Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001878 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001878
Unique NameTCONS_00001878
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length2867

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001878 ID=TCONS_00001878|Name=TCONS_00001878|organism=Clytia hemisphaerica|type=transcript|length=2867bp
AAAGAGAGGGGAATTTTAGAGAAATACAATGTTGCTGTTCTTGGTACACC
TACCAAATCGATTGAATGGACAGAAGATAGGAAAATGTTTTCAGACAAGA
TGGGAGAGATTGGTGAGAAAGTTGCACCAAGCTCAGTGGCTTATACTGTG
GATGAGGCTATCACAGCAGCTAACAGGCTAGGATATCCAGTGTTGTTACG
TGCAGCATTTGCACTAGGTGGACTTGGATCTGGTTTTGCTTCCAATGACA
ATGAGCTCAAAAAGCTTGCAGCATCGGCTTTTGCACATTCCAAACAGTGT
CTAGTTGACAAGTCACTGAAAGGATGGAAAGAAGTTGAATATGAAGTTGT
TAGAGATGCTTATGACAACTGTATCACTGTTTGTAATATGGAAAACTTTG
ACCCTTTGGGAATCCATACGGGTGAATCAATTGTTGTTGCACCAAGTCAA
ACACTAACAAATGAGGAATACAATATGCTTAGAAGAACAGCCATCAAAGT
CATCCGTAAACTTGGTGTTGTTGGTGAATGTAACATCCAGTATGCTTTAC
ACCCTGACTCAAAAGAGTTCTACATCATTGAGGTCAATGCTCGTCTCTCC
AGAAGTTCAGCTCTTGCTTCCAAAGCAACTGGATACCCATTGGCTTACGT
TGCTGCTAAACTTGCACTTGGTATTCCTCTACCAAAACTGAGAAATTCTG
TCACCAATTCAACTACCGCTTGTTTTGAGCCCTCTTTGGATTATTGTGTT
GTGAAAGTTCCTCGATGGGATCTGGACAAATTTCAGAGGGTTTCAACAAA
GATTGGATCTTCGATGAAGAGTGTTGGTGAAGTAATGGCTATTGGAAGAA
GTTTTGAGGAAGCCATTCAAAAGAGTTTGAGAATGGTTGACGATTCAAAC
CTTGGTTTTGATGCAAACAACCTCGAGTTGGATGAACAGGTCTTAGTTGA
GCCCTCTGACAAAAGAATCTTTCATGTTGCTGCTGCACTCCGTAGAGGAT
ATTCTATTGATCAGCTGTATGAGCTCACTCGTATTGATAAGTGGTTTTTG
AGCAAGCTAGCAAAAATAATCAACTATGCAAAAATGCTGGAAGAGAAATA
CCCAAAGGTTGGAGCTGGAAAGGACACCATTCCATGCAATATCCTACTGA
AGGGGAAGCAGCTTGGATTTTCAGATAAGCAAATTGCTAACTGCGTTCAA
AGTTCTGAACTGGTTATCCGCAAGTACCGTTATGAATGCAACATTTTGCC
CTGTTTCAAGCAAATTGACACTGTTGCTGCAGAATTCCCAGCTGAAGCTA
ACTATCTGTATTTAACTTACAATGGAGattgtgatgacgtcacatacGCA
GAAAGCCAAAACAAAGTCATGGTTATTGGGTCAGGTGTCTACAGAATCGG
AAGCAGTGTTGAATTTGATGCATGTGCTGTTGGATGTATTCGAGAATTGA
AGAGGCTTGGTAAGAGCACAATTATGGTGAATTACAATCCTGAAACTGTC
AGTACAGACTATGATGAATGTGATCGATTGTACTTCGATGAAATCACATT
TGAGACAATCATGGATATCTACCATAAAGAAGACCCAGAAGGTATTATCT
TATCAATGGGAGGACAGGTTGCCAACAACATTGCTATGCATCTCCACAGA
CAGGAAGTGAGGATCCTTGGCACATCGCCAGAAATGATTGACAACGCTGA
AAACAGATTCAAATTCTCTCGTATGCTAGACAACATTGGAATCCTACAAC
CAACATGGAAAGAGTTGACCACGATGGAGGAAGCCTATCAATTCTGCACC
AAAGTTGGTTACCCAGTGCTGGTACGACCTTCATACGTGTTGAGTGGAGC
TGCCATGAATGTTGTTTATGCTGAAGATGATTTAGAATCATATCTTGGAT
CTGCTGTCTCCATCTCTAAGGAGCATCCAGTTGTCATCTCCAAATTTATA
TCCAATGCTAAAGAAATTGACGTTGATGCCGTTGCCAACGACGGTGAAGT
GATGGCCATGGTCGTCTCTGAACACGTTGAAAACGCGGGTGTCCACTCTG
GTGACGCAACCATGATCTGTCCACCACAAGACATCAATACGGAAACCATG
GGACGGATCAAACAGATCTGTATTGCAGTTGGAAACGCCCTCAATGTGTC
TGGTCCTTTCAATATGCAACTTATTGCTAAGGACAATCAATTGAAGGTGA
TCGAATGCAATTTACGGGTGTCTCGGTCCTTCCCTTTTGTTTCCAAAACT
CTAGATTGTGATTTGGTTGCCTTGGCAACCAAAATCATCGTTGGTGCTCC
TGCTGAACCTGCATTCAACATTATGGATAAGTGTGAGAAGATCGGCTGTA
AGGTGccacaattttcattttcacgaCTTGCTGGAGCTGACGTTCAACTT
GGAGTAGAGATGGCAAGCACAGGAGAAGTAGCATGCTTCGGTGAAAATAG
ATACGAAGCTTACTTGAAGGCCTTGATGAGCACAGGTTTCAAATTACCCA
AGAAAAACATACTGCTGACTGTTGGTAGTTATAAGGCGAAGAAAGAAATG
TTGCCAAGTGTTCGTTTACTGGAGAAGATGGGATACGAATTGTATGCTAG
CATGGGTACCGGTGACTTCTATCAAGAACATGGTGTACAGGTCCAAATCA
TTGATTGGCCTTTCGAGGAGAATGGAACTGAGGGTCAGGAAGAGAGCATT
CAAGACTACCTCACACAGAACAAATTTGATTTGGTCATCAACATTCCAAT
GAGGGGTAGTGGTACCAAGAAGAAGTCTCATTTCATCACACATGGATATC
GCACCCGACGAATGGCCATCGATCATTCCGTCTCATTGATCACCAACATT
AAGTGTGCCAAACTCTT
Run BLAST on NCBI

transcript from alignment at sc0000012:97205..108102-

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001878 ID=TCONS_00001878|Name=TCONS_00001878|organism=Clytia hemisphaerica|type=transcript|length=10898bp|location=Sequence derived from alignment at sc0000012:97205..108102- (Clytia hemisphaerica)
AAAGAGAGGGGAATTTTAGAGAAATACAATGTTGCTGTTCTTGGTACACC TACCAAATCGATTGAATGGACAGAAGATAGGAAAATGTTTTCAGACAAGA TGGGAGAGATTGGTGAGAAAGTTGCACCAAGCTCAGTGGCTTATACTGTG GATGAGGTGAGTAATTTCTTTTGAAAAAAATAGAAAAAATAGTTATTCAT AATTTCTTATGTTTGCTTTATAAAAAAATTCAAAGGTTGCATTTTTTGGT TCTCAGAAAGTCTCCTTCTTATAAAAATATAGTTGATTCAATGATCCTCA CTCTCTGATCCACAGCCAAGCCACCAGTTGAGCATGCTCAATTCAGTTGC TTACTATAGAAATATGCTCTTGGTTTTCATATGCTTTTCATTATATTTTT AGGCTATCACAGCAGCTAACAGGCTAGGATATCCAGTGTTGTTACGTGCA GCATTTGCACTAGGTGGACTTGGATCTGGTTTTGCTTCCAATGACAATGA GCTCAAAAAGCTTGCAGCATCGGCTTTTGCACATTCCAAACAGTGTCTAG TTGACAAGTCACTGAAAGGATGGAAAGAAGTTGAATATGAAGTTGTTAGA GATGCTTATGACAACTGTATCACTGTAAGTTATTCTTTTGAAGGAGTTTC AATTAGTTATTCTATTCTATTCTTTGTCTGTAAACAGCGTTTGTCTTTTG GAAATTAATGCATTCTTTTAGGAAGTATATTCGTAATAATTTCAATAGTG GGCTTCCCCATTTTTGATTTTCTGCTTTTTGAAAAAAGGTTCGGGTTGGA GGTGGTGATGTCCCAATTTAAATATTCTGCCCAAACAAAATAAGTTTACA ATACGAATTTGAAGATGATGCCCATAATTTGTGAAATATCTTAGGAAGGG TATATTCTCTGTTACTTAAAAGCCCTCAGCTTTAAACTTGTGTTTGATTA CAAATAAGCTATATGTTTTCCAGGTTTGTAATATGGAAAACTTTGACCCT TTGGGAATCCATACGGGTGAATCAATTGTTGTTGCACCAAGTCAAACACT AACAAATGAGGAATACAATATGCTTAGAAGAACAGCCATCAAAGTCATCC GTAAACTTGGTGTTGTTGGTGAATGTAACATCCAGTATGCTTTACACCCT GACTCAAAAGAGGTACAAGTACTTGACCACTTGAGCAGACTGGAACACTT TTACCCCTTTACCCCAATGAAACCTTCTTTTATACATTTGCTTGTTACAG CATCTCAAAAAGACTTGTTTTGTGGTGACTCAATTTTCCTTTCTTTGTCT TTATTTTGTTCAATTTCTTCAATCCCAGAAGAGAAACACTTGCTGATTAT CAATTTATCTTTATTTGTTTTTGTCAATCAGACTTTGATTAGACACTTAG ACACAAAAACCTTTTGCATCATTGGTAAATGAATTTCTAATTTTTGGTTT TGAAACAAAGAATTAAAGCATAATATTTCTGAATCTTAATATTGCATCAA CCTTTTTTATAGTTCTACATCATTGAGGTCAATGCTCGTCTCTCCAGAAG TTCAGCTCTTGCTTCCAAAGCAACTGGATACCCATTGGCTTACGTTGCTG CTAAACTTGCACTTGGTATTCCTCTACCAAAACTGAGAAATTCTGTCACC AATTCAACTACCGCTTGTTTTGAGCCCTCTTTGGATTATTGTGTTGTGAA AGTTCCTCGATGGGATCTGGACAAATTTCAGAGGGTTTCAACAAAGGTGA TTTGATTGTTTTGATATCGTGTACCAAAATCCATATTATATGAAAGGAGA TTTGTTTTTGACTGAACCAGTAGTTGATTAACATCCAATGCATATGGAAA AGTTTGACAGTTGATATAGATCTATTCTGGTTAAACCAAAGCCAAAATTG TAGCAGCCTTTCGATTTATAAATTTATCTTGGAATCAGGTGTGAAGTTTT GTACCTTTTTCTTTTCTAATGCCATTTGTGTTTTTTAGATTGGATCTTCG ATGAAGAGTGTTGGTGAAGTAATGGCTATTGGAAGAAGTTTTGAGGAAGC CATTCAAAAGAGTTTGAGAATGGTTGACGATTCAAACCTTGGTTTTGATG CAAACAACCTCGAGTTGGATGAACAGGTATCTCCTGAAGTTTATCAGTCA ATTTCTTTTTTAGTCTATTATATTACAGCTTAAAAACAGGCTTAATCTTT TTCTCACAAGATTCGAACAAAATGTAAGAGTTGGTCCAATAAGGTTCTCC AGTGTCTGGTGCTTGTTACCTAATCTAGGAAGATACCTTTTTCTTCGACT AATAGAAAAATCTTTACTGTAATTGTCACTACAATTTATCTTTTGAAAAA AAAATCACATAATGTATCCTTTAAAGCAGTTCTAGTTATTATACTTACCT TGCTTCAATTTTCGGTCATTTGTTTCTCAATCAAAATTTGGTTAAATGCC TAGGTATCTAAAAATTATCTGCAATGGTTTACAATGTGACGTTTCCAATG GAATATATATGATTGGAAGATTTATGATTAACTTGACTTTCTGCCAATTC TCTTAGGTCTTAGTTGAGCCCTCTGACAAAAGAATCTTTCATGTTGCTGC TGCACTCCGTAGAGGATATTCTATTGATCAGCTGTATGAGCTCACTCGTA TTGATAAGTGGTTTTTGAGCAAGCTAGCAAAAATAATCAACTATGCAAAA ATGCTGGAAGAGAAATACCCAAAGGTAAAAGTTTTTATGAAATTTGACTT TTTTGTCCTAGGTTCTCTGTAACTCTTCTTTTTTGGCAGGGTTTGGAAGC TTAGTTGAGTTTGTCTGCGGTCATTCATTATCATGATTTTAACAGAAAAA AACAGTATTTCGGAATAAAAGCAGGTAAACCAATTGCTTAATTTGGTTAC TAACATAAGCTGAAAATGATTTTCTTCTTCAGAAAATCACGATAAATATT CTTTATTGTTTTTAGGTTGGAGCTGGAAAGGACACCATTCCATGCAATAT CCTACTGAAGGGGAAGCAGCTTGGATTTTCAGATAAGCAAATTGCTAACT GCGTTCAAAGGTTGTGACTTTATCTTTTAGATTTTACTACTTGACCATTT TATGTACTTAAACTTAGATTGAGTCAGATTAATTAAATTTTCTAGACTTT ACAAATAAAACTTCTTTAAAGAGTTCTTCAACGTCTTAGCCTAGTGAATC GGCGATGCCAGGATCAAACCGCTACTTCATCTTCTTGCTCTACTCTGATA ACCGAACTTAATACTCTGCAAAAGAGTAGTCCAAAGTGAGTGGATTATGA GTTCAACATTATGGAATGCAGACTAAGATTTATCAACTTGAACTTGAATG TTTTTCTCTTCAGTTCTGAACTGGTTATTCGCAAGTACCGTTATGAATGC AACATTTTGCCCTGTTTCAAGCAAATTGACACTGTTGCTGCAGAATTCCC AGCTGAAGCTAACTATCTGTATTTAACTTACAATGGAGATTGTGATGACG TCACATACGCAGAAAGCCAAAACAAAGTCATGGTTATTGGGTCAGGTGTC TACAGAATCGGAAGCAGTGTTGAATTTGATGCATGTGCTGTTGGATGTAT TCGAGAATTGAAGAGGGTAAGTATAGAAATGATTCTTAAGTCAAATCAAC TCAACGACTTAAGCTACCAAAATTACTTTGAAAAGTTCCTAAAGTTTGAC CGAAGATATTCCTCCAATGTTACTTGCTCTTGAGTAATTGACCGTGCATT CCCCTGTAATGTACATTGGGCTCCAGTCTTCCCCATCATATTTCTTGCAG TTACATTATTAGCTATTCAACTTTCCACCCTACATATTCTCTATTTCAGC TTGGTAAGAGCACAATTATGGTGAATTACAATCCTGAAACTGTCAGTACA GACTATGATGAATGTGATCGATTGTACTTCGATGAAATCACATTTGAGGT AATTCTTTATCAACCGATAATTCAAATTGTCATTTTNTTCTGCGGTCATT CATTATCATGATTTTAACAGAAAAAAACAGTATTTCGGAATAAAAGCAGG TAAACCAATAGCTTAATTTGGTTACTAACATAAGCTGAAAATGATTTTCT TCTTCAGAAAATCACGATAAATATTCTTTATTGTTTTTAGGTTGGAGCTG GAAAGGACACCATTCCATGCAATATCCTACTGAAGGGGAAGCAGCTTGGA TTTTCAGATAAGCAAATTGCTAACTGCGTTCAAAGGTTGTGACTTTATCT TTAGACTTAGACTTAAACTTAGATTGAGTCAGATTAATTAAATTTTCTAG ACTTTACAAATAAAATTTCTTTAAAGAGTTCTTCAACGTCTTAGCCTAGT GAATCGGCGATGCCAGGATCAAACCGCTACTTCATCTTCTTGCTCTACTC TGATAACCGAACTTAATACGCTGCAAAAGAGTAGTCCAAAGTAAGTGGAT TATGAGTTCAACATTATGGAATGCAGACTAAGATTTATCAACTTGAACTT GAATGTTTTTCTCTTCAGTTCTGAACTGGTTATCCGCAAGTACCGTTATG AATGCAACATTTTGCCCTGTTTCAAGCAAATTGACACTGTTGCTGCAGAA TTCCCAGCTGAAGCTAACTATCTGTATTTAACTTACAATGGAGATTGTGA TGACGTCACATACGCAGAAAGCCAAAACAAAGTCATGGTTATTGGGTCAG GTGTCTACAGAATCGGAAGCAGTGTTGAATTTGATGCATGTGCTGTTGGA TGTATTCGAGAATTGAAGAGGGTAAGTATAGAAATGATTCTTAAGTCAAA TCAACTCAACGACTTAAGCTACCAAAATTACTTTGAAAAGTTCCTAAAGT TTGACCGAAGATATTCCTCCAATGTTACTTGCTCTTGAGTAATTGACCGT GCATTCCCCTGTAATGTACATTGGGCTCCAGTCTTCCCCATCATATTTCT TGCAGTTACATTATTAGCTATTCAACTTTCCACCCTACATATTCTCTATT TCAGCTTGGTAAGAGCACAATTATGGTGAATTACAATCCTGAAACTGTCA GTACAGACTATGATGAATGTGATCGATTGTACTTCGATGAAATCACATTT GAGGTAATTCTTTATCAACCGATAATTCAAATTGTCATTTTTCTGTTAAC CCTGAAAGCTGACAAGGTATTTGCTAATTTTAGTCCTAACTATTTCAAAG AGTCCCTGTGACTAATTCAACCTGCCTTCAAACCAAACAGATGACCTAAA CAGATTGAACAGAACTTTAGAAATCATCAAAACACGACTTGTCTTTTTTC CAGACAATCATGGATATCTACCATAAAGAAGACCCAGAAGGTATTATCTT ATCAATGGGAGGACAGGTTGCCAACAACATTGCTATGCATCTCCACAGAC AGGAAGTAAGGCTTTAACATCTGAAAACATTTACCAGAGTTCAGAAATTA TCCAAATAATATTCACATTCCTCATGTTTACTTTAATCTTCTTGCTACCC CCAATGTTTGTTTATAATTTGGAAAGTTCCCCTGGATGTTTGTCTATTTT TAAGAGTTTCCTTACAATCTTCATGTAATTGTAATGGAAATGGTAATGTC TTGGAAAAATATTATGACCAAAAACGTCATGTCATTTTTACTAAGATATT TGTTTTTCCATTAGGTGAGGATCCTTGGCACATCGCCAGAAATGATTGAC AACGCTGAAAACAGATTCAAATTCTCTCGTATGCTAGACAACATTGGAAT CCTACAACCAACATGGAAAGAGTTGACCACGATGGAGGTGAGCTCATCAG TTATTCATAATGCACCTATCAAACCTTGAACTTTGGTCTTACTTACTTAA AATGGATGTCTGTGTTTATTGCTTTTTATTGCTGATATGCCATCAAATAC AGAATATCTAACCCTGANAATATTATGGTCTTGGAAAAATATTATGACCA AAAACGTCACGTCATTTTTACTAAGATATTTGTTTTTCCATTAGGTGAGG ATCCTTGGCACATCGCCAGAAATGATTGACAACGCTGAAAACAGATTCAA ATTCTCTCGTATGCTAGACAACATTGGAATCCTACAACCAACATGGAAAG AGTTGACCACGATGGAGGTGAGCTCATCAGTTATTCATAATGCACCTATC AAACCTTGAACTTTGGTCTTACTTACTTAAAATGGATGTCTGTGTTTATT GCTTTTNTGATCGATTGTACTTCGATGAGATCACATTTGAGGTAATTCTT TATCAACCGATAATTCAAATTGTCATTTTTCTGTTAACCCTGAAAGCTGA CATGGTATTTGCTAATTTTAGTCCTAACTATTTCAAAGAGTCCCTGTGAC TAATTCAACCTGCCTTCAAACCAAACAGATGACCTAAACAGATTGAACAG AACTTTAGAAATCATCAAAACACGACTTGTCTTTTTTCCAGACAATCATG GATATCTACCATAAAGAAGACCCAGAAGGTATTATCTTATCAATGGGAGG ACAGGTTGCCAACAACATTGCTATGCATCTCCACAGACAGGAAGTAAGGC TTTAACATCTGAAAACATTTACCAGAGTTCAGAAATTATCCAAATAATAT TCACATTCCTCATGTTTACTTTAATCTTCTTGCTACCCCCAATGTTTGTT TATAATTTGGAAAGTTCCCCTGGATGTTTGTCTATTTTTAAGAGTTTCCT TACAATCTTCATGTAATTGTAATGGAAATGGTAAAATATTATGGTCTTGG AAAAATATTATGACCAAAAACGTCACGTCATTTTTACTAAGATATTTGTT TTTCCATTAGGTGAGGATCCTTGGCACATCGCCAGAAATGATTGACAACG CTGAAAACAGATTCAAATTCTCTCGTATGCTAGACAACATTGGAATCCTA CAACCAACATGGAAAGAGTTGACCACGATGGAGGTGAGCTCATCAGTTAT TCATAATGCACCTATCAAACCTTGAACTTTGGTCTTACTTACTTAAAATG GATGTCTGTGTTTATTGTATGGATATGCCATCAAATATAGAATATCTAAC CCTGATAAATTCAAACCCAAATCTCTTTGATGGAGTTTGTTACTGTCAAC CTTGGTTTGTGTTAGTTAAGTTTCTAATCCCAGATTTTCATTGCATCCTT ATTTAAGTTCTTCACGATTTGCTCTTAGCTATTTTGGATATTCAAACTCT GAATTTACAGATTTTGCCCGGGGGGACGGTATGTGAGGCAAAAAAAATGG CTTTTAGAATCGCACCCTTACAGTGCAGAAAAAATCGGTGAAATTCATAC CCTTACAGTGCATTTTTTCACATTTTAAACTCGTTTAGAGCATGAAAAGA TTTTCGAGAAAAAATTAGCAATTTTTCCTAGATTTGCTGAAATTTTCACC CATACAGTGCATTTATCAAAAGTCCACCCTTACAGTGCATTTCTGATATT TTGAAAAACATACCCTTAACCACCGCACATACCCGTCGGNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCCCCCCCCCCCCA CGAGATTTTGCAGACAAAATAATTTACTATTCAGTCATTACCATTTCTGC ATTTTGTTTAAGGAAGCCTATCAATTCTGCACCAAAGTTGGTTACCCAGT GCTGGTACGACCTTCATACGTGTTGAGTGGAGCTGCCATGAATGTTGTTT ATGCTGAAGATGATTTAGAATCATATCTTGGATCTGCTGTCTCCATCTCT AAGGAGCATCCAGTTGTCATCTCCAAATTTATATCCAATGCTAAAGTAAC TGCAATTTATTCTACCTATAGTTCGTTTTGAATTGTTGATGTGGAAATAC CAATTTCTGCACAGATTTTTCGATAGGAAAAAAAAACAATCTGAATATTC AACAATGTTTTTTTTAAGTTTTCTTCTACAAACCGAAATAGTTCAATTCT TTGGTAAATGGTTACCCGAACTCTACGAGTCTATCTTCTTTGAATCTAGC TTTATTCTTAACCAGGAAATCTTAGTTACGTTTTTTGCAGTCGCACTTTG AATCCAGTCTGTGTAAAAGTTCCAACATCGTTTCTTAAAATCTACCCGAA CGCGACCGTAGTACAGTGGTAGAGCATCCGGCTGCGGTTCGCAAGGTTGT GGGTTCAACCCCCAGCCGGGTCATACCAAAGATTCCCAAAATGGTACTTG ATGCCTCTCTGCTTGATGCTCAGCACNAATACCAATTTCTGCACAGATTT TTCGATAAGAAAAAAAAACAATCTGAATATTCAACAATGTTTTTTTTAAG TTTTCTTCTACAAACCGAAATAGTTCAATTCTTTGGTAAATGGTTACCCG AACTCTACGAGTCTATCTTCTTTGAATCTAGCTTTATTCTTAACCAGGAA ATCTTAGTTACGTTTTTTGCAGTCGCACTTTGAATCCAGTCTGTGTAAAA GTTCCAACATCGTTTCTTAAAATCTACCCGAACGCTACCAACTTACAATT ACTTAATCGATTTCTTTCAACCAGGAAATTGACGTTGATGCCGTTGCCAA CGACGGTGAAGTGATGGCCATGGTCGTCTCTGAACACGTTGAAAACGCGG GTGTCCACTCTGGTGACGCAACCATGATCTGTCCACCACAAGACATCAAT ACGGAAACCATGGGACGGATCAAACAGATCTGTATTGCAGTTGGAAACGC CCTCAATGTGTCTGGTCCTTTCAATATGCAACTTATTGCTAAGGTATAAA GTCTGTTCATCTCTATACTTTCAATTAATTTGACACTTTGTAGAATAGTG AATTCAAAGTACTCCTTGACGACGTATAGAGAAAGGAAAACTTGCGTTCT TCCAATACGCCTAATTACTTTTACACCACTATCACGTCTCCTGTGTCAAA AAAACGTAATGTTTTTGTGAGTACGTCAACTTCATTATTTTTATGAGAAT CTAAAGAACGGGAAATTCTCCTTCGGTAATGGTATGCTATTTTACCAAGG CAAGGAATACACAACATCTCATGGATCTTCATTTACTCTTTTAGGACAAT CAATTGAAGGTGATCGAATGCAATTTACGGGTGTCTCGGTCCTTCCCTTT TGTTTCCAAAACTCTAGATTGTGATTTGGTTGCCTTGGCAACCAAAATCA TCGTTGGTGCTCCTGCTGAACCTGCATTCAACATTATGGATAAGTGTGAG AAGATCGGCTGTAAGGTATGAACAGAAATAAATATTCCTCCTTCAAAAGC AAATTTCAAGTTTAAATGATTGAAAAATTGGTCATATTTTTGTCCAGAAA TATTAACCGTCATTTTCTCCTGTAAGAGTCCACTTTTGTCAAACAGATAG CTGATTGTAGTCCGAATGCCTATACTCAAGTACTTTAGTATCACAACTAT TTGTCCGCTCGCCATACCTTCATAACTCAGAACCAAAAGCATCGAAGAAA TTTTACATATATTTTGGATTTATCTCTAAGGGGTATCTACATTTTCTTTT GAGCTTGAAAAGACGCATAGACACATAGTGGCTATGTTATAAATCAACCG GACAGTCCTGAAATTGAAATCAACTTTCTGTCTCTCTGCAGGTGCCACAA TTTTCATTTTCACGACTTGCTGGAGCTGACGTTCAACTTGGAGTAGAGAT GGCAAGCACAGGAGAAGTAGCATGCTTCGGTGAAAATAGATACGAAGCTT ACTTGAAGGCCTTGATGAGCACAGGTTTCAAATTACCCAAGAAAAACATA CTGCTGACTGTTGGTAGTTATAAGGTAATAATTCTTCATTTTATTTCAAT ACAATTTAGTTTTTCTGGTGGTAATTCGTAGTGGTGAAATTTGTTTTTTA GATTTAAACTATCCACAAAAACTTTTATTCAGGCAGTCTTGACGCTCCAT TGTTCTCATTATCTCGAAATGAAAACAAAGTTTCATCCATTGAATTTAGA AGATTTTTAGGATCTTCAACATAATCAGCCTGTAGTATATAAACCAGACT TCAAACAATTATGTTCACTACTTCCACACTCTCACCTTATCATTGATCTG GATTGTTTTAGGCGAAGAAAGAAATGTTGCCAAGTGTTCGTTTACTGGAG AAGATGGGATACGAATTGTATGCTAGCATGGGTACCGGTGACTTCTATCA AGAACATGGTGTACAGGTCTGTCGAGTATCTTAGTTGAGGGCGTTGGTCT TTATTCTCTTAGCTTAGAGGTGTCAGCCTTTATTCTCTGAGCTAAGGACA TTGGTTTCTCTGCTCTCTTAGCTAAACATGTTTGTCTCTGCTCTCCCTTA AAAGCCTTTATCAAAAGACATGGAATGTTTATGAATAAAATGTTATTAAA ATAAGCGGGATCATTTTTGGGTACTTTGTTCGCTTTCATGATAAATTGTA TGTCCAGTAGCACAGAAGTCTTTATATTTCAGAGTTGAAAGTTAAGTTAC GAAGTTTCTTGTACATGAAATTAGGTTCTTTTTTTGAACTGTCTAACTCA TCCAACATTTCGTCAAATTAATTGGTTCTTGATTTCTACCGGACCAAATA GCTTCGACATTTGTCTTTCAGGTCCAAATCATTGATTGGCCTTTCGAGGA GAATGGAACTGAGGGTCAGGAAGAGAGCATTCAAGACTACCTCACACAGA ACAAATTTGATTTGGTCATCAACATTCCAATGAGGGGTAGTGGTACCAAG AAGAAGTCTCATTTCATCACACATGGATATCGCACCCGACGAATGGCCAT CGATCATTCCGTCTCATTGATCACCAACATTAAGTGTGCCAAACTCTT
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000986XLOC_000986Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001878-exon-sc0000012-1575043694:107947..108102TCONS_00001878-exon-sc0000012-1575043694:107947..108102Clytia hemisphaericaexon
TCONS_00001878-exon-sc0000012-1575043694:107479..107700TCONS_00001878-exon-sc0000012-1575043694:107479..107700Clytia hemisphaericaexon
TCONS_00001878-exon-sc0000012-1575043694:106941..107129TCONS_00001878-exon-sc0000012-1575043694:106941..107129Clytia hemisphaericaexon
TCONS_00001878-exon-sc0000012-1575043694:106357..106590TCONS_00001878-exon-sc0000012-1575043694:106357..106590Clytia hemisphaericaexon
TCONS_00001878-exon-sc0000012-1575043694:105977..106114TCONS_00001878-exon-sc0000012-1575043694:105977..106114Clytia hemisphaericaexon
TCONS_00001878-exon-sc0000012-1575043694:105379..105546TCONS_00001878-exon-sc0000012-1575043694:105379..105546Clytia hemisphaericaexon
TCONS_00001878-exon-sc0000012-1575043694:105043..105137TCONS_00001878-exon-sc0000012-1575043694:105043..105137Clytia hemisphaericaexon
TCONS_00001878-exon-sc0000012-1575043694:103332..103584TCONS_00001878-exon-sc0000012-1575043694:103332..103584Clytia hemisphaericaexon
TCONS_00001878-exon-sc0000012-1575043694:103000..103098TCONS_00001878-exon-sc0000012-1575043694:103000..103098Clytia hemisphaericaexon
TCONS_00001878-exon-sc0000012-1575043694:102698..102799TCONS_00001878-exon-sc0000012-1575043694:102698..102799Clytia hemisphaericaexon
TCONS_00001878-exon-sc0000012-1575043694:102316..102438TCONS_00001878-exon-sc0000012-1575043694:102316..102438Clytia hemisphaericaexon
TCONS_00001878-exon-sc0000012-1575043694:100208..100390TCONS_00001878-exon-sc0000012-1575043694:100208..100390Clytia hemisphaericaexon
TCONS_00001878-exon-sc0000012-1575043694:99260..99478TCONS_00001878-exon-sc0000012-1575043694:99260..99478Clytia hemisphaericaexon
TCONS_00001878-exon-sc0000012-1575043694:98788..98958TCONS_00001878-exon-sc0000012-1575043694:98788..98958Clytia hemisphaericaexon
TCONS_00001878-exon-sc0000012-1575043694:98229..98411TCONS_00001878-exon-sc0000012-1575043694:98229..98411Clytia hemisphaericaexon
TCONS_00001878-exon-sc0000012-1575043694:97837..97941TCONS_00001878-exon-sc0000012-1575043694:97837..97941Clytia hemisphaericaexon
TCONS_00001878-exon-sc0000012-1575043694:97205..97431TCONS_00001878-exon-sc0000012-1575043694:97205..97431Clytia hemisphaericaexon
TCONS_00001878-exon-sc0000012-1510915933:107947..108102TCONS_00001878-exon-sc0000012-1510915933:107947..108102Clytia hemisphaericaexon
TCONS_00001878-exon-sc0000012-1510915933:107479..107700TCONS_00001878-exon-sc0000012-1510915933:107479..107700Clytia hemisphaericaexon
TCONS_00001878-exon-sc0000012-1510915933:106941..107129TCONS_00001878-exon-sc0000012-1510915933:106941..107129Clytia hemisphaericaexon
TCONS_00001878-exon-sc0000012-1510915933:106357..106590TCONS_00001878-exon-sc0000012-1510915933:106357..106590Clytia hemisphaericaexon
TCONS_00001878-exon-sc0000012-1510915933:105977..106114TCONS_00001878-exon-sc0000012-1510915933:105977..106114Clytia hemisphaericaexon
TCONS_00001878-exon-sc0000012-1510915933:105379..105546TCONS_00001878-exon-sc0000012-1510915933:105379..105546Clytia hemisphaericaexon
TCONS_00001878-exon-sc0000012-1510915933:105043..105137TCONS_00001878-exon-sc0000012-1510915933:105043..105137Clytia hemisphaericaexon
TCONS_00001878-exon-sc0000012-1510915933:103332..103584TCONS_00001878-exon-sc0000012-1510915933:103332..103584Clytia hemisphaericaexon
TCONS_00001878-exon-sc0000012-1510915933:103000..103098TCONS_00001878-exon-sc0000012-1510915933:103000..103098Clytia hemisphaericaexon
TCONS_00001878-exon-sc0000012-1510915933:102698..102799TCONS_00001878-exon-sc0000012-1510915933:102698..102799Clytia hemisphaericaexon
TCONS_00001878-exon-sc0000012-1510915933:102316..102438TCONS_00001878-exon-sc0000012-1510915933:102316..102438Clytia hemisphaericaexon
TCONS_00001878-exon-sc0000012-1510915933:100208..100390TCONS_00001878-exon-sc0000012-1510915933:100208..100390Clytia hemisphaericaexon
TCONS_00001878-exon-sc0000012-1510915933:99260..99478TCONS_00001878-exon-sc0000012-1510915933:99260..99478Clytia hemisphaericaexon
TCONS_00001878-exon-sc0000012-1510915933:98788..98958TCONS_00001878-exon-sc0000012-1510915933:98788..98958Clytia hemisphaericaexon
TCONS_00001878-exon-sc0000012-1510915933:98229..98411TCONS_00001878-exon-sc0000012-1510915933:98229..98411Clytia hemisphaericaexon
TCONS_00001878-exon-sc0000012-1510915933:97837..97941TCONS_00001878-exon-sc0000012-1510915933:97837..97941Clytia hemisphaericaexon
TCONS_00001878-exon-sc0000012-1510915933:97205..97431TCONS_00001878-exon-sc0000012-1510915933:97205..97431Clytia hemisphaericaexon
TCONS_00001878-exon-sc0000012-1491911889:107947..108102TCONS_00001878-exon-sc0000012-1491911889:107947..108102Clytia hemisphaericaexon
TCONS_00001878-exon-sc0000012-1491911889:107479..107700TCONS_00001878-exon-sc0000012-1491911889:107479..107700Clytia hemisphaericaexon
TCONS_00001878-exon-sc0000012-1491911889:106941..107129TCONS_00001878-exon-sc0000012-1491911889:106941..107129Clytia hemisphaericaexon
TCONS_00001878-exon-sc0000012-1491911889:106357..106590TCONS_00001878-exon-sc0000012-1491911889:106357..106590Clytia hemisphaericaexon
TCONS_00001878-exon-sc0000012-1491911889:105977..106114TCONS_00001878-exon-sc0000012-1491911889:105977..106114Clytia hemisphaericaexon
TCONS_00001878-exon-sc0000012-1491911889:105379..105546TCONS_00001878-exon-sc0000012-1491911889:105379..105546Clytia hemisphaericaexon
TCONS_00001878-exon-sc0000012-1491911889:105043..105137TCONS_00001878-exon-sc0000012-1491911889:105043..105137Clytia hemisphaericaexon
TCONS_00001878-exon-sc0000012-1491911889:103332..103584TCONS_00001878-exon-sc0000012-1491911889:103332..103584Clytia hemisphaericaexon
TCONS_00001878-exon-sc0000012-1491911889:103000..103098TCONS_00001878-exon-sc0000012-1491911889:103000..103098Clytia hemisphaericaexon
TCONS_00001878-exon-sc0000012-1491911889:102698..102799TCONS_00001878-exon-sc0000012-1491911889:102698..102799Clytia hemisphaericaexon
TCONS_00001878-exon-sc0000012-1491911889:102316..102438TCONS_00001878-exon-sc0000012-1491911889:102316..102438Clytia hemisphaericaexon
TCONS_00001878-exon-sc0000012-1491911889:100208..100390TCONS_00001878-exon-sc0000012-1491911889:100208..100390Clytia hemisphaericaexon
TCONS_00001878-exon-sc0000012-1491911889:99260..99478TCONS_00001878-exon-sc0000012-1491911889:99260..99478Clytia hemisphaericaexon
TCONS_00001878-exon-sc0000012-1491911889:98788..98958TCONS_00001878-exon-sc0000012-1491911889:98788..98958Clytia hemisphaericaexon
TCONS_00001878-exon-sc0000012-1491911889:98229..98411TCONS_00001878-exon-sc0000012-1491911889:98229..98411Clytia hemisphaericaexon
TCONS_00001878-exon-sc0000012-1491911889:97837..97941TCONS_00001878-exon-sc0000012-1491911889:97837..97941Clytia hemisphaericaexon
TCONS_00001878-exon-sc0000012-1491911889:97205..97431TCONS_00001878-exon-sc0000012-1491911889:97205..97431Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000012supercontigsc0000012:97205..108102 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
3.1262 4.13862 0.832955 0.346925 3.54906 3.66508 0.654796 0.354623 0.869346 1.06949 2.8708 2.326 1.93794 2.46251 1.82831 1.97329 1.00274 1.47262 0.634507 0.676961 1.43081 0.459945 3.41253 3.73121 6.71351e-05 0.74443 0.47744 0.538599 3.68274 4.03675
Blast
BLAST of TCONS_00001878 vs. Swiss-Prot (Human)
Match: PYR1 (CAD protein OS=Homo sapiens GN=CAD PE=1 SV=3)

HSP 1 Score: 1280.77 bits (3313), Expect = 0.000e+0
Identity = 651/954 (68.24%), Postives = 771/954 (80.82%), Query Frame = 1
Query:   10 GILEKYNVAVLGTPTKSIEWTEDRKMFSDKMGEIGEKVAPSSVAYTVDEAITAANRLGYPVXXXXXXXXXXXXXXXXXNDNELKKLAASAFAHSKQCLVDKSLKGWKEVEYEVVRDAYDNCITVCNMENFDPLGIHTGESIVVAPSQTLTNEEYNMLRRTAIKVIRKLGVVGECNIQYALHPDSKEFYIIEVNXXXXXXXXXXXXXTGYPLAYVAAKLALGIPLPKLRNSVTNSTTACFEPSLDYCVVKVPRWDLDKFQRVSTKIGSSMKSVGEVMAIGRSFEEAIQKSLRMVDDSNLGFDANNLELDEQVLVEPSDKRIFHVAAALRRGYSIDQLYELTRIDKWFLSKLAKIINYAKMLEEKYPKVGAGKDTIPCNILLKGKQLGFSDKQIANCVQSSELVIRKYRYECNILPCFKQIDTVAAEFPAEANYLYLTYNGDCDDVTYAESQNKVMVIGSGVYRIGSSVEFDACAVGCIRELKRLGKSTIMVNYNPETVSTDYDECDRLYFDEITFETIMDIYHKEDPEGIILSMGGQVANNIAMHLHRQEVRILGTSPEMIDNAENRFKFSRMLDNIGILQPTWKELTTMEEAYQFCTKVGYPVLVRPSYVLSGAAMNVVYAEDDLESYLGSAVSISKEHPVVISKFISNAKEIDVDAVANDGEVMAMVVSEHVENAGVHSGDATMICPPQDINTETMGRIKQICIAVGNALNVSGPFNMQLIAKDNQLKVIECNLRVSRSFPFVSKTLDCDLVALATKIIVGAPAEPAFNIMDKCEKIGCKVPQFSFSRLAGADVQLGVEMASTGEVACFGENRYEAYLKALMSTGFKLPKKNILLTVGSYKAKKEMLPSVRLLEKMGYELYASMGTGDFYQEHGVQVQIIDWPFEE--NGTEGQEESIQDYLTQNKFDLVINIPMRGSGTKKKSHFITHGYRTRRMAIDHSVSLITNIKCAKL 2865
            G+L +Y V VLGTP ++IE TEDR+ F+ +M EIGE VAPS  A ++++A  AA RLGYPVL+RAAFALGGLGSGFASN  EL  L A AFAH+ Q LVDKSLKGWKE+EYEVVRDAY NC+TVCNMEN DPLGIHTGESIVVAPSQTL + EY +LR+TAIKV + LG+VGECN+QYAL+P+S+++YIIEVNARLSRSSALASKATGYPLAYVAAKLALGIPLP+LRNSVT  T A FEPS+DYCVVK+PRWDL KF RVSTKIGS MKSVGEVM IGRSFEEA QK+LRMVD++ +GFD     + +  L  P+DKRIF VAAAL  GYS+D+LYELTRID+WFL ++ +II +A++LE+           +P ++L + K LGFSDKQIA  V S+EL +RK R E  I P  KQIDTVAAE+PA+ NYLYLTY G   D+T+      V+V+GSGVYRIGSSVEFD CAVGCI++L+++G  TIMVNYNPETVSTDYD CDRLYFDEI+FE +MDIY  E+PEG+ILSMGGQ+ NN+AM LHRQ+ R+LGTSPE ID+AENRFKFSR+LD IGI QP W+EL+ +E A QFC  VGYP +VRPSYVLSGAAMNV Y + DLE +L SA ++SKEHPVVISKFI  AKEIDVDAVA+DG V A+ +SEHVENAGVHSGDAT++ PPQDI  +T+ RIK I  AVG  L V+GPFN+QLIAKD+QLKVIECN+RVSRSFPFVSKTL  DLVALAT++I+G   EP   +M     +G KVPQFSFSRLAGADV LGVEM STGEVA FGE+R EAYLKA++STGFK+PKKNILLT+GSYK K E+LP+VRLLE +GY LYAS+GT DFY EHGV+V  +DW FEE  +G    + SI + L +  F+LVIN+ MRG+G ++ S F+T GYRTRR+A D SV LI +IKC KL
Sbjct:  492 GVLARYGVRVLGTPVETIELTEDRRAFAARMAEIGEHVAPSEAANSLEQAQAAAERLGYPVLVRAAFALGGLGSGFASNREELSALVAPAFAHTSQVLVDKSLKGWKEIEYEVVRDAYGNCVTVCNMENLDPLGIHTGESIVVAPSQTLNDREYQLLRQTAIKVTQHLGIVGECNVQYALNPESEQYYIIEVNARLSRSSALASKATGYPLAYVAAKLALGIPLPELRNSVTGGT-AAFEPSVDYCVVKIPRWDLSKFLRVSTKIGSCMKSVGEVMGIGRSFEEAFQKALRMVDENCVGFDHTVKPVSDMELETPTDKRIFVVAAALWAGYSVDRLYELTRIDRWFLHRMKRIIAHAQLLEQHR------GQPLPPDLLQQAKCLGFSDKQIALAVLSTELAVRKLRQELGICPAVKQIDTVAAEWPAQTNYLYLTYWGTTHDLTFRTPH--VLVLGSGVYRIGSSVEFDWCAVGCIQQLRKMGYKTIMVNYNPETVSTDYDMCDRLYFDEISFEVVMDIYELENPEGVILSMGGQLPNNMAMALHRQQCRVLGTSPEAIDSAENRFKFSRLLDTIGISQPQWRELSDLESARQFCQTVGYPCVVRPSYVLSGAAMNVAYTDGDLERFLSSAAAVSKEHPVVISKFIQEAKEIDVDAVASDGVVAAIAISEHVENAGVHSGDATLVTPPQDITAKTLERIKAIVHAVGQELQVTGPFNLQLIAKDDQLKVIECNVRVSRSFPFVSKTLGVDLVALATRVIMGEEVEPV-GLMTGSGVVGVKVPQFSFSRLAGADVVLGVEMTSTGEVAGFGESRCEAYLKAMLSTGFKIPKKNILLTIGSYKNKSELLPTVRLLESLGYSLYASLGTADFYTEHGVKVTAVDWHFEEAVDGECPPQRSILEQLAEKNFELVINLSMRGAGGRRLSSFVTKGYRTRRLAADFSVPLIIDIKCTKL 1435          

HSP 2 Score: 167.162 bits (422), Expect = 8.625e-42
Identity = 116/392 (29.59%), Postives = 190/392 (48.47%), Query Frame = 1
Query: 1360 NKVMVIGSGVYRIGSSVEFDACAVGCIRELKRLGKSTIMVNYNPETVSTDYDECDRLYFDEITFETIMDIYHKEDPEGIILSMGGQVANNIAMH------LHRQEVRILGTSPEMIDNAENRFKFSRMLDNIGILQPTWKELTTMEEAYQFCTKVGYPVLVRPSYVLSGAAMNVVYAEDDLESYLGSAVSISKEHPVVISKFISNAKEIDVDAVAND-GEVMAMVVSEHVENAGVHSGDATMICPPQDINTETMGRIKQICIAVGNALNVSGPFNMQ--LIAKDNQLKVIECNLRVSRSFPFVSKTLDCDLVALATKIIVGAP----------AEPAFNI-MDKCEKIGCKVPQFSFSRLAGADVQLGVEMASTGEVACFGENRYEAYLKAL 2475
             KV+++GSG   IG + EFD      I+ LK     T+++N N  TV T     D++YF  IT   +  +   E P+G++L+ GGQ A N  +       L R  VR+LGT  E I+  E+R  F+  +  IG      +   ++E+A     ++GYPVLVR ++ L G         ++L + +  A + + +  V++ K +   KEI+ + V +  G  + +   E+++  G+H+G++ ++ P Q +N      ++Q  I V   L + G  N+Q  L  +  Q  +IE N R+SRS    SK     L  +A K+ +G P             AF   +D C     K+P++  S+      ++G  M S GEV   G +  EA+ KAL
Sbjct:  394 RKVLILGSGGLSIGQAGEFDYSGSQAIKALKEENIQTLLINPNIATVQTSQGLADKVYFLPITPHYVTQVIRNERPDGVLLTFGGQTALNCGVELTKAGVLARYGVRVLGTPVETIELTEDRRAFAARMAEIGEHVAPSEAANSLEQAQAAAERLGYPVLVRAAFALGGLGSGFASNREELSALVAPAFAHTSQ--VLVDKSLKGWKEIEYEVVRDAYGNCVTVCNMENLDPLGIHTGESIVVAPSQTLNDREYQLLRQTAIKVTQHLGIVGECNVQYALNPESEQYYIIEVNARLSRSSALASKATGYPLAYVAAKLALGIPLPELRNSVTGGTAAFEPSVDYCV---VKIPRWDLSKFLRVSTKIGSCMKSVGEVMGIGRSFEEAFQKAL 780          
The following BLAST results are available for this feature:
BLAST of TCONS_00001878 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
PYR18.625e-4268.24CAD protein OS=Homo sapiens GN=CAD PE=1 SV=3[more]
back to top