTTCCCCCTGAAAAATCCTGGGGGCTGGACCCCTCTG CACACTATGGTCACAAGATCTGACATTATCAATCCCGTTTTCCATTGTAA TTTTTTTTGTGATTTCATTGTGAAATCGCAAAATGCCATACTTTAATCCG ATCCCTGATTTACTTGTATAATACTGGTCCTCATTTTAGCAAACCCTTTA AAATCTTAAATAATATTATTGAAAAGATTTTTCAGATTGCAATCTTTTAT TTAATGGTATTCAAATATCATATCAATATGAATGTAATGACTAGAGATTT ATTTTCAAAAGATTTTTTCAGCCTAGGGTTTTTGCTGACCTAATTTGTTT ACCATTGTTTTGTATAGAAAACCGAAATGGCGACACTTATTCTTGATGAT GGCACCAAATATCATGGTCAAATTTTTGGTGATGAAAGAAGTATTGCAGG AGAAGTTGGTAAGCTTGATAAACTTTATGTTTAATTTTTGCTGACGCTGT TGCAAAAAACTTAAATATAATTTTTAAATGAAGAGCTGGATTGTAACAAA AGCATAAAAGGAATAAGTTTTTTACTCTTCTAGTTATGATTTTCCTTTTC AACTGGTTTGGACAGCCTTTTTTCAAAGTAGTGTAATTTCAATTCATATT TGTTTTATTAGTCNCTGACGCTGTTGCAAAAAACTTAAATATAATTTTTA AATGAAGAGCTGGATTGTAACAAAAGCATAAAAGGAATAAGTTTTTTACT CTTCTAGTTATGATTTTCCTTTTCAACTGGTTTGGACAGCCTTTTTTCAA AGTAGTGTAATTTCAATTCATATTTGTTGTATTAGTCTTCCAAACTGGTA TGGTTGGTTACCCAGAATCATTGACAGATCCTTCATACAACAGTCAAATC TTGGTATTGACGTATCCACTGATTGGTAATTATGGTATACCAAACGATTC TCGTGATGAACATGGCATGCTCAAATTTTTTGAATCTGAAAAGATTTGGA ACAATGGTATGATTGTAGGAGACTTGACTGAGGACTACAGCCATTGGTTG GCAACCAAATCACTTTCAGAGTGGCTGAAGGAACACAAAATACCTGGAAT TACTGGTAAGTTTAGTTCTTGATATTTGAAATTAAGATTTTTTAGTATTA CAAACCTCAAAGGTTTCAATTTTCGGAAGCTTTGTGTCACCTTCAACAAA ATCAGCAGAGATAAGATAAAGAAAGTGGAATAAGATTTCCAATGAAAATC TGTTACTCCTTTTCTAAAAAAAATTATGAAAGAGCAAACATCTATCCACA GACACACATTTTGTCCTTCCCAGGACTCCGTGCGGCTTGGGTAAGTGAGC ATAGACTGCTTTTGTCACTAGAGTGCTCAAAACACTAAGCAACAGAGTGT ATTGAGTGCTCAAAGAACCAAAGTTCTGAAAAAGCAAACATAAACAAAAG AGGATGATGGGCCTATCTTCAATCATGATTATGGCTTAGATATTGATTTC AAAAGGCACACCTTTTTAAATTGTCTTACTAAACACTGAAAGTTTGCTTT ATTTTGAAGGTATTGATACCAGAGCATTAACAAAGAAGTTGAGAGAAAAT GGAACAATGTTAGGAAAGGTAAAAATTACATACTTCTGCGGCGGACATCA TGAATTCAAGACTTCCAATGCTTGTGGTCCAACATTGCAGTGATTAGTTG TTGTGTTGTACTGCAGCTTGTGTCGTGGTGCAATGTGTGTAAAAATTAAA ATTCTTCAAAGAGATTCTTTTCCACACTTTCGATAGAATTTGGAAAGTAT TGTCCCTGATTGAACAATTTCAGATTTAATTTTTTGCTTTTCATATTCAA TAACCTTTTATCATTGTGGCTAAAAAGTTAAGTTTAGTTGTTCTCCTTTT TTGATTTTCCAAGTTATTATTGTCATTGCTATAGATTGTTTTGGATGGAG AGGATGAAGCAAGTGTTCCATTTGATGATCCAAACAAAAGGAATTTGATT GCTGAAGTCTCTTGCAAGGTACTATATCCTTTTCTTTTCAAAACTTTTGA TATTCACGTTTTAGTGCGCCTAGCAAAATCAAGGCGTTTATGTGTGTCTA AGTGCGCTTAAGTGCGTTAGTGAACGTACTCACTAGAAAGCAAAAATGTG TCCGATGCACTTAGACGCACTTAAACGTGATTTTTTGCACAAGTGAGTAC CAAGCTTCACTGATGTAATAACATTTTCATCAAATAGAAAAACTTATACA CAGTAACAAATTATTTTTGGTAATAAAACCTTTAAAACATATGTTCTTCC AGATTTATAAGATTATTATTCCTTCCTTTTTTGCTTCTAGGAACCTAAAC TTTACAATCCTAAGGGTAAAATAAAGATGATTGCTGTAGACTTTGGTATC AAATACAACCAGATCCGGTGTTTGATTGATTGTGATTGTCAGGTTCTAGT TGTTCCATGGGATTATGACTATAGTACATTGTTAAAGAACAAAGGTAAGA GGTAGAAAATGTCTTTTAGAATTATTTTCACTTTCTTATTTAAATATTAG TTGAATTTTCATTTGTTCACAAAAACATCTTTCATGTTTTACAACTTCTG TATTACACTTCCGTATTATATAACTAACCAAGTATTTAATGCGGGGAAAA TGAATGTCGTAGTGGTGTGGTGGTCATTGCTCTTAACTCCCGTCTGGGAG GTCCAAGTTCGATTCCACTGTAGTACTACGGTTCACTTGGAAAATGGACG TACCTTCGCCCAGGTAAACCCATACCATGTGAGGGGAATTGGGTACCACT ACTCTGATACAAGAGTGTGGGTGATATGTCAGACATTGTGGTGTGTAGTG TGGTGTCACTCACCGCGTTCTGCGCCTAGCTCGAGTGTCGCCACTATGCA TCATAGTATCTGTGTCTCGCTTGCACAGAACCAGCGGTGTCTGGACAACG CTAAGCGCTCCAACTTGAAAAAAAAGGAATTCCTACTTTGTAAGGAGTAG GACCCATTCAGTGGGAAGGGCTGATATCATCAAATGAATGCAACAATTAA CGCAAAAGGCAGGGTTTTCAAAAATTACCACATTTTTGTTAAACAATTTA ATTTAATTGAAGCGAGGGTAACGGATTTGCCTTAATAAAGGTTGCTACCC ACTCAGCATTTTATGGTTCGTAAAACAAGGTGCGCTGCTTAATTATTGCA TAAATTACATAAATCAAGCCTTCAAAGGCTGTCGCTTTGAGCGCAACAAG AGTTGAAACTTTTCAACTTTTTTCGCTGAGCTGTGCAGCTTCCCTATTAT TCTTTTTTAATTAGCCATCAGAAGAGACATTTAACTCTCTTGTACTGTGT GCAAAAAATATCAACAATAGAAGAAAGAAATAATGTGCAGCATATCTCCC CTTTATTTTGGATCAGTGGAATGAGAAAAACGTTCAGCGCCGAACATAAA ATGCTGAGTGGGTAGCATCCTTATTGAGTAGTTATATAAGTGTAATAAGG TAACCTTCAACAATCTCTAATTTCACTTTTGTTTTTTGCTACTCTTCTAG AATATGATGGTCTGTTTATGAGCAATGGTCCTGGAGATCCTAGCCTTTGT CAAGTTTCAATTGACACCCTCCGTAAAGTCATTACAGAATTGCCAGATGT GCCAGTCTTTGGTATTTGCATGGGTCATCAGATCTTATCTCTTGCTGCTG GATGTGGGTCCTACAAAATGAAGTAAGGTTTTCGTCATTTTTTCTTGTAA TGGTGAGCATAAATTGTAAATTCTATTAAATGACATTTAAAGAATCTTTT GTGGTAAGCATCCCACTTATCTTATCCTACTTATATTATCCTACTCAGTT TTTTAACTGTGTTTGTTTCTTATCTCCCCATTCTATTCCTTTTTCTAATC AGATATGGTAACAGAGGACATAACCAACCTGCAACCCATTTGGAAACTCA ACGTTGCTTCATCACTTGCCAAAATCATGGCTTTGCAATTGACACAGACA GCTTACCAAAAGAATGGTCTGTTTTGTTTACAAATGAGAATGATGGCAGT AATGAAGGCATTGTTCACAACACAAAGCCAATCTTCTCAGTTCAGTTTCA TCCTGAACATCAAGGAGGACCAAGAGATTTGGAGCTTTTGTTTGGCTTTT TTGTGGATATTGTAAACAAACTGAAAATCGATTCTAACCTCTGCTTACGA ACCATGCTGAAAGAAACGTTGACTTTCCACCCAGCAGAAGAAACAAGATC CAGAGCATGTAAGAATTTTAAATTTTTTATGAATACTGTATGACTTCAAA TACACCCTTCAGGTGGCATTTATTTAGGGGACTTTTTAAAAAGAAGGGGT TGATTAAAAAGGGGGTCGTTTGAAAGAAGCATGTCTATTCAAAGTTAGGT TAAATAAATTCNAGAAGGGGTTGATTAAAAAAGGGGGTCGTTTGGAAGAA GCATGTCTATTAAAGTTAAGTTACATACATAAGTATGCAAGAATCATTTA GTTAACTTTTACCTTCTATTTTTACTTAAGTTTTTCAAGATGTTCTTTTT GTATTTTTATTACAGTCAAACCAAAGAAGGTCTTGATTTTGGGATCTGGT GGCTTATCTATTGGTCAAGCCGGAGAATTTGATTATTCTGGCTCTCAAGC TATCAAAGCATTAAAAGAAGAGAAGATTCACACAGTTTTGATCAATCCTA ATATTGCTACAGTGCAAACTTCCAAAGGACTTGCAGATAAAACTTACTTC CTTCCTGTTAACTTTGAATTCACAAGCAAGGTATGGAATTGCTTTTCACA GTTATTTACAGTTCTTATTTCATTGTATGTTTAGCTTTTTAGTCACTGAT CACCAACAATGTTATCAAAACATTTTGTAGTAGAATTGTATTTAATTGAT ACAAACCAATACTCTAGTACCTGATTCAGCATTTAATGCAAGAAGAACTA CAAATCAGGATGAATCATTTGAGACGTGGCACACACCTTCATACACCTAA CCCCTTTAAGGAATGCTATCAACCACACACCATAAATTTAGACTTTACTA CTAAAAAAAGCGGTGGATAGCACGCCTTATCACACGTCTAAATTAGCAAT ACTTAGTTTTTAGGAGTGATTGAATTTTCCAAATTAGAAAGCCTGACAAA CGCTGNATCTAAATTAGCAAAACTTAGTTTTTAGGAGTGATTGAATTTTC CAAATTAGAAAGCCTGACAAATAAATATTGTGAAGACTGCTATTATTATG ATTTTTTTATAATTTTGTAGGTGATTGAAGTAGAAAGACCAGATGGCATT CTGTTATCATTTGGTGGACAAACAGCATTGAACTGTGGACTGCTATTGAA AGAGAGGGGAATTTTAGAGAAATACAATGTTGCTGTTCTTGGTACACCTA CCAAATCGATTGAATGGACAGAAGATAGGAAAATGTTTTCAGACAAGATG GGAGAGATTGGTGAGAAAGTTGCACCAAGCTCAGTGGCTTATACTGTGGA TGAGGTGAGTAATTTCTTTTGAAAAAAATAGAAAAAATAGTTATTCATAA TTTCTTATGTTTGCTTTATAAAAAAATTCAAAGGTTGCATTTTTTGGTTC TCAGAAAGTCTCCTTCTTATAAAAATATAGTTGATTCAATGATCCTCACT CTCTGATCCACAGCCAAGCCACCAGTTGAGCATGCTCAATTCAGTTGCTT ACTATAGAAATATGCTCTTGGTTTTCATATGCTTTTCATTATATTTTTAG GCTATCACAGCAGCTAACAGGCTAGGATATCCAGTGTTGTTACGTGCAGC ATTTGCACTAGGTGGACTTGGATCTGGTTTTGCTTCCAATGACAATGAGC TCAAAAAGCTTGCAGCATCGGCTTTTGCACATTCCAAACAGTGTCTAGTT GACAAGTCACTGAAAGGATGGAAAGAAGTTGAATATGAAGTTGTTAGAGA TGCTTATGACAACTGTATCACTGTAAGTTATTCTTTTGAAGGAGTTTCAA TTAAACAGCGTTTGTCTTTTGGAAATTAATGCATTCTTTTAGGAAGTATA TGTGACTCCTCAAGCGATTTGGAGTACACAAAAGACCGATCGGCCCAAAG CGGGTAAAATCCCGGTCTTAAAGCAGCCGAAGTAAAATCTTTAGCGGCCC ATCATTCATGAAAATCGGCCTCAAAGCGGGCGAGAGAATTTTTGAAAGGT CCGCTTGAGGCCGCTCTTTTAGCGGCCCTTCTTGAGCAAGAGACTTCCAA GCGGCGTCNATAGGCTATTTTGTATCGATAAGGAAGTTCTATGAAATATA TCATTGGAAAATCTTTCTCGATAAAGTTTTATTGTTAAAAAATTCTATCG ATAAATTCTATCGCTAAAAATGATAAGGTTGTACCGAAGCAATTGGTCGC AAGACGTTTGTAAAAGTTACAAAGAAAGCGATTTGATAAAACTAAGCATA AGGGATGCTCGTAAAAATTACGGAGAAAGCGAGTTGATAAAACTAAGCGA GTTGATAAAACTAAGGAAAAAAGACGTTCGTGAAAATTACGAAGAAAGCG AGTTGATAAAACTAAGCATAAAAGACGCTCGTTAAAATTACGAAGAAAGC GAGTTGATAAAACTAAGCATAAGAGACGTTCGTGAAAATTACGAAGAAAG TGAGTTGATAAAACTAAGCATAACAGACGCATTTAAACTATACAAAGAAA TCAAATTCAGAAAAACTAAGCATGATAGATGCTTGTGGAAGCAATGTAAA AAACGAGCTAATATTAGTTGACTATTCTTGTTAAAACATACGAAGAAAAA CAAGTTGATAAAAGTATGCATAAGAAACTCGAATGAAATTTATGAAAAAT GGATCGGCTCAAACAAAAGTTGTGGCTAAGAGACAGGGGTGTTCTGTTTC TTAAAAAGTCTGTTGACGTACCCATGCAACCTACTATGTCTTTAGACATT TTTATTTGTAAAATTTCGGACCCTTAAAAACAGTATAATGACTTCTAAGT TGAATCGATAAAGTTTTATCACTAATTTTCTATTGCTACTTTTGTTATCG TTATCGATTAGTTTCTATCGCTAAATTGCACTGCAATGACTTCATTCATG GATCATCTATCGTTAAACTTTTATAGATAAAGCTCCCATCGCTTATTTGG GATCATTAAATTCTTATCGATAAAAGTCTATCGATAAAGTGTTGAGAGCG GTTGTTAAAAATGTCTACCATATCAAAATAAAATCCAAACGATTTAAAAT TACAAGAAGAAAATCTTACTTTCCAATTTCACAACACACGACAACTCGTT TTCCAAGAAACGAACTCAATGTTTACATTTTCGAAAACGAGGCTAAGTAA AAGTAAGTAAGTAAAGAAATCAATAGCGGCCATCGGGACGAAGCGTACCG GGCATTGGACCCCTCAGGCCCCTTTAGCGGCCTCAAAGCCTCTTCGTTAT GGCCGCTTTACATGATCGGCCATGCATCGGCCTCTTTCAATTTTTGAACG GCCTTAGCGGTAAAAAGACCGGTCCAATAGAGGCCAAAGAGGAACGGTAA TTAGACCGATCGGACTTTTGTGTACTCCAGATTGCTTGGGGAGTCACATA TTCGTAATAATGTCAATAGTGGGCTTCCCCATTTTTGATTTTCTGCTTTT TGAAAAAAGGTTTGGGTTCGAGGTGGTGATGTCCCAATTTAAATATTCTG CCCAAACAAAATAAGTTTACAATACGAATTTGAAGATGATGCCCATAATT TGTGAAATAGAGGNTATTGAAAGAGAGGGGAATTTTAGAGAAATACAATG TTGCTGTTCTTGGTACACCTACCAAATCGATTGAATGGACAGAAGATAGG AAAATGTTTTCAGACAAGATGGGAGAGATTGGTGAGAAAGTTGCACCAAG CTCAGTGGCTTATACTGTGGATGAGGTGAGTAATTTCTTTTGAAAAAAAT AGAAAAAATAGTTATTCATAATTTCTTATGTTTGCTTTATAAAAAAATTC AAAGGTTGCATTTTTTGGTTCTCAGAAAGTCTCCTTCTTATAAAAATATA GTTGATTCAATGATCCTCACTCTCTGATCCACAGCCAAGCCACCAGTTGA GCATGCTCAATTCAGTTGCTTACTATAGAAATATGCTCTTGGTTTTCATA TGCTTTTCATTATATTTTTAGGCTATCACAGCAGCTAACAGGCTAGGATA TCCAGTGTTGTTACGTGCAGCATTTGCACTAGGTGGACTTGGATCTGGTT TTGCTTCCAATGACAATGAGCTCAAAAAGCTTGCAGCATCGGCTTTTGCA CATTCCAAACAGTGTCTAGTTGACAAGTCACTGAAAGGATGGAAAGAAGT TGAATATGAAGTTGTTAGAGATGCTTATGACAACTGTATCACTGTAAGTT ATTCTTTTGAAGGAGTTTCAATTAGTTATTCTATTCTATTCTTTGTCTGT AAACAGCGTTTGTCTTTTGGAAATTAATGCATTCTTTTAGGAAGTATATT CGTAATAATTTCAATAGTGGGCTTCCCCATTTTTGATTTTCTGCTTTTTG AAAAAAGGTTCGGGTTGGAGGTGGTGATGTCCCAATTTAAATATTCTGCC CAAACAAAATAAGTTTACAATACGAATTTGAAGATGATGCCCATAATTTG TGAAATATCTTAGGAAGGGTATATTCTCTGTTACTTAAAAGCCCTCAGCT TTAAACTTGTGTTTGATTACAAATAAGCTATATGTTTTCCAGGTTTGTAA TATGGAAAACTTTGACCCTTTGGGAATCCATACGGGTGAATCAATTGTTG TTGCACCAAGTCAAACACTAACAAATGAGGAATACAATATGCTTAGAAGA ACAGCCATCAAAGTCATCCGTAAACTTGGTGTTGTTGGTGAATGTAACAT CCAGTATGCTTTACACCCTGACTCAAAAGAGGTACAAGTACTTGACCACT TGAGCAGACTGGAACACTTTTACCCCTTTACCCCAATGAAACCTTCTTTT ATACATTTGCTTGTTACAGCATCTCAAAAAGACTTGTTTTGTGGTGACTC AATTTTCCTTTCTTTGTCTTTATTTTGTTCAATTTCTTCAATCCCAGAAG AGAAACACTTGCTGATTATCAATTTATCTTTATTTGTTTTTGTCAATCAG ACTTTGATTAGACACTTAGACACAAAAACCTTTTGCATCATTGGTAAATG AATTTCTAATTTTTGGTTTTGAAACAAAGAATTAAAGCATAATATTTCTG AATCTTAATATTGCATCAACCTTTTTTATAGTTCTACATCATTGAGGTCA ATGCTCGTCTCTCCAGAAGTTCAGCTCTTGCTTCCAAAGCAACTGGATAC CCATTGGCTTACGTTGCTGCTAAACTTGCACTTGGTATTCCTCTACCAAA ACTGAGAAATTCTGTCACCAATTCAACTACCGCTTGTTTTGAGCCCTCTT TGGATTATTGTGTTGTGAAAGTTCCTCGATGGGATCTGGACAAATTTCAG AGGGTTTCAACAAAGGTGATTTGATTGTTTTGATATCGTGTACCAAAATC CATATTATATGAAAGGAGATTTGTTTTTGACTGAACCAGTAGTTGATTAA CATCCAATGCATATGGAAAAGTTTGACAGTTGATATAGATCTATTCTGGT TAAACCAAAGCCAAAATTGTAGCAGCCTTTCGATTTATAAATTTATCTTG GAATCAGGTGTGAAGTTTTGTACCTTTTTCTTTTCTAATGCCATTTGTGT TTTTTAGATTGGATCTTCGATGAAGAGTGTTGGTGAAGTAATGGCTATTG GAAGAAGTTTTGAGGAAGCCATTCAAAAGAGTTTGAGAATGGTTGACGAT TCAAACCTTGGTTTTGATGCAAACAACCTCGAGTTGGATGAACAGGTATC TCCTGAAGTTTATCAGTCAATTTCTTTTTTAGTCTATTATATTACAGCTT AAAAACAGGCTTAATCTTTTTCTCACAAGATTCGAACAAAATGTAAGAGT TGGTCCAATAAGGTTCTCCAGTGTCTGGTGCTTGTTACCTAATCTAGGAA GATACCTTTTTCTTCGACTAATAGAAAAATCTTTACTGTAATTGTCACTA CAATTTATCTTTTGAAAAAAAAATCACATAATGTATCCTTTAAAGCAGTT CTAGTTATTATACTTACCTTGCTTCAATTTTCGGTCATTTGTTTCTCAAT CAAAATTTGGTTAAATGCCTAGGTATCTAAAAATTATCTGCAATGGTTTA CAATGTGACGTTTCCAATGGAATATATATGATTGGAAGATTTATGATTAA CTTGACTTTCTGCCAATTCTCTTAGGTCTTAGTTGAGCCCTCTGACAAAA GAATCTTTCATGTTGCTGCTGCACTCCGTAGAGGATATTCTATTGATCAG CTGTATGAGCTCACTCGTATTGATAAGTGGTTTTTGAGCAAGCTAGCAAA AATAATCAACTATGCAAAAATGCTGGAAGAGAAATACCCAAAGGTAAAAG TTTTTATGAAATTTGACTTTTTTGTCCTAGGTTCTCTGTAACTCTTCTTT TTTGGCAGGGTTTGGAAGCTTAGTTGAGTTTGTCTGCGGTCATTCATTAT CATGATTTTAACAGAAAAAAACAGTATTTCGGAATAAAAGCAGGTAAACC AATTGCTTAATTTGGTTACTAACATAAGCTGAAAATGATTTTCTTCTTCA GAAAATCACGATAAATATTCTTTATTGTTTTTAGGTTGGAGCTGGAAAGG ACACCATTCCATGCAATATCCTACTGAAGGGGAAGCAGCTTGGATTTTCA GATAAGCAAATTGCTAACTGCGTTCAAAGGTTGTGACTTTATCTTTTAGA TTTTACTACTTGACCATTTTATGTACTTAAACTTAGATTGAGTCAGATTA ATTAAATTTTCTAGACTTTACAAATAAAACTTCTTTAAAGAGTTCTTCAA CGTCTTAGCCTAGTGAATCGGCGATGCCAGGATCAAACCGCTACTTCATC TTCTTGCTCTACTCTGATAACCGAACTTAATACTCTGCAAAAGAGTAGTC CAAAGTGAGTGGATTATGAGTTCAACATTATGGAATGCAGACTAAGATTT ATCAACTTGAACTTGAATGTTTTTCTCTTCAGTTCTGAACTGGTTATTCG CAAGTACCGTTATGAATGCAACATTTTGCCCTGTTTCAAGCAAATTGACA CTGTTGCTGCAGAATTCCCAGCTGAAGCTAACTATCTGTATTTAACTTAC AATGGAGATTGTGATGACGTCACATACGCAGAAAGCCAAAACAAAGTCAT GGTTATTGGGTCAGGTGTCTACAGAATCGGAAGCAGTGTTGAATTTGATG CATGTGCTGTTGGATGTATTCGAGAATTGAAGAGGGTAAGTATAGAAATG ATTCTTAAGTCAAATCAACTCAACGACTTAAGCTACCAAAATTACTTTGA AAAGTTCCTAAAGTTTGACCGAAGATATTCCTCCAATGTTACTTGCTCTT GAGTAATTGACCGTGCATTCCCCTGTAATGTACATTGGGCTCCAGTCTTC CCCATCATATTTCTTGCAGTTACATTATTAGCTATTCAACTTTCCACCCT ACATATTCTCTATTTCAGCTTGGTAAGAGCACAATTATGGTGAATTACAA TCCTGAAACTGTCAGTACAGACTATGATGAATGTGATCGATTGTACTTCG ATGAAATCACATTTGAGGTAATTCTTTATCAACCGATAATTCAAATTGTC ATTTTNTTCTGCGGTCATTCATTATCATGATTTTAACAGAAAAAAACAGT ATTTCGGAATAAAAGCAGGTAAACCAATAGCTTAATTTGGTTACTAACAT AAGCTGAAAATGATTTTCTTCTTCAGAAAATCACGATAAATATTCTTTAT TGTTTTTAGGTTGGAGCTGGAAAGGACACCATTCCATGCAATATCCTACT GAAGGGGAAGCAGCTTGGATTTTCAGATAAGCAAATTGCTAACTGCGTTC AAAGGTTGTGACTTTATCTTTAGACTTAGACTTAAACTTAGATTGAGTCA GATTAATTAAATTTTCTAGACTTTACAAATAAAATTTCTTTAAAGAGTTC TTCAACGTCTTAGCCTAGTGAATCGGCGATGCCAGGATCAAACCGCTACT TCATCTTCTTGCTCTACTCTGATAACCGAACTTAATACGCTGCAAAAGAG TAGTCCAAAGTAAGTGGATTATGAGTTCAACATTATGGAATGCAGACTAA GATTTATCAACTTGAACTTGAATGTTTTTCTCTTCAGTTCTGAACTGGTT ATCCGCAAGTACCGTTATGAATGCAACATTTTGCCCTGTTTCAAGCAAAT TGACACTGTTGCTGCAGAATTCCCAGCTGAAGCTAACTATCTGTATTTAA CTTACAATGGAGATTGTGATGACGTCACATACGCAGAAAGCCAAAACAAA GTCATGGTTATTGGGTCAGGTGTCTACAGAATCGGAAGCAGTGTTGAATT TGATGCATGTGCTGTTGGATGTATTCGAGAATTGAAGAGGGTAAGTATAG AAATGATTCTTAAGTCAAATCAACTCAACGACTTAAGCTACCAAAATTAC TTTGAAAAGTTCCTAAAGTTTGACCGAAGATATTCCTCCAATGTTACTTG CTCTTGAGTAATTGACCGTGCATTCCCCTGTAATGTACATTGGGCTCCAG TCTTCCCCATCATATTTCTTGCAGTTACATTATTAGCTATTCAACTTTCC ACCCTACATATTCTCTATTTCAGCTTGGTAAGAGCACAATTATGGTGAAT TACAATCCTGAAACTGTCAGTACAGACTATGATGAATGTGATCGATTGTA CTTCGATGAAATCACATTTGAGGTAATTCTTTATCAACCGATAATTCAAA TTGTCATTTTTCTGTTAACCCTGAAAGCTGACAAGGTATTTGCTAATTTT AGTCCTAACTATTTCAAAGAGTCCCTGTGACTAATTCAACCTGCCTTCAA ACCAAACAGATGACCTAAACAGATTGAACAGAACTTTAGAAATCATCAAA ACACGACTTGTCTTTTTTCCAGACAATCATGGATATCTACCATAAAGAAG ACCCAGAAGGTATTATCTTATCAATGGGAGGACAGGTTGCCAACAACATT GCTATGCATCTCCACAGACAGGAAGTAAGGCTTTAACATCTGAAAACATT TACCAGAGTTCAGAAATTATCCAAATAATATTCACATTCCTCATGTTTAC TTTAATCTTCTTGCTACCCCCAATGTTTGTTTATAATTTGGAAAGTTCCC CTGGATGTTTGTCTATTTTTAAGAGTTTCCTTACAATCTTCATGTAATTG TAATGGAAATGGTAATGTCTTGGAAAAATATTATGACCAAAAACGTCATG TCATTTTTACTAAGATATTTGTTTTTCCATTAGGTGAGGATCCTTGGCAC ATCGCCAGAAATGATTGACAACGCTGAAAACAGATTCAAATTCTCTCGTA TGCTAGACAACATTGGAATCCTACAACCAACATGGAAAGAGTTGACCACG ATGGAGGTGAGCTCATCAGTTATTCATAATGCACCTATCAAACCTTGAAC TTTGGTCTTACTTACTTAAAATGGATGTCTGTGTTTATTGCTTTTTATTG CTGATATGCCATCAAATACAGAATATCTAACCCTGANAATATTATGGTCT TGGAAAAATATTATGACCAAAAACGTCACGTCATTTTTACTAAGATATTT GTTTTTCCATTAGGTGAGGATCCTTGGCACATCGCCAGAAATGATTGACA ACGCTGAAAACAGATTCAAATTCTCTCGTATGCTAGACAACATTGGAATC CTACAACCAACATGGAAAGAGTTGACCACGATGGAGGTGAGCTCATCAGT TATTCATAATGCACCTATCAAACCTTGAACTTTGGTCTTACTTACTTAAA ATGGATGTCTGTGTTTATTGCTTTTNTGATCGATTGTACTTCGATGAGAT CACATTTGAGGTAATTCTTTATCAACCGATAATTCAAATTGTCATTTTTC TGTTAACCCTGAAAGCTGACATGGTATTTGCTAATTTTAGTCCTAACTAT TTCAAAGAGTCCCTGTGACTAATTCAACCTGCCTTCAAACCAAACAGATG ACCTAAACAGATTGAACAGAACTTTAGAAATCATCAAAACACGACTTGTC TTTTTTCCAGACAATCATGGATATCTACCATAAAGAAGACCCAGAAGGTA TTATCTTATCAATGGGAGGACAGGTTGCCAACAACATTGCTATGCATCTC CACAGACAGGAAGTAAGGCTTTAACATCTGAAAACATTTACCAGAGTTCA GAAATTATCCAAATAATATTCACATTCCTCATGTTTACTTTAATCTTCTT GCTACCCCCAATGTTTGTTTATAATTTGGAAAGTTCCCCTGGATGTTTGT CTATTTTTAAGAGTTTCCTTACAATCTTCATGTAATTGTAATGGAAATGG TAAAATATTATGGTCTTGGAAAAATATTATGACCAAAAACGTCACGTCAT TTTTACTAAGATATTTGTTTTTCCATTAGGTGAGGATCCTTGGCACATCG CCAGAAATGATTGACAACGCTGAAAACAGATTCAAATTCTCTCGTATGCT AGACAACATTGGAATCCTACAACCAACATGGAAAGAGTTGACCACGATGG AGGTGAGCTCATCAGTTATTCATAATGCACCTATCAAACCTTGAACTTTG GTCTTACTTACTTAAAATGGATGTCTGTGTTTATTGTATGGATATGCCAT CAAATATAGAATATCTAACCCTGATAAATTCAAACCCAAATCTCTTTGAT GGAGTTTGTTACTGTCAACCTTGGTTTGTGTTAGTTAAGTTTCTAATCCC AGATTTTCATTGCATCCTTATTTAAGTTCTTCACGATTTGCTCTTAGCTA TTTTGGATATTCAAACTCTGAATTTACAGATTTTGCCCGGGGGGACGGTA TGTGAGGCAAAAAAAATGGCTTTTAGAATCGCACCCTTACAGTGCAGAAA AAATCGGTGAAATTCATACCCTTACAGTGCATTTTTTCACATTTTAAACT CGTTTAGAGCATGAAAAGATTTTCGAGAAAAAATTAGCAATTTTTCCTAG ATTTGCTGAAATTTTCACCCATACAGTGCATTTATCAAAAGTCCACCCTT ACAGTGCATTTCTGATATTTTGAAAAACATACCCTTAACCACCGCACATA CCCGTCGGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNCCCCCCCCCCCCACGAGATTTTGCAGACAAAATAATTTACTATT CAGTCATTACCATTTCTGCATTTTGTTTAAGGAAGCCTATCAATTCTGCA CCAAAGTTGGTTACCCAGTGCTGGTACGACCTTCATACGTGTTGAGTGGA GCTGCCATGAATGTTGTTTATGCTGAAGATGATTTAGAATCATATCTTGG ATCTGCTGTCTCCATCTCTAAGGAGCATCCAGTTGTCATCTCCAAATTTA TATCCAATGCTAAAGTAACTGCAATTTATTCTACCTATAGTTCGTTTTGA ATTGTTGATGTGGAAATACCAATTTCTGCACAGATTTTTCGATAGGAAAA AAAAACAATCTGAATATTCAACAATGTTTTTTTTAAGTTTTCTTCTACAA ACCGAAATAGTTCAATTCTTTGGTAAATGGTTACCCGAACTCTACGAGTC TATCTTCTTTGAATCTAGCTTTATTCTTAACCAGGAAATCTTAGTTACGT TTTTTGCAGTCGCACTTTGAATCCAGTCTGTGTAAAAGTTCCAACATCGT TTCTTAAAATCTACCCGAACGCGACCGTAGTACAGTGGTAGAGCATCCGG CTGCGGTTCGCAAGGTTGTGGGTTCAACCCCCAGCCGGGTCATACCAAAG ATTCCCAAAATGGTACTTGATGCCTCTCTGCTTGATGCTCAGCACNAATA CCAATTTCTGCACAGATTTTTCGATAAGAAAAAAAAACAATCTGAATATT CAACAATGTTTTTTTTAAGTTTTCTTCTACAAACCGAAATAGTTCAATTC TTTGGTAAATGGTTACCCGAACTCTACGAGTCTATCTTCTTTGAATCTAG CTTTATTCTTAACCAGGAAATCTTAGTTACGTTTTTTGCAGTCGCACTTT GAATCCAGTCTGTGTAAAAGTTCCAACATCGTTTCTTAAAATCTACCCGA ACGCTACCAACTTACAATTACTTAATCGATTTCTTTCAACCAGGAAATTG ACGTTGATGCCGTTGCCAACGACGGTGAAGTGATGGCCATGGTCGTCTCT GAACACGTTGAAAACGCGGGTGTCCACTCTGGTGACGCAACCATGATCTG TCCACCACAAGACATCAATACGGAAACCATGGGACGGATCAAACAGATCT GTATTGCAGTTGGAAACGCCCTCAATGTGTCTGGTCCTTTCAATATGCAA CTTATTGCTAAGGTATAAAGTCTGTTCATCTCTATACTTTCAATTAATTT GACACTTTGTAGAATAGTGAATTCAAAGTACTCCTTGACGACGTATAGAG AAAGGAAAACTTGCGTTCTTCCAATACGCCTAATTACTTTTACACCACTA TCACGTCTCCTGTGTCAAAAAAACGTAATGTTTTTGTGAGTACGTCAACT TCATTATTTTTATGAGAATCTAAAGAACGGGAAATTCTCCTTCGGTAATG GTATGCTATTTTACCAAGGCAAGGAATACACAACATCTCATGGATCTTCA TTTACTCTTTTAGGACAATCAATTGAAGGTGATCGAATGCAATTTACGGG TGTCTCGGTCCTTCCCTTTTGTTTCCAAAACTCTAGATTGTGATTTGGTT GCCTTGGCAACCAAAATCATCGTTGGTGCTCCTGCTGAACCTGCATTCAA CATTATGGATAAGTGTGAGAAGATCGGCTGTAAGGTATGAACAGAAATAA ATATTCCTCCTTCAAAAGCAAATTTCAAGTTTAAATGATTGAAAAATTGG TCATATTTTTGTCCAGAAATATTAACCGTCATTTTCTCCTGTAAGAGTCC ACTTTTGTCAAACAGATAGCTGATTGTAGTCCGAATGCCTATACTCAAGT ACTTTAGTATCACAACTATTTGTCCGCTCGCCATACCTTCATAACTCAGA ACCAAAAGCATCGAAGAAATTTTACATATATTTTGGATTTATCTCTAAGG GGTATCTACATTTTCTTTTGAGCTTGAAAAGACGCATAGACACATAGTGG CTATGTTATAAATCAACCGGACAGTCCTGAAATTGAAATCAACTTTCTGT CTCTCTGCAGGTGCCACAATTTTCATTTTCACGACTTGCTGGAGCTGACG TTCAACTTGGAGTAGAGATGGCAAGCACAGGAGAAGTAGCATGCTTCGGT GAAAATAGATACGAAGCTTACTTGAAGGCCTTGATGAGCACAGGTTTCAA ATTACCCAAGAAAAACATACTGCTGACTGTTGGTAGTTATAAGGTAATAA TTCTTCATTTTATTTCAATACAATTTAGTTTTTCTGGTGGTAATTCGTAG TGGTGAAATTTGTTTTTTAGATTTAAACTATCCACAAAAACTTTTATTCA GGCAGTCTTGACGCTCCATTGTTCTCATTATCTCGAAATGAAAACAAAGT TTCATCCATTGAATTTAGAAGATTTTTAGGATCTTCAACATAATCAGCCT GTAGTATATAAACCAGACTTCAAACAATTATGTTCACTACTTCCACACTC TCACCTTATCATTGATCTGGATTGTTTTAGGCGAAGAAAGAAATGTTGCC AAGTGTTCGTTTACTGGAGAAGATGGGATACGAATTGTATGCTAGCATGG GTACCGGTGACTTCTATCAAGAACATGGTGTACAGGTCTGTCGAGTATCT TAGTTGAGGGCGTTGGTCTTTATTCTCTTAGCTTAGAGGTGTCAGCCTTT ATTCTCTGAGCTAAGGACATTGGTTTCTCTGCTCTCTTAGCTAAACATGT TTGTCTCTGCTCTCCCTTAAAAGCCTTTATCAAAAGACATGGAATGTTTA TGAATAAAATGTTATTAAAATAAGCGGGATCATTTTTGGGTACTTTGTTC GCTTTCATGATAAATTGTATGTCCAGTAGCACAGAAGTCTTTATATTTCA GAGTTGAAAGTTAAGTTACGAAGTTTCTTGTACATGAAATTAGGTTCTTT TTTTGAACTGTCTAACTCATCCAACATTTCGTCAAATTAATTGGTTCTTG ATTTCTACCGGACCAAATAGCTTCGACATTTGTCTTTCAGGTCCAAATCA TTGATTGGCCTTTCGAGGAGAATGGAACTGAGGGTCAGGAAGAGAGCATT CAAGACTACCTCACACAGAACAAATTTGATTTGGTCATCAACATTCCAAT GAGGGGTAGTGGTACCAAGAAGAAGTCTCATTTCATCACACATGGATATC GCACCCGACGAATGGCCATCGATCATTCCGTCTCATTGATCACCAACATT AAGTGTGCCAAACTCTT
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000986XLOC_000986Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001901-exon-sc0000012-1575043694:121171..121521TCONS_00001901-exon-sc0000012-1575043694:121171..121521Clytia hemisphaericaexon
TCONS_00001901-exon-sc0000012-1575043694:115414..115504TCONS_00001901-exon-sc0000012-1575043694:115414..115504Clytia hemisphaericaexon
TCONS_00001901-exon-sc0000012-1575043694:114767..115036TCONS_00001901-exon-sc0000012-1575043694:114767..115036Clytia hemisphaericaexon
TCONS_00001901-exon-sc0000012-1575043694:114254..114312TCONS_00001901-exon-sc0000012-1575043694:114254..114312Clytia hemisphaericaexon
TCONS_00001901-exon-sc0000012-1575043694:113854..113937TCONS_00001901-exon-sc0000012-1575043694:113854..113937Clytia hemisphaericaexon
TCONS_00001901-exon-sc0000012-1575043694:113378..113531TCONS_00001901-exon-sc0000012-1575043694:113378..113531Clytia hemisphaericaexon
TCONS_00001901-exon-sc0000012-1575043694:112150..112321TCONS_00001901-exon-sc0000012-1575043694:112150..112321Clytia hemisphaericaexon
TCONS_00001901-exon-sc0000012-1575043694:111614..111969TCONS_00001901-exon-sc0000012-1575043694:111614..111969Clytia hemisphaericaexon
TCONS_00001901-exon-sc0000012-1575043694:111092..111306TCONS_00001901-exon-sc0000012-1575043694:111092..111306Clytia hemisphaericaexon
TCONS_00001901-exon-sc0000012-1575043694:110368..110601TCONS_00001901-exon-sc0000012-1575043694:110368..110601Clytia hemisphaericaexon
TCONS_00001901-exon-sc0000012-1575043694:109900..110121TCONS_00001901-exon-sc0000012-1575043694:109900..110121Clytia hemisphaericaexon
TCONS_00001901-exon-sc0000012-1575043694:106941..107129TCONS_00001901-exon-sc0000012-1575043694:106941..107129Clytia hemisphaericaexon
TCONS_00001901-exon-sc0000012-1575043694:106357..106590TCONS_00001901-exon-sc0000012-1575043694:106357..106590Clytia hemisphaericaexon
TCONS_00001901-exon-sc0000012-1575043694:105977..106114TCONS_00001901-exon-sc0000012-1575043694:105977..106114Clytia hemisphaericaexon
TCONS_00001901-exon-sc0000012-1575043694:105379..105546TCONS_00001901-exon-sc0000012-1575043694:105379..105546Clytia hemisphaericaexon
TCONS_00001901-exon-sc0000012-1575043694:105043..105137TCONS_00001901-exon-sc0000012-1575043694:105043..105137Clytia hemisphaericaexon
TCONS_00001901-exon-sc0000012-1575043694:103332..103584TCONS_00001901-exon-sc0000012-1575043694:103332..103584Clytia hemisphaericaexon
TCONS_00001901-exon-sc0000012-1575043694:103000..103098TCONS_00001901-exon-sc0000012-1575043694:103000..103098Clytia hemisphaericaexon
TCONS_00001901-exon-sc0000012-1575043694:102698..102799TCONS_00001901-exon-sc0000012-1575043694:102698..102799Clytia hemisphaericaexon
TCONS_00001901-exon-sc0000012-1575043694:101986..102108TCONS_00001901-exon-sc0000012-1575043694:101986..102108Clytia hemisphaericaexon
TCONS_00001901-exon-sc0000012-1575043694:100208..100390TCONS_00001901-exon-sc0000012-1575043694:100208..100390Clytia hemisphaericaexon
TCONS_00001901-exon-sc0000012-1575043694:99260..99478TCONS_00001901-exon-sc0000012-1575043694:99260..99478Clytia hemisphaericaexon
TCONS_00001901-exon-sc0000012-1575043694:98788..98958TCONS_00001901-exon-sc0000012-1575043694:98788..98958Clytia hemisphaericaexon
TCONS_00001901-exon-sc0000012-1575043694:98229..98411TCONS_00001901-exon-sc0000012-1575043694:98229..98411Clytia hemisphaericaexon
TCONS_00001901-exon-sc0000012-1575043694:97837..97941TCONS_00001901-exon-sc0000012-1575043694:97837..97941Clytia hemisphaericaexon
TCONS_00001901-exon-sc0000012-1575043694:97205..97431TCONS_00001901-exon-sc0000012-1575043694:97205..97431Clytia hemisphaericaexon
TCONS_00001901-exon-sc0000012-1510915933:121171..121521TCONS_00001901-exon-sc0000012-1510915933:121171..121521Clytia hemisphaericaexon
TCONS_00001901-exon-sc0000012-1510915933:115414..115504TCONS_00001901-exon-sc0000012-1510915933:115414..115504Clytia hemisphaericaexon
TCONS_00001901-exon-sc0000012-1510915933:114767..115036TCONS_00001901-exon-sc0000012-1510915933:114767..115036Clytia hemisphaericaexon
TCONS_00001901-exon-sc0000012-1510915933:114254..114312TCONS_00001901-exon-sc0000012-1510915933:114254..114312Clytia hemisphaericaexon
TCONS_00001901-exon-sc0000012-1510915933:113854..113937TCONS_00001901-exon-sc0000012-1510915933:113854..113937Clytia hemisphaericaexon
TCONS_00001901-exon-sc0000012-1510915933:113378..113531TCONS_00001901-exon-sc0000012-1510915933:113378..113531Clytia hemisphaericaexon
TCONS_00001901-exon-sc0000012-1510915933:112150..112321TCONS_00001901-exon-sc0000012-1510915933:112150..112321Clytia hemisphaericaexon
TCONS_00001901-exon-sc0000012-1510915933:111614..111969TCONS_00001901-exon-sc0000012-1510915933:111614..111969Clytia hemisphaericaexon
TCONS_00001901-exon-sc0000012-1510915933:111092..111306TCONS_00001901-exon-sc0000012-1510915933:111092..111306Clytia hemisphaericaexon
TCONS_00001901-exon-sc0000012-1510915933:110368..110601TCONS_00001901-exon-sc0000012-1510915933:110368..110601Clytia hemisphaericaexon
TCONS_00001901-exon-sc0000012-1510915933:109900..110121TCONS_00001901-exon-sc0000012-1510915933:109900..110121Clytia hemisphaericaexon
TCONS_00001901-exon-sc0000012-1510915933:106941..107129TCONS_00001901-exon-sc0000012-1510915933:106941..107129Clytia hemisphaericaexon
TCONS_00001901-exon-sc0000012-1510915933:106357..106590TCONS_00001901-exon-sc0000012-1510915933:106357..106590Clytia hemisphaericaexon
TCONS_00001901-exon-sc0000012-1510915933:105977..106114TCONS_00001901-exon-sc0000012-1510915933:105977..106114Clytia hemisphaericaexon
TCONS_00001901-exon-sc0000012-1510915933:105379..105546TCONS_00001901-exon-sc0000012-1510915933:105379..105546Clytia hemisphaericaexon
TCONS_00001901-exon-sc0000012-1510915933:105043..105137TCONS_00001901-exon-sc0000012-1510915933:105043..105137Clytia hemisphaericaexon
TCONS_00001901-exon-sc0000012-1510915933:103332..103584TCONS_00001901-exon-sc0000012-1510915933:103332..103584Clytia hemisphaericaexon
TCONS_00001901-exon-sc0000012-1510915933:103000..103098TCONS_00001901-exon-sc0000012-1510915933:103000..103098Clytia hemisphaericaexon
TCONS_00001901-exon-sc0000012-1510915933:102698..102799TCONS_00001901-exon-sc0000012-1510915933:102698..102799Clytia hemisphaericaexon
TCONS_00001901-exon-sc0000012-1510915933:101986..102108TCONS_00001901-exon-sc0000012-1510915933:101986..102108Clytia hemisphaericaexon
TCONS_00001901-exon-sc0000012-1510915933:100208..100390TCONS_00001901-exon-sc0000012-1510915933:100208..100390Clytia hemisphaericaexon
TCONS_00001901-exon-sc0000012-1510915933:99260..99478TCONS_00001901-exon-sc0000012-1510915933:99260..99478Clytia hemisphaericaexon
TCONS_00001901-exon-sc0000012-1510915933:98788..98958TCONS_00001901-exon-sc0000012-1510915933:98788..98958Clytia hemisphaericaexon
TCONS_00001901-exon-sc0000012-1510915933:98229..98411TCONS_00001901-exon-sc0000012-1510915933:98229..98411Clytia hemisphaericaexon
TCONS_00001901-exon-sc0000012-1510915933:97837..97941TCONS_00001901-exon-sc0000012-1510915933:97837..97941Clytia hemisphaericaexon
TCONS_00001901-exon-sc0000012-1510915933:97205..97431TCONS_00001901-exon-sc0000012-1510915933:97205..97431Clytia hemisphaericaexon
TCONS_00001901-exon-sc0000012-1491911889:121171..121521TCONS_00001901-exon-sc0000012-1491911889:121171..121521Clytia hemisphaericaexon
TCONS_00001901-exon-sc0000012-1491911889:115414..115504TCONS_00001901-exon-sc0000012-1491911889:115414..115504Clytia hemisphaericaexon
TCONS_00001901-exon-sc0000012-1491911889:114767..115036TCONS_00001901-exon-sc0000012-1491911889:114767..115036Clytia hemisphaericaexon
TCONS_00001901-exon-sc0000012-1491911889:114254..114312TCONS_00001901-exon-sc0000012-1491911889:114254..114312Clytia hemisphaericaexon
TCONS_00001901-exon-sc0000012-1491911889:113854..113937TCONS_00001901-exon-sc0000012-1491911889:113854..113937Clytia hemisphaericaexon
TCONS_00001901-exon-sc0000012-1491911889:113378..113531TCONS_00001901-exon-sc0000012-1491911889:113378..113531Clytia hemisphaericaexon
TCONS_00001901-exon-sc0000012-1491911889:112150..112321TCONS_00001901-exon-sc0000012-1491911889:112150..112321Clytia hemisphaericaexon
TCONS_00001901-exon-sc0000012-1491911889:111614..111969TCONS_00001901-exon-sc0000012-1491911889:111614..111969Clytia hemisphaericaexon
TCONS_00001901-exon-sc0000012-1491911889:111092..111306TCONS_00001901-exon-sc0000012-1491911889:111092..111306Clytia hemisphaericaexon
TCONS_00001901-exon-sc0000012-1491911889:110368..110601TCONS_00001901-exon-sc0000012-1491911889:110368..110601Clytia hemisphaericaexon
TCONS_00001901-exon-sc0000012-1491911889:109900..110121TCONS_00001901-exon-sc0000012-1491911889:109900..110121Clytia hemisphaericaexon
TCONS_00001901-exon-sc0000012-1491911889:106941..107129TCONS_00001901-exon-sc0000012-1491911889:106941..107129Clytia hemisphaericaexon
TCONS_00001901-exon-sc0000012-1491911889:106357..106590TCONS_00001901-exon-sc0000012-1491911889:106357..106590Clytia hemisphaericaexon
TCONS_00001901-exon-sc0000012-1491911889:105977..106114TCONS_00001901-exon-sc0000012-1491911889:105977..106114Clytia hemisphaericaexon
TCONS_00001901-exon-sc0000012-1491911889:105379..105546TCONS_00001901-exon-sc0000012-1491911889:105379..105546Clytia hemisphaericaexon
TCONS_00001901-exon-sc0000012-1491911889:105043..105137TCONS_00001901-exon-sc0000012-1491911889:105043..105137Clytia hemisphaericaexon
TCONS_00001901-exon-sc0000012-1491911889:103332..103584TCONS_00001901-exon-sc0000012-1491911889:103332..103584Clytia hemisphaericaexon
TCONS_00001901-exon-sc0000012-1491911889:103000..103098TCONS_00001901-exon-sc0000012-1491911889:103000..103098Clytia hemisphaericaexon
TCONS_00001901-exon-sc0000012-1491911889:102698..102799TCONS_00001901-exon-sc0000012-1491911889:102698..102799Clytia hemisphaericaexon
TCONS_00001901-exon-sc0000012-1491911889:101986..102108TCONS_00001901-exon-sc0000012-1491911889:101986..102108Clytia hemisphaericaexon
TCONS_00001901-exon-sc0000012-1491911889:100208..100390TCONS_00001901-exon-sc0000012-1491911889:100208..100390Clytia hemisphaericaexon
TCONS_00001901-exon-sc0000012-1491911889:99260..99478TCONS_00001901-exon-sc0000012-1491911889:99260..99478Clytia hemisphaericaexon
TCONS_00001901-exon-sc0000012-1491911889:98788..98958TCONS_00001901-exon-sc0000012-1491911889:98788..98958Clytia hemisphaericaexon
TCONS_00001901-exon-sc0000012-1491911889:98229..98411TCONS_00001901-exon-sc0000012-1491911889:98229..98411Clytia hemisphaericaexon
TCONS_00001901-exon-sc0000012-1491911889:97837..97941TCONS_00001901-exon-sc0000012-1491911889:97837..97941Clytia hemisphaericaexon
TCONS_00001901-exon-sc0000012-1491911889:97205..97431TCONS_00001901-exon-sc0000012-1491911889:97205..97431Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000012supercontigsc0000012:97205..121521 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0 0.0581483 0 0 0.804793 3.98164e-07 0.628157 0.131958 0.0450898 1.31423e-07 0 0 0.041766 0 0 0 0 0 0 0 0 0 0 0 1.7587e-07 1.15352e-07 0 0 0 0
Blast
BLAST of TCONS_00001901 vs. Swiss-Prot (Human)
Match: PYR1 (CAD protein OS=Homo sapiens GN=CAD PE=1 SV=3)

HSP 1 Score: 1865.89 bits (4832), Expect = 0.000e+0
Identity = 946/1449 (65.29%), Postives = 1139/1449 (78.61%), Query Frame = 1
Query:  361 MATLILDDGTKYHGQIFGDERSIAGEVVFQTGMVGYPESLTDPSYNSQILVLTYPLIGNYGIPNDSRDEHGMLKFFESEKIWNNGMIVGDLTEDYSHWLATKSLSEWLKEHKIPGITGIDTRALTKKLRENGTMLGKIVLDGEDEASVPFDDPNKRNLIAEVSCKEPKLYNPKGKIKMIAVDFGIKYNQIRCLIDCDCQVLVVPWDYDYSTLLKNKEYDGLFMSNGPGDPSLCQVSIDTLRKVITELPDVPVFGICMGHQILSLAAGCGSYKMKYGNRGHNQPATHLETQRCFITCQNHGFAIDTDSLPKEWSVLFTNENDGSNEGIVHNTKPIFSVQFHPEHQGGPRDLELLFGFFVDIVNKLKIDS--NLCLRTMLKETLTFHPAEETRSRAFKPKKVXXXXXXXXXXXQAGEFDYSGSQAIKALKEEKIHTVLINPNIATVQTSKGLADKTYFLPVNFEFTSKVIEVERPDGILLSFGGQTALNCGLLLKERGILEKYNVAVLGTPTKSIEWTEDRKMFSDKMGEIGEKVAPSSVAYTVDEAITAANRLGYPVXXXXXXXXXXXXXXXXXNDNELKKLAASAFAHSKQCLVDKSLKGWKEVEYEVVRDAYDNCITVCNMENFDPLGIHTGESIVVAPSQTLTNEEYNMLRRTAIKVIRKLGVVGECNIQYALHPDSKEFYIIEVNXXXXXXXXXXXXXTGYPLAYVAAKLALGIPLPKLRNSVTNSTTACFEPSLDYCVVKVPRWDLDKFQRVSTKIGSSMKSVGEVMAIGRSFEEAIQKSLRMVDDSNLGFDANNLELDEQVLVEPSDKRIFHVAAALRRGYSIDQLYELTRIDKWFLSKLAKIINYAKMLEEKYPKVGAGKDTIPCNILLKGKQLGFSDKQIANCVQSSELVIRKYRYECNILPCFKQIDTVAAEFPAEANYLYLTYNGDCDDVTYAESQNKVMVIGSGVYRIGSSVEFDACAVGCIRELKRLGKSTIMVNYNPETVSTDYDECDRLYFDEITFETIMDIYHKEDPEGIILSMGGQVANNIAMHLHRQEVRILGTSPEMIDNAENRFKFSRMLDNIGILQPTWKELTTMEEAYQFCTKVGYPVLVRPSYVLSGAAMNVVYAEDDLESYLGSAVSISKEHPVVISKFISNAKEIDVDAVANDGEVMAMVVSEHVENAGVHSGDATMICPPQDINTETMGRIKQICIAVGNALNVSGPFNMQLIAKDNQLKVIECNLRVSRSFPFVSKTLDCDLVALATKIIVGAPAEPAFNIMDKCEKIGCKVPQFSFSRLAGADVQLGVEMASTGEVACFGENRYEAYLKALMSTGFKLPKKNILLTVGSYKAKKEMLPSVRLLEKMGYELYASMGTGDFYQEHGVQVQIIDWPFEE--NGTEGQEESIQDYLTQNKFDLVINIPMRGSGTKKKSHFITHGYRTRRMAIDHSVSLITNIKCAKL 4695
            MA L+L+DG+   GQ FG   S AGEVVFQTGMVGYPE+LTDPSY +QILVLTYPLIGNYGIP D  DE G+ K+FES  I    ++VG+     SHW AT++L EWL++H IPG+ G+DTR LTKKLRE G++LGK+V +G + +S+PF DPN R L+ EVS K P+++N  G  +++A+D G+KYNQIRCL     +V VVPWD+     L ++EY+GLF+SNGPGDP+     + TL +V++E    PVFGIC+GHQ+L+LA G  +YKM+YGNRGHNQP   + + RCF+T QNHGFA++TDSLP +W+ LFTN NDGSNEGIVHN+ P FSVQFHPEHQ GP D+ELLF  F++ V +    +     +R  L E L         S    P+KVLILGSGGLSIGQAGEFDYSGSQAIKALKEE I T+LINPNIATVQTS+GLADK YFLP+   + ++VI  ERPDG+LL+FGGQTALNCG+ L + G+L +Y V VLGTP ++IE TEDR+ F+ +M EIGE VAPS  A ++++A  AA RLGYPVL+RAAFALGGLGSGFASN  EL  L A AFAH+ Q LVDKSLKGWKE+EYEVVRDAY NC+TVCNMEN DPLGIHTGESIVVAPSQTL + EY +LR+TAIKV + LG+VGECN+QYAL+P+S+++YIIEVNARLSRSSALASKATGYPLAYVAAKLALGIPLP+LRNSVT  T A FEPS+DYCVVK+PRWDL KF RVSTKIGS MKSVGEVM IGRSFEEA QK+LRMVD++ +GFD     + +  L  P+DKRIF VAAAL  GYS+D+LYELTRID+WFL ++ +II +A++LE+           +P ++L + K LGFSDKQIA  V S+EL +RK R E  I P  KQIDTVAAE+PA+ NYLYLTY G   D+T+      V+V+GSGVYRIGSSVEFD CAVGCI++L+++G  TIMVNYNPETVSTDYD CDRLYFDEI+FE +MDIY  E+PEG+ILSMGGQ+ NN+AM LHRQ+ R+LGTSPE ID+AENRFKFSR+LD IGI QP W+EL+ +E A QFC  VGYP +VRPSYVLSGAAMNV Y + DLE +L SA ++SKEHPVVISKFI  AKEIDVDAVA+DG V A+ +SEHVENAGVHSGDAT++ PPQDI  +T+ RIK I  AVG  L V+GPFN+QLIAKD+QLKVIECN+RVSRSFPFVSKTL  DLVALAT++I+G   EP   +M     +G KVPQFSFSRLAGADV LGVEM STGEVA FGE+R EAYLKA++STGFK+PKKNILLT+GSYK K E+LP+VRLLE +GY LYAS+GT DFY EHGV+V  +DW FEE  +G    + SI + L +  F+LVIN+ MRG+G ++ S F+T GYRTRR+A D SV LI +IKC KL
Sbjct:    1 MAALVLEDGSVLRGQPFGAAVSTAGEVVFQTGMVGYPEALTDPSYKAQILVLTYPLIGNYGIPPDEMDEFGLCKWFESSGIHVAALVVGECCPTPSHWSATRTLHEWLQQHGIPGLQGVDTRELTKKLREQGSLLGKLVQNGTEPSSLPFLDPNARPLVPEVSIKTPRVFNTGGAPRILALDCGLKYNQIRCLCQRGAEVTVVPWDHA----LDSQEYEGLFLSNGPGDPASYPSVVSTLSRVLSEPNPRPVFGICLGHQLLALAIGAKTYKMRYGNRGHNQPCLLVGSGRCFLTSQNHGFAVETDSLPADWAPLFTNANDGSNEGIVHNSLPFFSVQFHPEHQAGPSDMELLFDIFLETVKEATAGNPGGQTVRERLTERLCPPGIPTPGSGLPPPRKVLILGSGGLSIGQAGEFDYSGSQAIKALKEENIQTLLINPNIATVQTSQGLADKVYFLPITPHYVTQVIRNERPDGVLLTFGGQTALNCGVELTKAGVLARYGVRVLGTPVETIELTEDRRAFAARMAEIGEHVAPSEAANSLEQAQAAAERLGYPVLVRAAFALGGLGSGFASNREELSALVAPAFAHTSQVLVDKSLKGWKEIEYEVVRDAYGNCVTVCNMENLDPLGIHTGESIVVAPSQTLNDREYQLLRQTAIKVTQHLGIVGECNVQYALNPESEQYYIIEVNARLSRSSALASKATGYPLAYVAAKLALGIPLPELRNSVTGGT-AAFEPSVDYCVVKIPRWDLSKFLRVSTKIGSCMKSVGEVMGIGRSFEEAFQKALRMVDENCVGFDHTVKPVSDMELETPTDKRIFVVAAALWAGYSVDRLYELTRIDRWFLHRMKRIIAHAQLLEQHR------GQPLPPDLLQQAKCLGFSDKQIALAVLSTELAVRKLRQELGICPAVKQIDTVAAEWPAQTNYLYLTYWGTTHDLTFRTPH--VLVLGSGVYRIGSSVEFDWCAVGCIQQLRKMGYKTIMVNYNPETVSTDYDMCDRLYFDEISFEVVMDIYELENPEGVILSMGGQLPNNMAMALHRQQCRVLGTSPEAIDSAENRFKFSRLLDTIGISQPQWRELSDLESARQFCQTVGYPCVVRPSYVLSGAAMNVAYTDGDLERFLSSAAAVSKEHPVVISKFIQEAKEIDVDAVASDGVVAAIAISEHVENAGVHSGDATLVTPPQDITAKTLERIKAIVHAVGQELQVTGPFNLQLIAKDDQLKVIECNVRVSRSFPFVSKTLGVDLVALATRVIMGEEVEPV-GLMTGSGVVGVKVPQFSFSRLAGADVVLGVEMTSTGEVAGFGESRCEAYLKAMLSTGFKIPKKNILLTIGSYKNKSELLPTVRLLESLGYSLYASLGTADFYTEHGVKVTAVDWHFEEAVDGECPPQRSILEQLAEKNFELVINLSMRGAGGRRLSSFVTKGYRTRRLAADFSVPLIIDIKCTKL 1435          
The following BLAST results are available for this feature:
BLAST of TCONS_00001901 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
PYR10.000e+065.29CAD protein OS=Homo sapiens GN=CAD PE=1 SV=3[more]
back to top