Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001872 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001872
Unique NameTCONS_00001872
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length7762

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001872 ID=TCONS_00001872|Name=TCONS_00001872|organism=Clytia hemisphaerica|type=transcript|length=7762bp
CAATTATCACCGATTTAATTTTCGCGCCAATTAAATCGGGGaagtggttt
gttttgatttggtttcTAATGCCATCGCTATTTTGCAGAATGATTATTTT
ATCAGTAGGAGCCAGCCAAGCCTCTTGGTAAATATCGGTCCGCAAAATAT
ACATAACAGCACGTGCTAATTTTTTTCTCCGACCTCAAAAGCATGTTGTA
AAATTTGGTACTGTCACCTGATCTGATGACTTGACTTGGTCACATATCAG
CTGATAAGTACATTTCACCTATCATCCTCAAAACTGACTTGCTCAGAAGG
AAAACCGAAATGGCGACACTTATTCTTGATGATGGCACCAAATATCATGG
TCAAATTTTTGGTGATGAAAGAAGTATTGCAGGAGAAGTTGTCTTCCAAA
CTGGTATGGTTGGTTACCCAGAATCATTGACAGATCCTTCATACAACAGT
CAAATCTTGGTATTGACGTATCCACTGATTGGTAATTATGGTATACCAAA
CGATTCTCGTGATGAACATGGCAtgctcaaattttttgaatctgAAAAGA
TTTGGAACAATGGTATGATTGTAGGAGACTTGACTGAGGACTACAGCCAT
TGGTTGGCAACCAAATCACTTTCAGAGTGGCTGAAGGAACACAAAATACC
TGGAATTACTGGTATTGATACCAGAGCATTAACAAAGAAGTTGAGAGAAA
ATGGAACAATGTTAGGAAAGATTGTTTTGGATGGAGAGGATGAAGCAAGT
GTTCCATTTGATGATCCAAACAAAAGGAATTTGATTGCTGAAGTCTCTTG
CAAGGAACCTAAACTTTACAATCCTAAGGGTAAAATAAAGATGATTGCTG
TAGACTTTGGTATCAAATACAACCAGATCCGGTGTTTGATTGATTGTGAT
TGTCAGGTTCTAGTTGTTCCATGGGATTATGACTATAGTACATTGTTAAA
GAACAAAGAATATGATGGTCTGTTTATGAGCAATGGTCCTGGAGATCCTA
GCCTTTGTCAAGTTTCAATTGACACCCTCCGTAAAGTCATTACAGAATTG
CCAGATGTGCCAGTCTTTGGTATTTGCATGGGTCATCAGATCTTATCTCT
TGCTGCTGGATGTGGGTCCTACAAAATGAAATATGGTAACAGAGGACATA
ACCAACCTGCAACCCATTTGGAAACTCAACGTTGCTTCATCACTTGCCAA
AATCATGGCTTTGCAATTGACACAGACAGCTTACCAAAAGAATGgtctgt
tttgtttacaaatgaGAATGATGGCAGTAATGAAGGCATTGTTCACAACA
CAAAGCCAATCTTCTCAGTTCAGTTTCATCCTGAACATCAAGGAGGACCA
AGAGATTTGGAGCTTTTGTTTGGCTTTTTTGTGGATATTGTAAACAAACT
GAAAATCGATTCTAACCTCTGCTTACGAACCATGCTGAAAGAAACGTTGA
CTTTCCACCCAGCAGAAGAAACAAGATCCAGAGCATTCAAACCAAAGAAG
GTCTTGATTTTGGGATCTGGTGGCTTATCTATTGGTCAAGCCGGAGAATT
TGATTATTCTGGCTCTCAAGCTATCAAAGCATTAAAAGAAGAGAAGATTC
ACACAGTTTTGATCAATCCTAATATTGCTACAGTGCAAACTTCCAAAGGA
CTTGCAGATAAAACTTACTTCCTTCCTGTTAACTTTGAATTCACAAGCAA
GGTGATTGAAGTAGAAAGACCAGATGGCATTCTGTTATCATTTGGTGGAC
AAACAGCATTGAACTGTGGACTGCTATTGAAAGAGAGGGGAATTTTAGAG
AAATACAATGTTGCTGTTCTTGGTACACCTACCAAATCGATTGAATGGAC
AGAAGATAGGAAAATGTTTTCAGACAAGATGGGAGAGATTGGTGAGAAAG
TTGCACCAAGCTCAGTGGCTTATACTGTGGATGAGGCTATCACAGCAGCT
AACAGGCTAGGATATCCAGTGTTGTTACGTGCAGCATTTGCACTAGGTGG
ACTTGGATCTGGTTTTGCTTCCAATGACAATGAGCTCAAAAAGCTTGCAG
CATCGGCTTTTGCACATTCCAAACAGTGTCTAGTTGACAAGTCACTGAAA
GGATGGAAAGAAGTTGAATATGAAGTTGTTAGAGATGCTTATGACAACTG
TATCACTGTTTGTAATATGGAAAACTTTGACCCTTTGGGAATCCATACGG
GTGAATCAATTGTTGTTGCACCAAGTCAAACACTAACAAATGAGGAATAC
AATATGCTTAGAAGAACAGCCATCAAAGTCATCCGTAAACTTGGTGTTGT
TGGTGAATGTAACATCCAGTATGCTTTACACCCTGACTCAAAAGAGTTCT
ACATCATTGAGGTCAATGCTCGTCTCTCCAGAAGTTCAGCTCTTGCTTCC
AAAGCAACTGGATACCCATTGGCTTACGTTGCTGCTAAACTTGCACTTGG
TATTCCTCTACCAAAACTGAGAAATTCTGTCACCAATTCAACTACCGCTT
GTTTTGAGCCCTCTTTGGATTATTGTGTTGTGAAAGTTCCTCGATGGGAT
CTGGACAAATTTCAGAGGGTTTCAACAAAGATTGGATCTTCGATGAAGAG
TGTTGGTGAAGTAATGGCTATTGGAAGAAGTTTTGAGGAAGCCATTCAAA
AGAGTTTGAGAATGGTTGACGATTCAAACCTTGGTTTTGATGCAAACAAC
CTCGAGTTGGATGAACAGGTCTTAGTTGAGCCCTCTGACAAAAGAATCTT
TCATGTTGCTGCTGCACTCCGTAGAGGATATTCTATTGATCAGCTGTATG
AGCTCACTCGTATTGATAAGTGGTTTTTGAGCAAGCTAGCAAAAATAATC
AACTATGCAAAAATGCTGGAAGAGAAATACCCAAAGGTTGGAGCTGGAAA
GGACACCATTCCATGCAATATCCTACTGAAGGGGAAGCAGCTTGGATTTT
CAGATAAGCAAATTGCTAACTGCGTTCAAAGTTCTGAACTGGTTATCCGC
AAGTACCGTTATGAATGCAACATTTTGCCCTGTTTCAAGCAAATTGACAC
TGTTGCTGCAGAATTCCCAGCTGAAGCTAACTATCTGTATTTAACTTACA
ATGGAGattgtgatgacgtcacatacGCAGAAAGCCAAAACAAAGTCATG
GTTATTGGGTCAGGTGTCTACAGAATCGGAAGCAGTGTTGAATTTGATGC
ATGTGCTGTTGGATGTATTCGAGAATTGAAGAGGCTTGGTAAGAGCACAA
TTATGGTGAATTACAATCCTGAAACTGTCAGTACAGACTATGATGAATGT
GATCGATTGTACTTCGATGAAATCACATTTGAGACAATCATGGATATCTA
CCATAAAGAAGACCCAGAAGGTATTATCTTATCAATGGGAGGACAGGTTG
CCAACAACATTGCTATGCATCTCCACAGACAGGAAGTGAGGATCCTTGGC
ACATCGCCAGAAATGATTGACAACGCTGAAAACAGATTCAAATTCTCTCG
TATGCTAGACAACATTGGAATCCTACAACCAACATGGAAAGAGTTGACCA
CGATGGAGGAAGCCTATCAATTCTGCACCAAAGTTGGTTACCCAGTGCTG
GTACGACCTTCATACGTGTTGAGTGGAGCTGCCATGAATGTTGTTTATGC
TGAAGATGATTTAGAATCATATCTTGGATCTGCTGTCTCCATCTCTAAGG
AGCATCCAGTTGTCATCTCCAAATTTATATCCAATGCTAAAGAAATTGAC
GTTGATGCCGTTGCCAACGACGGTGAAGTGATGGCCATGGTCGTCTCTGA
ACACGTTGAAAACGCGGGTGTCCACTCTGGTGACGCAACCATGATCTGTC
CACCACAAGACATCAATACGGAAACCATGGGACGGATCAAACAGATCTGT
ATTGCAGTTGGAAACGCCCTCAATGTGTCTGGTCCTTTCAATATGCAACT
TATTGCTAAGGACAATCAATTGAAGGTGATCGAATGCAATTTACGGGTGT
CTCGGTCCTTCCCTTTTGTTTCCAAAACTCTAGATTGTGATTTGGTTGCC
TTGGCAACCAAAATCATCGTTGGTGCTCCTGCTGAACCTGCATTCAACAT
TATGGATAAGTGTGAGAAGATCGGCTGTAAGGTGccacaattttcatttt
cacgaCTTGCTGGAGCTGACGTTCAACTTGGAGTAGAGATGGCAAGCACA
GGAGAAGTAGCATGCTTCGGTGAAAATAGATACGAAGCTTACTTGAAGGC
CTTGATGAGCACAGGTTTCAAATTACCCAAGAAAAACATACTGCTGACTG
TTGGTAGTTATAAGGCGAAGAAAGAAATGTTGCCAAGTGTTCGTTTACTG
GAGAAGATGGGATACGAATTGTATGCTAGCATGGGTACCGGTGACTTCTA
TCAAGAACATGGTGTACAGGTCCAAATCATTGATTGGCCTTTCGAGGAGA
ATGGAACTGAGGGTCAGGAAGAGAGCATTCAAGACTACCTCACACAGAAC
AAATTTGATTTGGTCATCAACATTCCAATGAGGGGTAGTGGTACCAAGAA
GAAGTCTCATTTCATCACACATGGATATCGCACCCGACGAATGGCCATCG
ATCATTCCGTCTCATTGATCACCAACATTAAGTGTGCCAAACTCTTCTGT
GAAGCATTGTTCAAAGTGGGCAGCAAGATCGAAGTGAAAACACACATTGA
TTGCATTTCATCGGGAAACATTGTGCGATTGCCAGGTCTCATTGATGTCC
ACGTACACTTGCGACAACCTGGTGCCGAGTACAAAGAAGATTTCGATAGC
GGTACTGCAGCCGCACTGGCCGGTGGCGTCACCATGGTGCTGTGTATGCC
GAACACCAAGCCAGCTGTGGTGGATCAACCCACTTTCCAGCTTGCGCACC
AATTGGCCATTAAGAACGCTCGCTGTGATTTCGCCTTGTACGCTGGTGCC
AGTTCAACCAATGCTCTAATGTTGCCAAAGATTGCACCAGGATGTGCTGG
TCTCAAAATGTACCTCAACGATACTTACACTACCTTGAAGATGGACAACC
TCNAAGATTGCACCAGGTTGTGCTGGTCTCAAAATGTACCTCAACGATAC
TTACACTACCTTGAAGATGGACAACCTCTCTGATTGGATGAAACATTTCG
AGAACTGGCCTAAACACTTGCCCATTGTCTGTCATGCAGAAAGCCAGACC
ACTGCTGCTGTTATCCTGATGTCTGAGCTGTACAACAGACCGGTCCATAT
TGCTCACGTTGCCAGGAAAGAAGAGATCCTTGTTATCAAGGCTGCTAAGA
AGAAAGGGCTTCAAGTGACCTGTGAAGTTGCACCCCACCATCTCTTCCTT
TCCACTGACGATACCAAACGTATCGGTGAAGGACGTGCCAGGGTCAAGCC
TCAAATTTGCAGTGCTGAAGACCAAAAAGCATTGTGGGAAAATATGGACT
TCATTGATTGCTTTGCCACTGACCACGCACCTCATCATGTGGACGAGAAG
AATTCTGAAAACCCTCCTCCAGGTTTCCCAGGCCTCGAAACTATGCTACC
ATTATTGTTGACTGCAGTCAAAGATGGCCGACTCAcccttgatgacgtca
ttttacgTTTGCACACCAACCCGAGACGCATTTTTGGCCTTCCAGAGCAA
CATGACACCTACGTTGAAGTGGACTTGAACGAAGAATGGACCATCCCCGA
TGCTATGGCGTACACAAAGTCCAAATGGACCCCTTTCGCTGGGATGAAAG
TGTTCGGTAAAGTTTGCCGCGTGGTGGTCAGAGGTGAACTTGCTGTTATT
GAGGACCAGgTGCTAGCCAAGCCAGGTTTTGGTGAAGATGTACGCGCATG
GGAGCCTCCAAATTGTCTACCACCTCTCTCCAAAGCTCAGAAACAGAAGC
TCGATGCCATTAATAATGAACAACCAACACCAGCCAACTTACCTGACATC
GAACAACCTTCATTGCTTAGCGGACCGCCCACGCCAATCCGCAAAATCTC
TAACATTATGGAAAAGCTTCACACACAAGACGGTCTATCTGCAGAGCACC
ACCATGCACCTCACTTCTTACCACCATTCCTTCATTCTCAACTACTGGTC
GGCAAACACGTCTTAAAAGTGGAGTCCATTAACAAAGACCAGTTAAATGC
TTTATTTAACATCGCACAACAATTGAAAAAAGAGGAGAGGCGTGGTCGAC
AGATCGATACACTTAAAGGTAAAGTTTTGGCGCTGATGTTTTTCGAACCC
AGTACTCGCACTGCATGCTCGTTCCAGTCTGCAATGCAGCGTCTCGGTGG
AACTACCATCGCTATCAAACCTGGAAACTCATCACTCACCAAGGGAGAAT
CTGTTCAAGATACGGTTGCCACTATGGCTTGTTACAGTGACGTCATCGTC
ATGAGACATCCTACCAAAGGCATGGTTCAGCAAGCAGCGGAGAAGTCGCG
ACGCCCGATCATCAATGCGGGAGACGGGGTTGGAGAACACCCCACACAAG
CTTTGTTAGATGTTTTCACTATCAGAGAAGAAATTGGTACCGTCAACGGA
ATTACCGTGACAATGGTTGGTGATCTGAAGAATGGCCGTACCGTGCATTC
ATTGGCTCGCTTATTGACACTGTACCGAGTGAACTTACAATATGTCTCAC
CTGACTCTCTTCCAATGCCTGAAAACGTTCAAAACTATGTTCACAAGTGT
GGCATCCCACAGAGACAATTCAAGACAATTGAAGAGGCGTTACCGACAAC
TGATGTGCTATACATGACACGAATTCAAAGAGAAAGATTTGCAGACCAAC
AAGAATACGAGAAGgtgCATGGTTATTTCGTGTTGACACCGAAAATGTTG
ACGAAAGCGAAGAACAAGATGATCGTTATGCACCCATTCCCAAGAGTCAA
CGAAATCAGTACTGAAGTGGATTGCGACCCAAGGGCTGCTTATTTCCGTC
AAATGGAATACGGGATGTTTGTTCGAATGGCTTTACTTTCCATGTTGACT
GGTCGATTTTAATGGACAGAGAAAACCGAAAATTTACGTAATCTTTGTCA
TAAAAGAAAACGTCACAAAAAGCGAAAATATTGTAGCCATCTGAGCACTA
ATTTTATAGCTCGACAAAAGAATATATTATAATGGATTGTAGGGCAATTT
TGTAGTCATTAATTTTTAAGTCGGACAATTTTCGGTCAAAGAATTTATCA
CTTTCCCAAAAGAGACATTGCAAATTCGTTTCTAATTATTTCGTTAATTG
GTATTGTCGACAGTAATTAGATGTTTGTGATATTATTTTTGCGGTTcata
tttgagatttttttatttttgtagctTTTTTTCCAGATcccttttttagt
tttatatatttttacttttgGGATAAATAGGCTTTTTTATTATcatatta
ttgaaaaaaataatcaaaaaatcttgacaTAAAAAAGGAATACAACATTT
GATCATTTGCTTATGTGAAAGATTGTTTATTGTAGACCACAATCCTCGCA
AAACCAATTTCCTGAAAACCGTCACTTTCACCTAAAGTGCGGACTACATT
CTTGCGAACTTTTACGAAAGGTATTAGCACTCTTCTTGCCGGAAATTTAG
GAAGTTCTTTCAACCGTCAAAATACACTCTAGATTGCGGTTTTTCCATAG
TGAATTTTCGTTTTGAATGAATAATTTCTTCTTTATCTTAAACTCTCACG
ATATAAGTTAGTACTATGAAATTAAGGGGAATGAATGAAAGAGTACTATA
TTCAAATCAGCC
Run BLAST on NCBI

protein sequence of CAD like protein

>TCONS_00001872-protein ID=TCONS_00001872-protein|Name=CAD like protein|organism=Clytia hemisphaerica|type=polypeptide|length=1607bp
MATLILDDGTKYHGQIFGDERSIAGEVVFQTGMVGYPESLTDPSYNSQIL
VLTYPLIGNYGIPNDSRDEHGMLKFFESEKIWNNGMIVGDLTEDYSHWLA
TKSLSEWLKEHKIPGITGIDTRALTKKLRENGTMLGKIVLDGEDEASVPF
DDPNKRNLIAEVSCKEPKLYNPKGKIKMIAVDFGIKYNQIRCLIDCDCQV
LVVPWDYDYSTLLKNKEYDGLFMSNGPGDPSLCQVSIDTLRKVITELPDV
PVFGICMGHQILSLAAGCGSYKMKYGNRGHNQPATHLETQRCFITCQNHG
FAIDTDSLPKEWSVLFTNENDGSNEGIVHNTKPIFSVQFHPEHQGGPRDL
ELLFGFFVDIVNKLKIDSNLCLRTMLKETLTFHPAEETRSRAFKPKKVLI
LGSGGLSIGQAGEFDYSGSQAIKALKEEKIHTVLINPNIATVQTSKGLAD
KTYFLPVNFEFTSKVIEVERPDGILLSFGGQTALNCGLLLKERGILEKYN
VAVLGTPTKSIEWTEDRKMFSDKMGEIGEKVAPSSVAYTVDEAITAANRL
GYPVLLRAAFALGGLGSGFASNDNELKKLAASAFAHSKQCLVDKSLKGWK
EVEYEVVRDAYDNCITVCNMENFDPLGIHTGESIVVAPSQTLTNEEYNML
RRTAIKVIRKLGVVGECNIQYALHPDSKEFYIIEVNARLSRSSALASKAT
GYPLAYVAAKLALGIPLPKLRNSVTNSTTACFEPSLDYCVVKVPRWDLDK
FQRVSTKIGSSMKSVGEVMAIGRSFEEAIQKSLRMVDDSNLGFDANNLEL
DEQVLVEPSDKRIFHVAAALRRGYSIDQLYELTRIDKWFLSKLAKIINYA
KMLEEKYPKVGAGKDTIPCNILLKGKQLGFSDKQIANCVQSSELVIRKYR
YECNILPCFKQIDTVAAEFPAEANYLYLTYNGDCDDVTYAESQNKVMVIG
SGVYRIGSSVEFDACAVGCIRELKRLGKSTIMVNYNPETVSTDYDECDRL
YFDEITFETIMDIYHKEDPEGIILSMGGQVANNIAMHLHRQEVRILGTSP
EMIDNAENRFKFSRMLDNIGILQPTWKELTTMEEAYQFCTKVGYPVLVRP
SYVLSGAAMNVVYAEDDLESYLGSAVSISKEHPVVISKFISNAKEIDVDA
VANDGEVMAMVVSEHVENAGVHSGDATMICPPQDINTETMGRIKQICIAV
GNALNVSGPFNMQLIAKDNQLKVIECNLRVSRSFPFVSKTLDCDLVALAT
KIIVGAPAEPAFNIMDKCEKIGCKVPQFSFSRLAGADVQLGVEMASTGEV
ACFGENRYEAYLKALMSTGFKLPKKNILLTVGSYKAKKEMLPSVRLLEKM
GYELYASMGTGDFYQEHGVQVQIIDWPFEENGTEGQEESIQDYLTQNKFD
LVINIPMRGSGTKKKSHFITHGYRTRRMAIDHSVSLITNIKCAKLFCEAL
FKVGSKIEVKTHIDCISSGNIVRLPGLIDVHVHLRQPGAEYKEDFDSGTA
AALAGGVTMVLCMPNTKPAVVDQPTFQLAHQLAIKNARCDFALYAGASST
NALMLPKIAPGCAGLKMYLNDTYTTLKMDNLXDCTRLCWSQNVPQRYLHY
LEDGQPL
Run BLAST on NCBI

transcript from alignment at sc0000012:62297..121470-

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001872 ID=TCONS_00001872|Name=TCONS_00001872|organism=Clytia hemisphaerica|type=transcript|length=59174bp|location=Sequence derived from alignment at sc0000012:62297..121470- (Clytia hemisphaerica)
CAATTATCACCGATTTAATTTTCGCGCCAATTAAATCGGGGAAGTGGTTT GTTTTGATTTGGTTTCTAATGCCATCGCTATTTTGCAGAATGATTATTTT ATCAGTAGGAGCCAGCCAAGCCTCTTGGTAAATATCGGTCCGCAAAATAT ACATAACAGCACGTGCTAATTTTTTTCTCCGACCTCAAAAGCATGTTGTA AAATTTGGTACTGTCACCTGATCTGATGACTTGACTTGGTCACATATCAG CTGATAAGTACATTTCACCTATCATCCTCAAAACTGACTTGCTCAGAAGG GTAAGTTTTCTATTATTTCTCTTTGTCTCTTGTGGTTCTTTTCGCGTTAA AATTATGAATAATTTATTAAAGTAAAAACTGTTATGTTAAAAACTTCAGG GGTTACTATTTACTATACCATGCTTTCCATGTCATTTTCCTTAAAATACA GCCAGACAGCCTTGCATTCTTACAAAAACAATAGTGAGGTCAGGTAGCAC ATAAAAACGTAAGAATACTTCAGATGGTGATTAAAGTATGAAATTTGGCA CAGATGATCCTTAGAGGGTCTAAAACTTAATTTTAAACAGTAACACCAAA TTTTGCCACCTGGCCACCTGCCAGATGGAAAGATCTAGTTTTAATCACCA ATTCCAGACGGTGTCAATCCAACAACTTCGAACAAAAATCGCAATCGAAC CAATCGAACGTAGTAATCGAATGCAATATAATTGCAATTCGATTGTCGAA CGTAATCGAATCTTAATCGAACGGCCGATTCCTGGGTAATATTCGATTGT GTTCGATTGCGTTCGAGTAATGTTCGATTGATAGTTGACTATGTTCGATC GGTTCGATTGATTGTCAATTATATTGGATTAATGTTCGATTACGATTATG TGCGATGAGTTTGATTTTGCGATTAAATCAAATTGGATCACTCTGTTAGA GCTTTTTAGCGTGGGCGGCAGAGTGCTTAAGTACCATACCAAAGCGAATA AAATCTAATACAATCGAATACAATCTAACGTAATTGAATACAATCGAAAG TAATCAAAGTAATCGAACAGTAAATCCTGGGTAATATTCGATTGCGATTC GATTGCGTTCGACAATCGAATTTCAATTATTCGATTGCGTTCAATTGCGT TCGATTGATTCGGCGTTCGATTCGTTCGATTGACACCGTCTGGCCAATTC CGCCCTTCTCCTCTTTTTCTCTATTTCCTAACTCTTACTTTGTTTTTTCT GATTTCTGGACTTAGTTTTTCTGAATTTGACTATTTGACGCTATTTTGCT AATTCTGAAACTATACTCCCACACCTCGGTTCGAACCACCAAATGCAAGC AACCTTGGTTTCCAAACCCGACGCCTTACCACTTGCACTATTGTCGCACA GCAAAATCACGCAATTCATAACATATTATACCGAACTGGCAAAAAACGGG GGTAATGTTATTATAATATGAGTAAAAGTACCCCTTTTTTAAACCTGACT GAAATTATTCGAGCCGTTACTAGCAACCCTGCGGGGCCCAAGGCACCGAG TATGCACCCAGCACAGTGACAAGCCGTTACTAGCAACCCTGACCCTAACT AACTGACAATAATCGAATCCTGACCCCGGAAAATTACCACGGACTAGAAA GAACGAAAAAAATTGAAGGGGCGGAATTGCTGATTGAAACTAGTTTTCAC CCTGCCAGATGACGTCATCAGGTGGCTGGGCAAAAAATTATTTTTTTGAA AATATTCAAAATCTGATGGTTCCAGCGGAAAGAGCATGAAATGCTGATAA AAATTGAGGTATAAAACATGCCTTGAAAATCTTCCTATCAAAAGTTATAG ATGTTGTCCGATGTTCAAATTGAATTAAAAGCTTTAAATCAGGAGCACAG TGTACAACCAACTAATTTTTTTTTGCTGTTTTAAGCCTTCCAATTTTTTT TGACCCAAGCATCAGATGGAACTTCAAATTTTGACATGGATTCATGTATA AGACACTAAATTTGGTCAACTAGTTCCGTTATTACGGGATTTTAGGTTTT GCCTGGAAAGGCTTGCGATGACGTCATCACAAAACTTTAAGCCTTCATAA CTTTTGATAGGAAGATTTTGAAGGCATGTTTTATACCTCGATTTTCATCA GCATTTCATGCTCTTTCCGCTGATACCATCAGATTTTAAATATTTTCAAA AAAATAAATTTTTGCTAAGCCAATTGATGACGTCATCTGACAGGTGGCCG GGTGGCAAAATTTGGTGTTACTGTTTAAAATTAAGTTTTAGACCCTCTAA GGATCATCTGTGCCAAATTTCATGCTTTAATCACCATCTGAAGTATTTTG GTGCTAACAGACCTCACTACCTACAATGCAGAATATTTATTTCCCCAGTC AGAAATGTAGAACACAGACATGTGCTTACTTCTGAAGTCTTCTATTATCC AAGACATGCTAACTCTCTACAGAAAAAAATAGTACTTTTTTGAATTGGTC TACAAAATGCACATGATTTTTAGAGACCTTGTTTGTCAACTTGCAACCCC GTTCTTGATTCAAAGTCAAGCGTTGTCAAGTTTTATAGCAGATAAGCTTC AATATTTGAAAATTTTGTGGAATTAGACTTGAAAATTATAGTTTTTCTTG ACAAATTTAAGATTAAAATTTTCATGTGGACAAAATTTTGTGAATCTATC TTCTCTTTGTGCTAATTTTTTCATTTTCTATAAAATCCTGTTATTCAAAA AAAATTGTGAGGACTAATTTTGGCAATTTTTTTTTGAATAATAGTATTTT TGAGAAAAGCTCAAAAAATAAAGAAATTAGCCTAAATAGAAAATGGATTC TCCCAGACGGTGTCAATCGAATTAATCAAACGCCGATTTGATTGTCGAAC GCAATCAAATATTACAGTACCCAGGATTTGCAGTTTGATTGCAACGATTT TGTTCGATTACATTCGATTGATTCAATTGTATTCAATTTTATTCACTCTC GTACCATATTACGCGCTCAGCCATCCAGGCTAAAAAAGCTCTTAGAAAGG AGTGATTAAATTTAATTTCATCGCAATCAAACTTATCAAACACAATCGTA ATCAAGGCGGATCTCTAAAAATTGTTTGGTTCCCGTCATCCGACCGACCC TGATTTTTACTCTGAAGTTAGAGTCAAACTTACAATGCAGGTACCTACAA TGAACAAAGATGGTATGTATGTACAAAAAAATATTTTTGACCGACCGACC GACTGACCGACCGATCCACTTTGTAAAGTCGAAATGACGGGAACCAAACA ATTTTTAAAGATCCGCCCAAACATAATCGAAGATCAATCGAAGGTAATTT ACAATCAATCGAACCAATCAAACGTTACTCAAACGCAATCGAACACAATA GAATATTACCCAAGAGGCCATTCGATTGAGATTCGATTGCGTTTGATTGA GATTTGATTGCGTTCCATTGAGATACGATTTCATTCGATTGAGATTCGAC TGCGTTCCATAATCGAATCGCAATTATTTGATCTTGTTTGATTACGTTCG ATTCGTTCGATTGCGATTTTTCTTTGAAGTTTGACACCGTCTGGATTCTC TGAAGCACCAGCCATGAATATCTGTTATCAAATTAAGAAAACTTTTACCA CTGTTTTTACTGGACAGTTTGGTGTGGGTTTAAATTTATCAATGATTTCT TGCTCATTTTTAATTTTTGTTAACATTTTTCCTATTTTCAAATCGGCATT GGTAAAATAGCGAAAAAGTTGGACAAAGATTACCCAGAGAAGTATTTCTT TTCAATAAAAGTAAGTAAACAATGATTAGGAAAAGTTGATCTGAAATGAT CATATCGGTTAGACACAACCATTATGGACACTGGCATGTGTCATCCAGCT CAGAGTGACTTTCATACAGTAAATGGATTTTCCAATTTTTCTATTCTAAA ACAGTCTGGAATTGGTGTACCTGTCTGGAAAAATATGGAATTTGAAGGAA ATAGTCCTTAATGAAGTCTAAAAAACTTCCCGGAGATTGGAAACTTTTAT CTTGACATTAGAATTTTCCAACAACTTCTGTTTTAAAACTGAAAACCTTC CTAATGGATGAAATGTCTAGAATATTTTTGGCATTTTTAGGAAAAAATTA ACAATTTGGCTTTCCAGACTAAAAGTCTGGAACTTTCTGTATGAAACACC CTTATCTCAGCAAAAAACAGTAAAAGAACATGTATTGGTAAAGAATTATC ATTTTGCTATATAAAGATAAACAAGATTAATTAGGATAGAGCAATCGACT AAATTAACTTTGAATTCTTCTGGTCTAATAATGACGCTTCAAACGTTATC AAGATAACAATAGCCATTTTTTGAACTTTTAGTACACAGATCTCAGTTGT TCCCCTAATGAGCATTCACAGATTTGAATGTTCTTTTTTCATAACTAGGA TTCAAGTTTTCTCCTTGGTATTCAAGTGACTTCAGTACACTCATTTTGTT TTATAAGCATAACGTTTATAAGCATATGCTAAGCATACCTTGAGGCTCAG CCAAAGAAATTTTTAGAATCATAATTTCCAAAACTTCAGAAAATAACAGA AGAAAGAATCATATATCATATATCATATGGTAAACATTCGAAAACAATAG AATGTCTTCATTTCTCTCAAGATTAAAGAGAGGGGAAAATGCGCGAAAAA TCTTACCACAGAAAAGTTTAGTTTTGTATTATTTGTAAGAAAGATAAAAT TATACATAAATAGTTTTACCAATTATGTATTGAAACTTTTCGAAAGTGCC TACAAATTAAACAACCTTATATTATTATTGGTGTTTAGACAAAGGCACCC AAAAGTTAACCTCAGGCAATTATTTCCACCCCAAAAAGATTTGTAGGATG TACGGACGGATGGACGCAGAAGGCTACCGTAATACTTTAGCTGGGCAAAA TTAAAGGTCAAGTTTGAAGTTTTAGATATATAACCCTGTCTTAGTAAGAG TATTTTTTAGATAAAAGGGAAGACAAAAAGTCCAACAAATTTGACTTTGC CAGACAAAAGTTTACAAAAAATAAAAGCTTTTCTACCAAGAAAGTTAAAA AGCTACAGTAAGAAAATATTGTACAGTTCGAAAGAGAGCATCAGTAAGTC TTCGTCAATTTCAAGATCCACAATCANCTTTTCTACCAAGAAAGTTAAAA AGCTACAGTAAGAAAATATTGTACAGTTCGAAAGAGAGCATCAGTAAGTC TTCGTCAATTTCAAGATCCCCAATCATAGAATGCCCCCCCCCCCTTGAGC TTAGGGGGGGGGGCTAAACTATTTTTGCTTGATTGGGGGCTGTATTTTTC AAAAAATACTGGGGGCTAGCTTGCTAGGGGAGGCTGAGTGTTGTGTAATA GAACCAGGGGCAGAGCTGATAGGTTGAAGATATTTTAAATTATGTTAAAA ATCTATGCTGTGGGGAAGGTTTTATCCCTCTTGAAAAAAGATTTTTCCTT GCAGCGCAATCAATTTATTGAGAATTTCCATGCAAAATTTCTTTGATATT TTGCTTTGTGAAGGTGGGGGCTATGTTTCTAGAATTTAGCCTGGGGCTAT TTTCCTTTGCCTCTTCCCCCTGAAAAATCCTGGGGGCTGGACCCCTCTGC ACACTATGGTCACAAGATCTGACATTATCAATCCCGTTTTCCATTGTAAT TTTTTTTGTGATTTCATTGTGAAATCGCAAAATGCCATACTTTAATCCGA TCCCTGATTTACTTGTATAATACTGGTCCTCATTTTAGCAAACCCTTTAA AATCTTAAATAATATTATTGAAAAGATTTTTCAGATTGCAATCTTTTATT TAATGGTATTCAAATATCATATCAATATGAATGTAATGACTAGAGATTTA TTTTCAAAAGATTTTTTCAGCCTAGGGTTTTTGCTGACCTAATTTGTTTA CCATTGTTTTGTATAGAAAACCGAAATGGCGACACTTATTCTTGATGATG GCACCAAATATCATGGTCAAATTTTTGGTGATGAAAGAAGTATTGCAGGA GAAGTTGGTAAGCTTGATAAACTTTATGTTTAATTTTTGCTGACGCTGTT GCAAAAAACTTAAATATAATTTTTAAATGAAGAGCTGGATTGTAACAAAA GCATAAAAGGAATAAGTTTTTTACTCTTCTAGTTATGATTTTCCTTTTCA ACTGGTTTGGACAGCCTTTTTTCAAAGTAGTGTAATTTCAATTCATATTT GTTTTATTAGTCNCTGACGCTGTTGCAAAAAACTTAAATATAATTTTTAA ATGAAGAGCTGGATTGTAACAAAAGCATAAAAGGAATAAGTTTTTTACTC TTCTAGTTATGATTTTCCTTTTCAACTGGTTTGGACAGCCTTTTTTCAAA GTAGTGTAATTTCAATTCATATTTGTTGTATTAGTCTTCCAAACTGGTAT GGTTGGTTACCCAGAATCATTGACAGATCCTTCATACAACAGTCAAATCT TGGTATTGACGTATCCACTGATTGGTAATTATGGTATACCAAACGATTCT CGTGATGAACATGGCATGCTCAAATTTTTTGAATCTGAAAAGATTTGGAA CAATGGTATGATTGTAGGAGACTTGACTGAGGACTACAGCCATTGGTTGG CAACCAAATCACTTTCAGAGTGGCTGAAGGAACACAAAATACCTGGAATT ACTGGTAAGTTTAGTTCTTGATATTTGAAATTAAGATTTTTTAGTATTAC AAACCTCAAAGGTTTCAATTTTCGGAAGCTTTGTGTCACCTTCAACAAAA TCAGCAGAGATAAGATAAAGAAAGTGGAATAAGATTTCCAATGAAAATCT GTTACTCCTTTTCTAAAAAAAATTATGAAAGAGCAAACATCTATCCACAG ACACACATTTTGTCCTTCCCAGGACTCCGTGCGGCTTGGGTAAGTGAGCA TAGACTGCTTTTGTCACTAGAGTGCTCAAAACACTAAGCAACAGAGTGTA TTGAGTGCTCAAAGAACCAAAGTTCTGAAAAAGCAAACATAAACAAAAGA GGATGATGGGCCTATCTTCAATCATGATTATGGCTTAGATATTGATTTCA AAAGGCACACCTTTTTAAATTGTCTTACTAAACACTGAAAGTTTGCTTTA TTTTGAAGGTATTGATACCAGAGCATTAACAAAGAAGTTGAGAGAAAATG GAACAATGTTAGGAAAGGTAAAAATTACATACTTCTGCGGCGGACATCAT GAATTCAAGACTTCCAATGCTTGTGGTCCAACATTGCAGTGATTAGTTGT TGTGTTGTACTGCAGCTTGTGTCGTGGTGCAATGTGTGTAAAAATTAAAA TTCTTCAAAGAGATTCTTTTCCACACTTTCGATAGAATTTGGAAAGTATT GTCCCTGATTGAACAATTTCAGATTTAATTTTTTGCTTTTCATATTCAAT AACCTTTTATCATTGTGGCTAAAAAGTTAAGTTTAGTTGTTCTCCTTTTT TGATTTTCCAAGTTATTATTGTCATTGCTATAGATTGTTTTGGATGGAGA GGATGAAGCAAGTGTTCCATTTGATGATCCAAACAAAAGGAATTTGATTG CTGAAGTCTCTTGCAAGGTACTATATCCTTTTCTTTTCAAAACTTTTGAT ATTCACGTTTTAGTGCGCCTAGCAAAATCAAGGCGTTTATGTGTGTCTAA GTGCGCTTAAGTGCGTTAGTGAACGTACTCACTAGAAAGCAAAAATGTGT CCGATGCACTTAGACGCACTTAAACGTGATTTTTTGCACAAGTGAGTACC AAGCTTCACTGATGTAATAACATTTTCATCAAATAGAAAAACTTATACAC AGTAACAAATTATTTTTGGTAATAAAACCTTTAAAACATATGTTCTTCCA GATTTATAAGATTATTATTCCTTCCTTTTTTGCTTCTAGGAACCTAAACT TTACAATCCTAAGGGTAAAATAAAGATGATTGCTGTAGACTTTGGTATCA AATACAACCAGATCCGGTGTTTGATTGATTGTGATTGTCAGGTTCTAGTT GTTCCATGGGATTATGACTATAGTACATTGTTAAAGAACAAAGGTAAGAG GTAGAAAATGTCTTTTAGAATTATTTTCACTTTCTTATTTAAATATTAGT TGAATTTTCATTTGTTCACAAAAACATCTTTCATGTTTTACAACTTCTGT ATTACACTTCCGTATTATATAACTAACCAAGTATTTAATGCGGGGAAAAT GAATGTCGTAGTGGTGTGGTGGTCATTGCTCTTAACTCCCGTCTGGGAGG TCCAAGTTCGATTCCACTGTAGTACTACGGTTCACTTGGAAAATGGACGT ACCTTCGCCCAGGTAAACCCATACCATGTGAGGGGAATTGGGTACCACTA CTCTGATACAAGAGTGTGGGTGATATGTCAGACATTGTGGTGTGTAGTGT GGTGTCACTCACCGCGTTCTGCGCCTAGCTCGAGTGTCGCCACTATGCAT CATAGTATCTGTGTCTCGCTTGCACAGAACCAGCGGTGTCTGGACAACGC TAAGCGCTCCAACTTGAAAAAAAAGGAATTCCTACTTTGTAAGGAGTAGG ACCCATTCAGTGGGAAGGGCTGATATCATCAAATGAATGCAACAATTAAC GCAAAAGGCAGGGTTTTCAAAAATTACCACATTTTTGTTAAACAATTTAA TTTAATTGAAGCGAGGGTAACGGATTTGCCTTAATAAAGGTTGCTACCCA CTCAGCATTTTATGGTTCGTAAAACAAGGTGCGCTGCTTAATTATTGCAT AAATTACATAAATCAAGCCTTCAAAGGCTGTCGCTTTGAGCGCAACAAGA GTTGAAACTTTTCAACTTTTTTCGCTGAGCTGTGCAGCTTCCCTATTATT CTTTTTTAATTAGCCATCAGAAGAGACATTTAACTCTCTTGTACTGTGTG CAAAAAATATCAACAATAGAAGAAAGAAATAATGTGCAGCATATCTCCCC TTTATTTTGGATCAGTGGAATGAGAAAAACGTTCAGCGCCGAACATAAAA TGCTGAGTGGGTAGCATCCTTATTGAGTAGTTATATAAGTGTAATAAGGT AACCTTCAACAATCTCTAATTTCACTTTTGTTTTTTGCTACTCTTCTAGA ATATGATGGTCTGTTTATGAGCAATGGTCCTGGAGATCCTAGCCTTTGTC AAGTTTCAATTGACACCCTCCGTAAAGTCATTACAGAATTGCCAGATGTG CCAGTCTTTGGTATTTGCATGGGTCATCAGATCTTATCTCTTGCTGCTGG ATGTGGGTCCTACAAAATGAAGTAAGGTTTTCGTCATTTTTTCTTGTAAT GGTGAGCATAAATTGTAAATTCTATTAAATGACATTTAAAGAATCTTTTG TGGTAAGCATCCCACTTATCTTATCCTACTTATATTATCCTACTCAGTTT TTTAACTGTGTTTGTTTCTTATCTCCCCATTCTATTCCTTTTTCTAATCA GATATGGTAACAGAGGACATAACCAACCTGCAACCCATTTGGAAACTCAA CGTTGCTTCATCACTTGCCAAAATCATGGCTTTGCAATTGACACAGACAG CTTACCAAAAGAATGGTCTGTTTTGTTTACAAATGAGAATGATGGCAGTA ATGAAGGCATTGTTCACAACACAAAGCCAATCTTCTCAGTTCAGTTTCAT CCTGAACATCAAGGAGGACCAAGAGATTTGGAGCTTTTGTTTGGCTTTTT TGTGGATATTGTAAACAAACTGAAAATCGATTCTAACCTCTGCTTACGAA CCATGCTGAAAGAAACGTTGACTTTCCACCCAGCAGAAGAAACAAGATCC AGAGCATGTAAGAATTTTAAATTTTTTATGAATACTGTATGACTTCAAAT ACACCCTTCAGGTGGCATTTATTTAGGGGACTTTTTAAAAAGAAGGGGTT GATTAAAAAGGGGGTCGTTTGAAAGAAGCATGTCTATTCAAAGTTAGGTT AAATAAATTCNAGAAGGGGTTGATTAAAAAAGGGGGTCGTTTGGAAGAAG CATGTCTATTAAAGTTAAGTTACATACATAAGTATGCAAGAATCATTTAG TTAACTTTTACCTTCTATTTTTACTTAAGTTTTTCAAGATGTTCTTTTTG TATTTTTATTACAGTCAAACCAAAGAAGGTCTTGATTTTGGGATCTGGTG GCTTATCTATTGGTCAAGCCGGAGAATTTGATTATTCTGGCTCTCAAGCT ATCAAAGCATTAAAAGAAGAGAAGATTCACACAGTTTTGATCAATCCTAA TATTGCTACAGTGCAAACTTCCAAAGGACTTGCAGATAAAACTTACTTCC TTCCTGTTAACTTTGAATTCACAAGCAAGGTATGGAATTGCTTTTCACAG TTATTTACAGTTCTTATTTCATTGTATGTTTAGCTTTTTAGTCACTGATC ACCAACAATGTTATCAAAACATTTTGTAGTAGAATTGTATTTAATTGATA CAAACCAATACTCTAGTACCTGATTCAGCATTTAATGCAAGAAGAACTAC AAATCAGGATGAATCATTTGAGACGTGGCACACACCTTCATACACCTAAC CCCTTTAAGGAATGCTATCAACCACACACCATAAATTTAGACTTTACTAC TAAAAAAAGCGGTGGATAGCACGCCTTATCACACGTCTAAATTAGCAATA CTTAGTTTTTAGGAGTGATTGAATTTTCCAAATTAGAAAGCCTGACAAAC GCTGNATCTAAATTAGCAAAACTTAGTTTTTAGGAGTGATTGAATTTTCC AAATTAGAAAGCCTGACAAATAAATATTGTGAAGACTGCTATTATTATGA TTTTTTTATAATTTTGTAGGTGATTGAAGTAGAAAGACCAGATGGCATTC TGTTATCATTTGGTGGACAAACAGCATTGAACTGTGGACTGCTATTGAAA GAGAGGGGAATTTTAGAGAAATACAATGTTGCTGTTCTTGGTACACCTAC CAAATCGATTGAATGGACAGAAGATAGGAAAATGTTTTCAGACAAGATGG GAGAGATTGGTGAGAAAGTTGCACCAAGCTCAGTGGCTTATACTGTGGAT GAGGTGAGTAATTTCTTTTGAAAAAAATAGAAAAAATAGTTATTCATAAT TTCTTATGTTTGCTTTATAAAAAAATTCAAAGGTTGCATTTTTTGGTTCT CAGAAAGTCTCCTTCTTATAAAAATATAGTTGATTCAATGATCCTCACTC TCTGATCCACAGCCAAGCCACCAGTTGAGCATGCTCAATTCAGTTGCTTA CTATAGAAATATGCTCTTGGTTTTCATATGCTTTTCATTATATTTTTAGG CTATCACAGCAGCTAACAGGCTAGGATATCCAGTGTTGTTACGTGCAGCA TTTGCACTAGGTGGACTTGGATCTGGTTTTGCTTCCAATGACAATGAGCT CAAAAAGCTTGCAGCATCGGCTTTTGCACATTCCAAACAGTGTCTAGTTG ACAAGTCACTGAAAGGATGGAAAGAAGTTGAATATGAAGTTGTTAGAGAT GCTTATGACAACTGTATCACTGTAAGTTATTCTTTTGAAGGAGTTTCAAT TAAACAGCGTTTGTCTTTTGGAAATTAATGCATTCTTTTAGGAAGTATAT GTGACTCCTCAAGCGATTTGGAGTACACAAAAGACCGATCGGCCCAAAGC GGGTAAAATCCCGGTCTTAAAGCAGCCGAAGTAAAATCTTTAGCGGCCCA TCATTCATGAAAATCGGCCTCAAAGCGGGCGAGAGAATTTTTGAAAGGTC CGCTTGAGGCCGCTCTTTTAGCGGCCCTTCTTGAGCAAGAGACTTCCAAG CGGCGTCNATAGGCTATTTTGTATCGATAAGGAAGTTCTATGAAATATAT CATTGGAAAATCTTTCTCGATAAAGTTTTATTGTTAAAAAATTCTATCGA TAAATTCTATCGCTAAAAATGATAAGGTTGTACCGAAGCAATTGGTCGCA AGACGTTTGTAAAAGTTACAAAGAAAGCGATTTGATAAAACTAAGCATAA GGGATGCTCGTAAAAATTACGGAGAAAGCGAGTTGATAAAACTAAGCGAG TTGATAAAACTAAGGAAAAAAGACGTTCGTGAAAATTACGAAGAAAGCGA GTTGATAAAACTAAGCATAAAAGACGCTCGTTAAAATTACGAAGAAAGCG AGTTGATAAAACTAAGCATAAGAGACGTTCGTGAAAATTACGAAGAAAGT GAGTTGATAAAACTAAGCATAACAGACGCATTTAAACTATACAAAGAAAT CAAATTCAGAAAAACTAAGCATGATAGATGCTTGTGGAAGCAATGTAAAA AACGAGCTAATATTAGTTGACTATTCTTGTTAAAACATACGAAGAAAAAC AAGTTGATAAAAGTATGCATAAGAAACTCGAATGAAATTTATGAAAAATG GATCGGCTCAAACAAAAGTTGTGGCTAAGAGACAGGGGTGTTCTGTTTCT TAAAAAGTCTGTTGACGTACCCATGCAACCTACTATGTCTTTAGACATTT TTATTTGTAAAATTTCGGACCCTTAAAAACAGTATAATGACTTCTAAGTT GAATCGATAAAGTTTTATCACTAATTTTCTATTGCTACTTTTGTTATCGT TATCGATTAGTTTCTATCGCTAAATTGCACTGCAATGACTTCATTCATGG ATCATCTATCGTTAAACTTTTATAGATAAAGCTCCCATCGCTTATTTGGG ATCATTAAATTCTTATCGATAAAAGTCTATCGATAAAGTGTTGAGAGCGG TTGTTAAAAATGTCTACCATATCAAAATAAAATCCAAACGATTTAAAATT ACAAGAAGAAAATCTTACTTTCCAATTTCACAACACACGACAACTCGTTT TCCAAGAAACGAACTCAATGTTTACATTTTCGAAAACGAGGCTAAGTAAA AGTAAGTAAGTAAAGAAATCAATAGCGGCCATCGGGACGAAGCGTACCGG GCATTGGACCCCTCAGGCCCCTTTAGCGGCCTCAAAGCCTCTTCGTTATG GCCGCTTTACATGATCGGCCATGCATCGGCCTCTTTCAATTTTTGAACGG CCTTAGCGGTAAAAAGACCGGTCCAATAGAGGCCAAAGAGGAACGGTAAT TAGACCGATCGGACTTTTGTGTACTCCAGATTGCTTGGGGAGTCACATAT TCGTAATAATGTCAATAGTGGGCTTCCCCATTTTTGATTTTCTGCTTTTT GAAAAAAGGTTTGGGTTCGAGGTGGTGATGTCCCAATTTAAATATTCTGC CCAAACAAAATAAGTTTACAATACGAATTTGAAGATGATGCCCATAATTT GTGAAATAGAGGNTATTGAAAGAGAGGGGAATTTTAGAGAAATACAATGT TGCTGTTCTTGGTACACCTACCAAATCGATTGAATGGACAGAAGATAGGA AAATGTTTTCAGACAAGATGGGAGAGATTGGTGAGAAAGTTGCACCAAGC TCAGTGGCTTATACTGTGGATGAGGTGAGTAATTTCTTTTGAAAAAAATA GAAAAAATAGTTATTCATAATTTCTTATGTTTGCTTTATAAAAAAATTCA AAGGTTGCATTTTTTGGTTCTCAGAAAGTCTCCTTCTTATAAAAATATAG TTGATTCAATGATCCTCACTCTCTGATCCACAGCCAAGCCACCAGTTGAG CATGCTCAATTCAGTTGCTTACTATAGAAATATGCTCTTGGTTTTCATAT GCTTTTCATTATATTTTTAGGCTATCACAGCAGCTAACAGGCTAGGATAT CCAGTGTTGTTACGTGCAGCATTTGCACTAGGTGGACTTGGATCTGGTTT TGCTTCCAATGACAATGAGCTCAAAAAGCTTGCAGCATCGGCTTTTGCAC ATTCCAAACAGTGTCTAGTTGACAAGTCACTGAAAGGATGGAAAGAAGTT GAATATGAAGTTGTTAGAGATGCTTATGACAACTGTATCACTGTAAGTTA TTCTTTTGAAGGAGTTTCAATTAGTTATTCTATTCTATTCTTTGTCTGTA AACAGCGTTTGTCTTTTGGAAATTAATGCATTCTTTTAGGAAGTATATTC GTAATAATTTCAATAGTGGGCTTCCCCATTTTTGATTTTCTGCTTTTTGA AAAAAGGTTCGGGTTGGAGGTGGTGATGTCCCAATTTAAATATTCTGCCC AAACAAAATAAGTTTACAATACGAATTTGAAGATGATGCCCATAATTTGT GAAATATCTTAGGAAGGGTATATTCTCTGTTACTTAAAAGCCCTCAGCTT TAAACTTGTGTTTGATTACAAATAAGCTATATGTTTTCCAGGTTTGTAAT ATGGAAAACTTTGACCCTTTGGGAATCCATACGGGTGAATCAATTGTTGT TGCACCAAGTCAAACACTAACAAATGAGGAATACAATATGCTTAGAAGAA CAGCCATCAAAGTCATCCGTAAACTTGGTGTTGTTGGTGAATGTAACATC CAGTATGCTTTACACCCTGACTCAAAAGAGGTACAAGTACTTGACCACTT GAGCAGACTGGAACACTTTTACCCCTTTACCCCAATGAAACCTTCTTTTA TACATTTGCTTGTTACAGCATCTCAAAAAGACTTGTTTTGTGGTGACTCA ATTTTCCTTTCTTTGTCTTTATTTTGTTCAATTTCTTCAATCCCAGAAGA GAAACACTTGCTGATTATCAATTTATCTTTATTTGTTTTTGTCAATCAGA CTTTGATTAGACACTTAGACACAAAAACCTTTTGCATCATTGGTAAATGA ATTTCTAATTTTTGGTTTTGAAACAAAGAATTAAAGCATAATATTTCTGA ATCTTAATATTGCATCAACCTTTTTTATAGTTCTACATCATTGAGGTCAA TGCTCGTCTCTCCAGAAGTTCAGCTCTTGCTTCCAAAGCAACTGGATACC CATTGGCTTACGTTGCTGCTAAACTTGCACTTGGTATTCCTCTACCAAAA CTGAGAAATTCTGTCACCAATTCAACTACCGCTTGTTTTGAGCCCTCTTT GGATTATTGTGTTGTGAAAGTTCCTCGATGGGATCTGGACAAATTTCAGA GGGTTTCAACAAAGGTGATTTGATTGTTTTGATATCGTGTACCAAAATCC ATATTATATGAAAGGAGATTTGTTTTTGACTGAACCAGTAGTTGATTAAC ATCCAATGCATATGGAAAAGTTTGACAGTTGATATAGATCTATTCTGGTT AAACCAAAGCCAAAATTGTAGCAGCCTTTCGATTTATAAATTTATCTTGG AATCAGGTGTGAAGTTTTGTACCTTTTTCTTTTCTAATGCCATTTGTGTT TTTTAGATTGGATCTTCGATGAAGAGTGTTGGTGAAGTAATGGCTATTGG AAGAAGTTTTGAGGAAGCCATTCAAAAGAGTTTGAGAATGGTTGACGATT CAAACCTTGGTTTTGATGCAAACAACCTCGAGTTGGATGAACAGGTATCT CCTGAAGTTTATCAGTCAATTTCTTTTTTAGTCTATTATATTACAGCTTA AAAACAGGCTTAATCTTTTTCTCACAAGATTCGAACAAAATGTAAGAGTT GGTCCAATAAGGTTCTCCAGTGTCTGGTGCTTGTTACCTAATCTAGGAAG ATACCTTTTTCTTCGACTAATAGAAAAATCTTTACTGTAATTGTCACTAC AATTTATCTTTTGAAAAAAAAATCACATAATGTATCCTTTAAAGCAGTTC TAGTTATTATACTTACCTTGCTTCAATTTTCGGTCATTTGTTTCTCAATC AAAATTTGGTTAAATGCCTAGGTATCTAAAAATTATCTGCAATGGTTTAC AATGTGACGTTTCCAATGGAATATATATGATTGGAAGATTTATGATTAAC TTGACTTTCTGCCAATTCTCTTAGGTCTTAGTTGAGCCCTCTGACAAAAG AATCTTTCATGTTGCTGCTGCACTCCGTAGAGGATATTCTATTGATCAGC TGTATGAGCTCACTCGTATTGATAAGTGGTTTTTGAGCAAGCTAGCAAAA ATAATCAACTATGCAAAAATGCTGGAAGAGAAATACCCAAAGGTAAAAGT TTTTATGAAATTTGACTTTTTTGTCCTAGGTTCTCTGTAACTCTTCTTTT TTGGCAGGGTTTGGAAGCTTAGTTGAGTTTGTCTGCGGTCATTCATTATC ATGATTTTAACAGAAAAAAACAGTATTTCGGAATAAAAGCAGGTAAACCA ATTGCTTAATTTGGTTACTAACATAAGCTGAAAATGATTTTCTTCTTCAG AAAATCACGATAAATATTCTTTATTGTTTTTAGGTTGGAGCTGGAAAGGA CACCATTCCATGCAATATCCTACTGAAGGGGAAGCAGCTTGGATTTTCAG ATAAGCAAATTGCTAACTGCGTTCAAAGGTTGTGACTTTATCTTTTAGAT TTTACTACTTGACCATTTTATGTACTTAAACTTAGATTGAGTCAGATTAA TTAAATTTTCTAGACTTTACAAATAAAACTTCTTTAAAGAGTTCTTCAAC GTCTTAGCCTAGTGAATCGGCGATGCCAGGATCAAACCGCTACTTCATCT TCTTGCTCTACTCTGATAACCGAACTTAATACTCTGCAAAAGAGTAGTCC AAAGTGAGTGGATTATGAGTTCAACATTATGGAATGCAGACTAAGATTTA TCAACTTGAACTTGAATGTTTTTCTCTTCAGTTCTGAACTGGTTATTCGC AAGTACCGTTATGAATGCAACATTTTGCCCTGTTTCAAGCAAATTGACAC TGTTGCTGCAGAATTCCCAGCTGAAGCTAACTATCTGTATTTAACTTACA ATGGAGATTGTGATGACGTCACATACGCAGAAAGCCAAAACAAAGTCATG GTTATTGGGTCAGGTGTCTACAGAATCGGAAGCAGTGTTGAATTTGATGC ATGTGCTGTTGGATGTATTCGAGAATTGAAGAGGGTAAGTATAGAAATGA TTCTTAAGTCAAATCAACTCAACGACTTAAGCTACCAAAATTACTTTGAA AAGTTCCTAAAGTTTGACCGAAGATATTCCTCCAATGTTACTTGCTCTTG AGTAATTGACCGTGCATTCCCCTGTAATGTACATTGGGCTCCAGTCTTCC CCATCATATTTCTTGCAGTTACATTATTAGCTATTCAACTTTCCACCCTA CATATTCTCTATTTCAGCTTGGTAAGAGCACAATTATGGTGAATTACAAT CCTGAAACTGTCAGTACAGACTATGATGAATGTGATCGATTGTACTTCGA TGAAATCACATTTGAGGTAATTCTTTATCAACCGATAATTCAAATTGTCA TTTTNTTCTGCGGTCATTCATTATCATGATTTTAACAGAAAAAAACAGTA TTTCGGAATAAAAGCAGGTAAACCAATAGCTTAATTTGGTTACTAACATA AGCTGAAAATGATTTTCTTCTTCAGAAAATCACGATAAATATTCTTTATT GTTTTTAGGTTGGAGCTGGAAAGGACACCATTCCATGCAATATCCTACTG AAGGGGAAGCAGCTTGGATTTTCAGATAAGCAAATTGCTAACTGCGTTCA AAGGTTGTGACTTTATCTTTAGACTTAGACTTAAACTTAGATTGAGTCAG ATTAATTAAATTTTCTAGACTTTACAAATAAAATTTCTTTAAAGAGTTCT TCAACGTCTTAGCCTAGTGAATCGGCGATGCCAGGATCAAACCGCTACTT CATCTTCTTGCTCTACTCTGATAACCGAACTTAATACGCTGCAAAAGAGT AGTCCAAAGTAAGTGGATTATGAGTTCAACATTATGGAATGCAGACTAAG ATTTATCAACTTGAACTTGAATGTTTTTCTCTTCAGTTCTGAACTGGTTA TCCGCAAGTACCGTTATGAATGCAACATTTTGCCCTGTTTCAAGCAAATT GACACTGTTGCTGCAGAATTCCCAGCTGAAGCTAACTATCTGTATTTAAC TTACAATGGAGATTGTGATGACGTCACATACGCAGAAAGCCAAAACAAAG TCATGGTTATTGGGTCAGGTGTCTACAGAATCGGAAGCAGTGTTGAATTT GATGCATGTGCTGTTGGATGTATTCGAGAATTGAAGAGGGTAAGTATAGA AATGATTCTTAAGTCAAATCAACTCAACGACTTAAGCTACCAAAATTACT TTGAAAAGTTCCTAAAGTTTGACCGAAGATATTCCTCCAATGTTACTTGC TCTTGAGTAATTGACCGTGCATTCCCCTGTAATGTACATTGGGCTCCAGT CTTCCCCATCATATTTCTTGCAGTTACATTATTAGCTATTCAACTTTCCA CCCTACATATTCTCTATTTCAGCTTGGTAAGAGCACAATTATGGTGAATT ACAATCCTGAAACTGTCAGTACAGACTATGATGAATGTGATCGATTGTAC TTCGATGAAATCACATTTGAGGTAATTCTTTATCAACCGATAATTCAAAT TGTCATTTTTCTGTTAACCCTGAAAGCTGACAAGGTATTTGCTAATTTTA GTCCTAACTATTTCAAAGAGTCCCTGTGACTAATTCAACCTGCCTTCAAA CCAAACAGATGACCTAAACAGATTGAACAGAACTTTAGAAATCATCAAAA CACGACTTGTCTTTTTTCCAGACAATCATGGATATCTACCATAAAGAAGA CCCAGAAGGTATTATCTTATCAATGGGAGGACAGGTTGCCAACAACATTG CTATGCATCTCCACAGACAGGAAGTAAGGCTTTAACATCTGAAAACATTT ACCAGAGTTCAGAAATTATCCAAATAATATTCACATTCCTCATGTTTACT TTAATCTTCTTGCTACCCCCAATGTTTGTTTATAATTTGGAAAGTTCCCC TGGATGTTTGTCTATTTTTAAGAGTTTCCTTACAATCTTCATGTAATTGT AATGGAAATGGTAATGTCTTGGAAAAATATTATGACCAAAAACGTCATGT CATTTTTACTAAGATATTTGTTTTTCCATTAGGTGAGGATCCTTGGCACA TCGCCAGAAATGATTGACAACGCTGAAAACAGATTCAAATTCTCTCGTAT GCTAGACAACATTGGAATCCTACAACCAACATGGAAAGAGTTGACCACGA TGGAGGTGAGCTCATCAGTTATTCATAATGCACCTATCAAACCTTGAACT TTGGTCTTACTTACTTAAAATGGATGTCTGTGTTTATTGCTTTTTATTGC TGATATGCCATCAAATACAGAATATCTAACCCTGANAATATTATGGTCTT GGAAAAATATTATGACCAAAAACGTCACGTCATTTTTACTAAGATATTTG TTTTTCCATTAGGTGAGGATCCTTGGCACATCGCCAGAAATGATTGACAA CGCTGAAAACAGATTCAAATTCTCTCGTATGCTAGACAACATTGGAATCC TACAACCAACATGGAAAGAGTTGACCACGATGGAGGTGAGCTCATCAGTT ATTCATAATGCACCTATCAAACCTTGAACTTTGGTCTTACTTACTTAAAA TGGATGTCTGTGTTTATTGCTTTTNTGATCGATTGTACTTCGATGAGATC ACATTTGAGGTAATTCTTTATCAACCGATAATTCAAATTGTCATTTTTCT GTTAACCCTGAAAGCTGACATGGTATTTGCTAATTTTAGTCCTAACTATT TCAAAGAGTCCCTGTGACTAATTCAACCTGCCTTCAAACCAAACAGATGA CCTAAACAGATTGAACAGAACTTTAGAAATCATCAAAACACGACTTGTCT TTTTTCCAGACAATCATGGATATCTACCATAAAGAAGACCCAGAAGGTAT TATCTTATCAATGGGAGGACAGGTTGCCAACAACATTGCTATGCATCTCC ACAGACAGGAAGTAAGGCTTTAACATCTGAAAACATTTACCAGAGTTCAG AAATTATCCAAATAATATTCACATTCCTCATGTTTACTTTAATCTTCTTG CTACCCCCAATGTTTGTTTATAATTTGGAAAGTTCCCCTGGATGTTTGTC TATTTTTAAGAGTTTCCTTACAATCTTCATGTAATTGTAATGGAAATGGT AAAATATTATGGTCTTGGAAAAATATTATGACCAAAAACGTCACGTCATT TTTACTAAGATATTTGTTTTTCCATTAGGTGAGGATCCTTGGCACATCGC CAGAAATGATTGACAACGCTGAAAACAGATTCAAATTCTCTCGTATGCTA GACAACATTGGAATCCTACAACCAACATGGAAAGAGTTGACCACGATGGA GGTGAGCTCATCAGTTATTCATAATGCACCTATCAAACCTTGAACTTTGG TCTTACTTACTTAAAATGGATGTCTGTGTTTATTGTATGGATATGCCATC AAATATAGAATATCTAACCCTGATAAATTCAAACCCAAATCTCTTTGATG GAGTTTGTTACTGTCAACCTTGGTTTGTGTTAGTTAAGTTTCTAATCCCA GATTTTCATTGCATCCTTATTTAAGTTCTTCACGATTTGCTCTTAGCTAT TTTGGATATTCAAACTCTGAATTTACAGATTTTGCCCGGGGGGACGGTAT GTGAGGCAAAAAAAATGGCTTTTAGAATCGCACCCTTACAGTGCAGAAAA AATCGGTGAAATTCATACCCTTACAGTGCATTTTTTCACATTTTAAACTC GTTTAGAGCATGAAAAGATTTTCGAGAAAAAATTAGCAATTTTTCCTAGA TTTGCTGAAATTTTCACCCATACAGTGCATTTATCAAAAGTCCACCCTTA CAGTGCATTTCTGATATTTTGAAAAACATACCCTTAACCACCGCACATAC CCGTCGGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNCCCCCCCCCCCCACGAGATTTTGCAGACAAAATAATTTACTATTC AGTCATTACCATTTCTGCATTTTGTTTAAGGAAGCCTATCAATTCTGCAC CAAAGTTGGTTACCCAGTGCTGGTACGACCTTCATACGTGTTGAGTGGAG CTGCCATGAATGTTGTTTATGCTGAAGATGATTTAGAATCATATCTTGGA TCTGCTGTCTCCATCTCTAAGGAGCATCCAGTTGTCATCTCCAAATTTAT ATCCAATGCTAAAGTAACTGCAATTTATTCTACCTATAGTTCGTTTTGAA TTGTTGATGTGGAAATACCAATTTCTGCACAGATTTTTCGATAGGAAAAA AAAACAATCTGAATATTCAACAATGTTTTTTTTAAGTTTTCTTCTACAAA CCGAAATAGTTCAATTCTTTGGTAAATGGTTACCCGAACTCTACGAGTCT ATCTTCTTTGAATCTAGCTTTATTCTTAACCAGGAAATCTTAGTTACGTT TTTTGCAGTCGCACTTTGAATCCAGTCTGTGTAAAAGTTCCAACATCGTT TCTTAAAATCTACCCGAACGCGACCGTAGTACAGTGGTAGAGCATCCGGC TGCGGTTCGCAAGGTTGTGGGTTCAACCCCCAGCCGGGTCATACCAAAGA TTCCCAAAATGGTACTTGATGCCTCTCTGCTTGATGCTCAGCACNAATAC CAATTTCTGCACAGATTTTTCGATAAGAAAAAAAAACAATCTGAATATTC AACAATGTTTTTTTTAAGTTTTCTTCTACAAACCGAAATAGTTCAATTCT TTGGTAAATGGTTACCCGAACTCTACGAGTCTATCTTCTTTGAATCTAGC TTTATTCTTAACCAGGAAATCTTAGTTACGTTTTTTGCAGTCGCACTTTG AATCCAGTCTGTGTAAAAGTTCCAACATCGTTTCTTAAAATCTACCCGAA CGCTACCAACTTACAATTACTTAATCGATTTCTTTCAACCAGGAAATTGA CGTTGATGCCGTTGCCAACGACGGTGAAGTGATGGCCATGGTCGTCTCTG AACACGTTGAAAACGCGGGTGTCCACTCTGGTGACGCAACCATGATCTGT CCACCACAAGACATCAATACGGAAACCATGGGACGGATCAAACAGATCTG TATTGCAGTTGGAAACGCCCTCAATGTGTCTGGTCCTTTCAATATGCAAC TTATTGCTAAGGTATAAAGTCTGTTCATCTCTATACTTTCAATTAATTTG ACACTTTGTAGAATAGTGAATTCAAAGTACTCCTTGACGACGTATAGAGA AAGGAAAACTTGCGTTCTTCCAATACGCCTAATTACTTTTACACCACTAT CACGTCTCCTGTGTCAAAAAAACGTAATGTTTTTGTGAGTACGTCAACTT CATTATTTTTATGAGAATCTAAAGAACGGGAAATTCTCCTTCGGTAATGG TATGCTATTTTACCAAGGCAAGGAATACACAACATCTCATGGATCTTCAT TTACTCTTTTAGGACAATCAATTGAAGGTGATCGAATGCAATTTACGGGT GTCTCGGTCCTTCCCTTTTGTTTCCAAAACTCTAGATTGTGATTTGGTTG CCTTGGCAACCAAAATCATCGTTGGTGCTCCTGCTGAACCTGCATTCAAC ATTATGGATAAGTGTGAGAAGATCGGCTGTAAGGTATGAACAGAAATAAA TATTCCTCCTTCAAAAGCAAATTTCAAGTTTAAATGATTGAAAAATTGGT CATATTTTTGTCCAGAAATATTAACCGTCATTTTCTCCTGTAAGAGTCCA CTTTTGTCAAACAGATAGCTGATTGTAGTCCGAATGCCTATACTCAAGTA CTTTAGTATCACAACTATTTGTCCGCTCGCCATACCTTCATAACTCAGAA CCAAAAGCATCGAAGAAATTTTACATATATTTTGGATTTATCTCTAAGGG GTATCTACATTTTCTTTTGAGCTTGAAAAGACGCATAGACACATAGTGGC TATGTTATAAATCAACCGGACAGTCCTGAAATTGAAATCAACTTTCTGTC TCTCTGCAGGTGCCACAATTTTCATTTTCACGACTTGCTGGAGCTGACGT TCAACTTGGAGTAGAGATGGCAAGCACAGGAGAAGTAGCATGCTTCGGTG AAAATAGATACGAAGCTTACTTGAAGGCCTTGATGAGCACAGGTTTCAAA TTACCCAAGAAAAACATACTGCTGACTGTTGGTAGTTATAAGGTAATAAT TCTTCATTTTATTTCAATACAATTTAGTTTTTCTGGTGGTAATTCGTAGT GGTGAAATTTGTTTTTTAGATTTAAACTATCCACAAAAACTTTTATTCAG GCAGTCTTGACGCTCCATTGTTCTCATTATCTCGAAATGAAAACAAAGTT TCATCCATTGAATTTAGAAGATTTTTAGGATCTTCAACATAATCAGCCTG TAGTATATAAACCAGACTTCAAACAATTATGTTCACTACTTCCACACTCT CACCTTATCATTGATCTGGATTGTTTTAGGCGAAGAAAGAAATGTTGCCA AGTGTTCGTTTACTGGAGAAGATGGGATACGAATTGTATGCTAGCATGGG TACCGGTGACTTCTATCAAGAACATGGTGTACAGGTCTGTCGAGTATCTT AGTTGAGGGCGTTGGTCTTTATTCTCTTAGCTTAGAGGTGTCAGCCTTTA TTCTCTGAGCTAAGGACATTGGTTTCTCTGCTCTCTTAGCTAAACATGTT TGTCTCTGCTCTCCCTTAAAAGCCTTTATCAAAAGACATGGAATGTTTAT GAATAAAATGTTATTAAAATAAGCGGGATCATTTTTGGGTACTTTGTTCG CTTTCATGATAAATTGTATGTCCAGTAGCACAGAAGTCTTTATATTTCAG AGTTGAAAGTTAAGTTACGAAGTTTCTTGTACATGAAATTAGGTTCTTTT TTTGAACTGTCTAACTCATCCAACATTTCGTCAAATTAATTGGTTCTTGA TTTCTACCGGACCAAATAGCTTCGACATTTGTCTTTCAGGTCCAAATCAT TGATTGGCCTTTCGAGGAGAATGGAACTGAGGGTCAGGAAGAGAGCATTC AAGACTACCTCACACAGAACAAATTTGATTTGGTCATCAACATTCCAATG AGGGGTAGTGGTACCAAGAAGAAGTCTCATTTCATCACACATGGATATCG CACCCGACGAATGGCCATCGATCATTCCGTCTCATTGATCACCAACATTA AGTGTGCCAAACTCTTCTGTGAAGTAAGTATGGCTTATAACTGCTTATAA TAGTGATTAAAATTGCTTGAATTTATGTAAAAAACATTTTTTCGAATATT AATACAAGACTTTTTTCATTAATTCGAACTTCCATGAATCGAATCTTTTT ATGATTTGGACTAATCTCTATAATTCGAACAAGTTAGACTTTTTCCTTCG AGTTCGAATTAGCAGGAGACAACTGTATAAAGAATGCTCTCAACGTTTAG GTTATCTAAGAACATGGCCTTTCTGAGTCGTGTATTGAAAATTTCTTTAA AGACTACTGGCTACTTGAAAGCCTCATAGCAATTTTATTTGTGGGGGGAT TGTCGAGAGTATGGTGTGTTAAATGTACAGTGTCGCGGAACCCAGTTGGT TTCAAGAAATATTTTCCTGTTGACGATTGCATTTGTCCGTATTATATCCA ATCGCTATTCAAGGCATTGTTCAAAGTGGGCAGCAAGATCGAAGTGAAAA CACACATTGATTGCATTTCATCGGGAAACATTGTGCGATTGCCAGGTCTC ATTGATGTCCACGTACACTTGCGACAACCTGGTGCCGAGTACAAAGAAGA TTTCGATAGCGGTACTGCAGCCGCACTGGCCGGTGGCGTCACCATGGTGC TGTGTATGCCGAACACCAAGCCAGCTGTGGTGGATCAACCCACTTTCCAG CTTGCGCACCAAGTATGTAAAGTGTTTAATACTTACTATTCTTAAGTCTT CAGATAAGAGTTTGGTGCGCATTCGAAAAGTTTTTGTATCACTCACTTTT GCCTTGAATGTAGGTTGTTTCTAAGAAGGGAAGAGTAGACTACTAATTTC AATTTTGTTATTTTAACTGCTGCACAATCTCAAGTTTCACTTTATTTAAA AGTGAGGTACTTTTATGGCGTTTTAAAATACTTTTTTTAAAACAGGACAG ACTATTTACATCCATCCTGGATGAACATTCTTCATGGTTACCCTTTATCC GTCGTGCTCGGATCTCACCTATTCTTTTGCACAAAGATGAAAGTCTTTTT CCTTATAAATAACTTTTGTCGTCTTCTTTTTTCTCAGTTGGCCATTAAGA ACGCTCGCTGTGATTTCGCCTTGTACGCTGGTGCCAGTTCAACCAATGCT CTAATGTTGCCAAAGATTGCACCAGGATGTGCTGGTCTCAAAATGTACCT CAACGATACTTACACTACCTTGAAGATGGACAACCTCNAAGATTGCACCA GGTTGTGCTGGTCTCAAAATGTACCTCAACGATACTTACACTACCTTGAA GATGGACAACCTCTCTGATTGGATGAAACATTTCGAGAACTGGCCTAAAC ACTTGCCCATTGTCTGTCATGCAGAAAGCCAGACCACTGCTGCTGTTATC CTGATGTCTGAGCTGTACAACAGACCGGTCCATATTGCTCACGTTGCCAG GAAAGAAGAGGTANAATGTCTGAACTGTATAACAGACCGGTCCATATTGC TCACGTTGCCAGGAAAGAAGAGGTAATGTAGACTAAGCCATAAGCTCAAC GAAATCATAATCGACCGTTTCATTTGACGTTTCTTAGTTAACCTTTCTCT GGTCTGCATTATTTCACTCTAAAAATGATTTAAAAAATCTTATTATTTAT GATTTTGAGCTCTCATATTCAACTTATTTTCTATTTTATATTATGATATT TATTATAATTCACTGGAGTTTTTATCAATTTTATTCATCATTTCCACACT TGATCCACTTCCACAGATCCTTGTTATCAAGGCTGCTAAGAAGAAAGGGC TTCAAGTGACCTGTGAAGTTGCACCCCACCATCTCTTCCTTTCCACTGAC GATACCAAACGTATCGGTGAAGGACGTGCCAGGGTCAAGCCTCAAATTTG CAGTGCTGAAGACCAAAAAGCATTGTGGGAAAATATGGACTTCATTGATT GCTTTGCCACTGACCACGGTTTGTTTTTTCCTTGTAATCCTTTTCATTCC TATAAATTCTGATTCTGAAGATTTTGCCCTCCCCTAATATTATTAACTTA TGTGAATATTTTGTCTGGTTTTGCGCCCAAGAGTTTTGTTCTTTTATTTA TCTTTTCAAGAAAAAACTATACGCCTTGTAAGTTAAAACTAAAGGGAACT AATTTTCGAAATAGCCTTATCTGTTAAAATTAACCTTAGCTGATTGTATT TGTTTTTAATCACGATATATTATGCAAGCTATTTTGGAAGCAATTATAAT ATTTTCAATGGGATTTATTAGAGGTCGGTTAGTGGGCAAAACCTCAAAAC ACACCTTTTTATAGTATTGTTAATGGTTTTTTAATGCCCCTTGCTTTTTT CTCATAACCTAAGAAATTCGATGAATCTAAATTTTACTCTATAACGGTTT GTTGATTGTGATTAAACGAAAAGGATCCTGATTGGTTCATTTGAAAACAA TGAAAAGCGGGTCAAGGTATTGTGAATTAAATCAAGTTGTAAATCAATTT AGGCTTGCCATTAAGCTTTTCTTCCTGAGGGAATCTGAGGTAGTTTGTTT TATAAGTGTGAAAAGGAAAGCTCAAAAGAGACGAAATGCCTGACTGGGTT GGAAATTAAAAACTAGGTGCGACGGTTTTTGGAACCGACTCGAGACTAAA AGTGTCTGATGAAAATCAATAACACTGAGGTTTCTTATGAAAGATTCCAT CCGACGATCCGATACCTTTGCATGTCATATATTTTTTCATTAAAACGACC AAAACTAATTTAGTGGTTTCTTCTTAATTGGACTTTAACAATGCAATCCT CATCAATGGAAACGAGGTCTATCTAAACGGATCTAAATTTAGAAATTGTG ATGAAGGCATGGTATGATTTTCAGGTGATACTGTCGATAGCTTCAATAAG TTTACTGCGAAATTAATTGGTTAAAAGAAACCTTGCTTTTTGTAATTTTC TTTTTTCTCCGACCAATTAACCTTTGAACCAAAAACTTTCAAAAACCTCC AGAAAGGCGGCTACTTTAACACCGAACTTTTGATAATTAAATTCCTTTAT ACAAAGCTCTATTTCCCACAGTAATTACAAACGATTGTTTTGTCTTGGTT TGGCATTAGACCAAAAAGAAGAGTATATTTAATTCAATATATACGACCAG TCATCTTTGTAATCACTTAATGATTGACTGGCTGCTGATTTTTCTTTTCA ACAGTTACATCTCTGATTTGGCTTTTCATTCATTTCTTTGGAAGTTCTCT TTCCCTCCTATAATATATGTGATGTCATAATTTTATTATCCTGATTTGAT CAAAATCAAAGCATTTAATTTGGTTCCTTGGTCTTAATCAAGTTACTTTT CTTCTTTCTCTCCGTAATTGCTAGTCTTGACGTACGATTGTCTAATAAAA TTTCACTTTTATTTATAATCAAAGGCAGTCAAAATTGAATGATTTAAAAA AAGAATCATACCCTGTATTTGATCAACCAAAAGCCGTGAAACTATGTAAA TTACAGGCTCTGAAATTATTAAGAACCTTGTGTTCAACAACAAATAGAGA CTTATTTAATCCTATTCCCCTGTCTCAATATTAAATTATATTGAATTTAC GTCAATTCCCCCCTCCTTTTTCAGCACCTCATCATGTGGACGAGAAGAAT TCTGAAAACCCTCCTCCAGGTTTCCCAGGCCTCGAAACTATGCTACCATT ATTGTTGACTGCAGTCAAAGATGGCCGACTCACCCTTGATGACGTCATTT TACGTTTGCACACCAACCCGAGACGCATTTTTGGCCTTCCAGAGCAACAT GGTAAGAAAAGAATTCTCTAAAATTAAGTTGAACAACTTTATAACCCTTA TAACCAACTTAGTTGCTACATACCAAGTAGAGAATACAGGTTTTTTTAAC TTCTAGCCTTCCTTATTAGCCTGTTCTCGCTTAAAAGAAATTGAAAAACC GAGTCCGTCTTAAGGTCTGGAGTCAAGAACTCTTCCAGAAATGGATCTTG TTTGATAAACTGTAGGTTTTATGCAGTCAACGAATAGTTATAGTCGATAC AAAGACTGGGCCTTCATTTTGAATACTCTGACTGATGGATGGGCTATCAG TAAAAAAGTTCTATGTATTGTCAGCTTTATGTAGAAAGACTCTTTGATAT TGTCTTGAACTTCGAAAATGTTGATTAATCATCTGAATGAAGGGTTTTCC TCTGATAATGAAAATGCAGTCATTCATTTTAATTATATCATTTTTATCAA CAAACGAAAAACAGGGATGGTGATAGTCTTATTAAGTTGGGATTAAGACA CATCTGACTTGCACACTTTATCCTGCAATTATAAGCTTTTTGACATCTTT GAATACTTTCACTGTGTTACTCAATTTGCCAGGAAAGCTAGCCTCAAAAG TTGGAAAAAGGATCTTGAAATTAGAACCCTTCCTTTTGTTTCAACATGGA ACACAATAGACAAACCATTCCACTCTACATGGGGTACTAGGTGTTTGATG GGTTTATATTAACTGTATGCGATGAAGAATTTGTCGCCCGTTATCAACTA CTACTCCACAACTAAAAGGGCTTTAAGAAATTTAAATGGATAGGATTCGC CAGCACTCTTTAAAAATGCATTTACACTTTGTTTCTTTCAATACTTTTAC TTACCATCCCGTAATGTTTTTCAAATGAGTAATTATCACAAGATTTGCAC AACATGATTCGACCAACACATTATTGACAATCTTATTTCCGTTTTTCAGC TCGTATCACCAGCACAATGAGCATTCAGCCATTTCACCCTTAGTGCTTGA AACCCAATCACTGTCATAATTATTGCCATGATTATGATGACCCCCATTTC CTCTGTCAATGTGATATTGACTGAAATTATTATTTGTTCATCCTTTAGGA CTCGCTTAGTATTCGTTTATTATATTTGCATCTGCATTTGAATTTTGAAT TGAAGAATTTTAAAGTTATTTTTATAGTAAGGAAAAACACTAGAGGTACC AAAGCTCTTTATTTTATGCTGTTAAACTAGATATCTTCACAAATGAGGGT TTTTTTTCTCGAAAAGGCTAATTCTTGAAGCTAAAAAAATGAAAAAGTAT TTTTTCACTGTCGGAAACCATAATACAATATATTTGCCGGCAGTCGTCAG CTGATTTTCGACGTCAGAAAAAATTAAAAGACATAAGTTAAATTGTGGCT TTTTCGAGACAGTATAACAAATTGTGTCATTAGAAAATAGCAGGGAAAAT ATTTTTTTTGTAAATTCAATCGAATTCTATTACACAAAATTTCTCATTGA CGGAAGCATTCTGTTACAAAAAAGAAACTAATCAGTGAGAAGGAAGATAA TTATTTGCTCCCACCGTGATTTTGTAAATCATACCCCAAAGTACATGCTA GTTTATAAGAACCAGTAATTTAGTTGTTCTTATTTTTCGTGATTTTAAGG CATAATGTCCTTAAAATGTTCTCAATGTGATTTCATGCTTTAATTATTTT GTAATGTTCTTAACGTGTTTACTTCACTTATCAACTTAAAAGGGATTGGG ATTGGGGATTCTTCTTCATTGTTCTTAAAGAGCTTTTCTTCTAAAAAAAT AGAGCGTATTCAAAAAATATCTCCACCTTTAACATCACAAAGTAAATCAA CGAATTGTTTTAGTATCTGAAAAAATTGCATTAGCCACTTATCGGATGAC TGGTTGACTACCCAGTGTCATAAGTAATATCAAAATCAAAGCTCTGCTAT AAGAAAATTCAAGCTATTCATTACGCTAAGATACCCCAATTTCACTCAAT ACCTTCCATTTTCCCATAGACACCTACGTTGAAGTGGACTTGAACGAAGA ATGGACCATCCCCGATGCTATGGCGTACACAAAGTCCAAATGGACCCCTT TCGCTGGGATGAAAGTGTTCGGTAAAGTTTGCCGCGTGGTGGTCAGAGGT GAACTTGCTGTTATTGAGGACCAGGTATGGCTAAATTATTTACCAACCAT TTTTTTGAATATTTTTTATGGTGAAAAAGCGCGAATGTGCTTTTTAAATA TCAAATTAACTCTTGTTTTTGCTCCTCCATTTGATTTTTGTGATAAAGGT TTTAGAGAGTTTTCAAAAATTTCCTACTGGACCATTTAAAGAAGAGGTCG TTTTCTAAAAAAACAATTATTTTTACCAGATAATTTTCTTCTGTGGACGA AATAGTCTAATTTGAAATCGATTAACTGAGGAAAATGTCTCCACAAATGG CTTTAATATCGGTTTTTCTTTTCTGCCTGTCTCACTTTCACCTCTTTACA ACCAATATGATGCATTACTGCGTTTCTGCAACAAAAGAAATCGTGCTACT AATTGAAATTTCTTAACGAGATTCTGCGGTTTAACCTCTTCATTTAACGA CCTCCATGCTTATAGTATTGGTATAAAGAATCCTCATTATCGTGCGGGTC ATTAATTTATACGAATGATGTTGCTATAGTAACAACAATTATATGGAATG CTAAATTTAGGCTCTTTTGCACAACCCGTAATAATTTTTTTGCGATGGGT CATAAATTTGAGGATTTGTATCCCCAGCTGTATTAAATGTCATCCAAATT TTCACCATCAATTTGACCAGATAATTAATTTGCTGGGATAACTTTCTGAC AGTGTGGTTACATTGTTTGTGTGATTTGTCATTTTTGTTGGTCATTTTTG AAAAATTCCTTGTGTTCAGTCATTTTTGGAATATTTTAATGTCTGTTTTT GAATGCTATGCTTTCTCTTCGTCACACACGCCCTTTATCATTATCACCCA AAACAAAATTGCACACTTTAATTTGTTTTAGAAATTTCTGATCCGAACCC TATCTGCAAAATTTTTCGGTGGGAATGCTCTGCCTTTAACGACAGGACAA TTCTTTTTTTCCAAAAGAAGTTTCTCAAATTTTGTCGAGATCTCAGCGCA CTGTGGGTCAACTTTCGGAAAGGAAAGGATTTTTACTGTGACTTAAAATA TCATTCAGAATGTCTTTCTTTGGAGGATTATTTCTAGTGAAAATTACAGA TAATGAAAAAGAAGAGGATTTTGGGTCTACTCTTTGAATAAATCCCATCT CACTTTTTTACTTTTCTTTAGGTGCTAGCCAAGCCAGGTTTTGGTGAAGA TGTACGCGCATGGGAGCCTCCAAATTGTCTACCACCTCTCTCCAAAGCTC AGAAACAGAAGCTCGATGCCATTAATAATGAACAACCAACACCAGCCAAC TTACCTGACATCGAACAACCTTCATTGCTTAGCGGACCGCCCACGCCAAT CCGCAAAATCTCTAACATTATGGAAAAGCTTCACACACAAGGTAGGAATC TTTAAGTACTTATGTTTTCGACTCGATCGTTTTCTCAGAAATGTTAGGAA AATCCAACTCCTGATGTACTGCGTTCAACCCAGATTCAGAAAAGTTCGAA GGCGTAAATTATGCTTATTTTTTATAGACGGTCTATCTGCAGAGCACCAC CATGCACCTCACTTCTTACCACCATTCCTTCATTCTCAACTACTGGTCGG CAAACACGTCTTAAAAGTGGAGTCCATTAACAAAGACCAGGTTAGAAATG TTTTTTTAGAAACTGTATTTAGAAATACCTTAGATTTAGATTTGGGATCC TCGATTGCGGCCGTGGCTGTTTAAACTTAACACAAAAGGCATCTATTGTT TGGTTAAAGATCCGATGATTAGTCGATTGGTAAAAGGCAGTGGAACGCCT TGAGCTAAATTTCGGTTTCTAAATTCCTTTGTCACTGTAGCAATAGATAA AGTGTGAAATAGGTAATCGTCGTACATGAAATTCAAAACGATACCTTCAT GGGTATGCCTTTTTGGTTTCGTTTTAAAGTTTTCATTGAGGTGAAAACGA TTAGTTTTTGGGTTTAACTTGTGACGAATCTAATGTTTATCTTATGTCTT GTGTTTCAGTTAAATGCTTTATTTAACATCGCACAACAATTGAAAAAAGA GGAGAGGCGTGGTCGACAGATCGATACACTTAAAGTATGTCGACGCCCCT TTGTACATTTTACCCCTTTGTGTGCACACAGTGAAATCTACTCCACTTTG ACTTTTCTTAGAGGGGTCTTGCTTCAAACTATCGTTGCCTTGCAAACAAT GTACCCTAATGTACCTTTCAAATGTTTTTTTCCTATCCAATGTAGCTGAC CTAGTTTCCTAAAGCTACAAAATTTGAAATAATTTCAAACCTGTAGATTG ATAGTCAAAGCTTAAATCCCTAACAAAAAATGAGTTTTCTTAAAGCAATA CCTTCATTTTGGCTTTTCACTTAACATAGAACCTTAGAAGAGCCATTCTG TTTATTACTCAAATCTAGAAGCTGGCCGTTTCATCAAGATGTTTCTAAGA CGATATGTCTCTGAAGATGGTTCGAATTTTAAATATTCTTCTTAATTTTG ATAGGGTAAAGTTTTGGCGCTGATGTTTTTCGAACCCAGTACTCGCACTG CATGCTCGTTCCAGTCTGCAATGCAGCGTCTCGGTGGAACTACCATCGCT ATCAAACCTGGAAACTCATCACTCACCAAGGGAGAATCTGTTCAAGGTAT ACTAGCCTACTTTCTTTGTTTCATTTGCTTGATATCCCGCTGATTGCATA ACATTCAATAACTCAGCTTCTAAAGGATGTGATTTAAGGTACCAAAGACT GCGGAAAATATCATTGTATATTTTAAAATCACGGGGCTTACAAAGTCTCT TGGTACTAAAGGTTCAAAAACCCAAAATAATACTTTCATAAAGTTTTGGC TCTACGAGGTTTAGTTAAAGTAGTTTATCCTTATAAAAGCTGTTTCATGA AAGTGTCGAAGATTTTTTTTCTCCCTCTGTCTTATCACTCGTGTCCTTTG GAATTTCTTTTCGTTCCTCTTGTTGTAAAGTAAGAGCGTAGACGACCAAC TGTCTCCTCTATGTTCTATATATAGAAGTATGACATCATCGATCTACCAT TATCCCTCCGTAAGCAACTGACAGACCAGCACGAGAACTATGAAGGTTTT TCCTTTTCTACTTATGAAGATAAAAGTCACGATACTTTTTGTGGGTTTTT TATGGTTGGTTCAGAAAACACTGATTGGTCAAACTTAGACGTCCGGTCTT TTGAAAGCTCTCTCTCTTTTTGATGGTGTTATTCTCTCATCTCTAGAAAA CTTGGACCATCCTTCCTGTTTAAGGGATAACTTCTTTACTTTTACTTATT TGTTTCATGGCAAAATTTGGTAAAAATCTTCATTAGCCCATATGAGACTA ACCTTTCTCGTGTAAAATATCTACTTTTTTTGGCCTACTGATGAGTATGA TGCGAGTCGTTTAAAAAATGTTCGAATAATCAGAATCTACGTTATTTCTA AAGGGTTCTATTTCTTGAACGGTAATATCAAATTGCATGCAATAGTTTTG CACACGGCACAGAATTTTTTTAAATGCCTAGATACCCTCAAAAGTGGACA TTCGACCCCATGAAATCTTTTTTCTACACTTAGATTATTTTCAATGGCGG CTTCGATTTACTGAATTTTGACAGATTTATGCAATTGATCAATACACGAG CTCAATATTTTTGGCATTTCAGCTGAGTGTCAGCAGTTGTGTTTCCTGAT ATAAGAACAAAACCGAACCATAGCTTATCCGATTACATGTATCCCATCAA AAGACTCTCGAATTACCTTTTATCATCTCTAACAGGGTATGGGTCGTTTT ATGCAACTAAAAATAAAATCTCTCGATGATATAATTATTTTTCCTGTGTC AAGTTAACACTATGGAGTTTAAAGCCCAGAGAAATACCCTAGATAAAAGG AAAATTTATGCTTAATTTAACTTATCAAGAATATTTTAATTGTGAGAACA GACAAGGCACAGCCAAAATTCACTCGCTTTCATAAAAAATATCACGTCAA TTTTTCTCATTTTATGCAATAACAAATATGCACAATATTTTTAATGGAAA TAGAAAATTACTTTCATTAATTTCATATAAGTAGTGGTAATATCCAATTT GAAAGGGTTTAAGTCTTTAATTGGGTCAACAAACTTTTATATTGATGGTA CTTTTACTAACCCCATATCTCTGTCTCGTTTTGATAACGATTGTATTCAA TACAAAGCCTGAGACCAAAGCTGAGACTAAAGCATGTTTTCCACTGTTGT TAACAAACATGTGGCGCACACTTCAATCAGAACTTTCTCGGGCTTTCTTC TCTAGATTGACCTTAATTACTCTTGATCTCACAAATTTGTTTAGAAGAAT ATCAGGGTTGTCCGCCGAACGGCAGTTAGTTTTTCAGGTTTTTCAGTTTT TCAGAGTTTAACCAACGATATCTTGGTTAGGGTTGTTATTCAAAGTCTTT ATGGACGAGCTATTGTTGCAGGGTCGCCGTTGTCTCTGTACCATCTATCT TACCACGCGTATGACGCTTGTTTCTGACAATTTAGTAGAACTCGATGTTT TCTTATCTTTGAAGTAAACCATCGAGCTGTTTAGAGGACTTTTTCACAAA ACTACTCTATTACGATCTGTGCCCCATTTGAGGTGATAATCAGTTGAATT CTTGACTATGCAATCTTAATTTTAATCACTTTGGTTAACCCAAGTGTATT ATATAGGCCTTTGGTTTTTGGAGAGCTATTTGCTCGTTATGGCCGCTTTT CCTCGTTAGCTAACCTAAACGAGTTTATAAGGTAATCAAATTGTAGTCGT ACCGAAACCTTTCGAACAATGCAACTGAAATGTTTGTTTTGACTTCTGCC ATCCTTTACGTTTATTGCATTGGAATTATCTCGTTGTGTCCACCTTGAGC CAATGAGTAATTTTCCTATTCAAGAATAAAAAATGTCATGTTTTTTCAGT AGTAAGAAGTCTGGATATTTATTGTGAAACGACAGAGACGTTTCAGATTT ACATAATCAACAAAGCCACAAATGATTTTTCATTGTGAATTAATACTTTT TTCTTGTGACACACCGTAAAAAAAAGTATAGTATTTAAACTTAGATAGTT TTTATGGCTCTGAAAACCACAAATCTTTCATCATCCATTCTTTTTTCGAG GCACACTGTATCAAAAGGAAGTTCATTATGATTGACACACACTGTAGAGG AATTTGAAATTAGATAATTCACAATGTCTCTGAAAACCACAAATCTTTCA TCATTGAAAATTGATACTTTTTTTGAGGCACACTGTATAAAAGGAAAGTT CATTATGATTGACACACACTGTAGAGGAATTTGAATTAATTGGATAATTC ACAATGTCTCTGAAAACCACAAATCTGTCATCATTGAAAATTGATGCCTT TTTTTTTAGGCACACTGTATAAAAGGAAAGTTCATTATGATTGACACACA CTGTAGAGGAATTACTTTTTGATACACGCTGTANGAGGCACGCTGTATAA AAGGAAAGTTCATTATGATTGACACACTGTAGAGGAATTACTTTTTGATA CACGCTGTATTAAATGAGGAAGTAAAACAGATTAGTTTGAGGCACACTGT AGACGAGTTTGAAATCGGATCAATATTATGTCAATTTTTATTGTCAAAAA CACGTCATTCATTCAAATAATACGTTCTCGTGATCTGAGAGATGCAATAA AAAAGAAGGAAGGATTGAGCCTTTATTTGAAACACTCTGTATAAAAATGC TGAGTTAGATATACTTGACAACAATGTTTATCAGATACTATAGCGGGAAC CAAGACCACCGTTGAATTGGAGTTGTGTTGTTCCTTTTATAGGCATAACA TATTAACCATTTGGAATCAGGACTCCATTTGTTTATATAAATAAACCTCA TTTTTCTGAGGTGCTCTCCATCCTATCCTTATTTAAAAAAAAAGAAAAAT GAGCCAGAACGTCAAACGTCCATAAACCATTGCAACGAAGTGCTTTTAGA TTTGGAATTCTTTGGCTCTTTTGGTTCATCCGACGTGCAGCACTCTTAGA ACTTACTCGACGTGGTGTTGTCGACGGACATGGCACTTCATATATGTGGA GATGACGTCACTGACAGCAAACACGAAGATATTAGTCAGCTGTCAGTTAG CTAACATTGCTGTCCTATTGTCATTTTCTTACCCGTCTAATAAAATGGTT TTCATGAGCATGAAATTTTCTCACACTTCAAAAATTATGAAATGAGTAAA AAGTCTGAAGTCTGTGACGCTTACTATAAAAACTTGTCAATTCTTTTCGA TGTCTACACGTTGTTAATTTTAGCTCAAAGGCCGGATATCAATATCGTCT AAGCCTGATCTTTTGCTCACTCAAAAATAACAGTATATTTTAACGACATC TTATCGTAATAAACTAAGGAGCTTTTGACAATTCAAAGTAGCTGTTATTG ATTCTAAATACTAAAATAACGTGATCCTTAACTTTTTAATAGCCGTAAAA ATTTTCTAACATTGGAACCATGTTTCTGAAATTTGGCTTTTTGTCAATTT ATGGTCTATCGTGACAGTAAAGTCACGTGTGGAAAAATACGAATCCTTGC ACTCGAGCCCAAACTAAATTCTGTAAAGCCTTCGGTTGTCCTTAGAATGT TCATAAATGTTTTGACTTCGAAGCCTTATGTTCTAATAAAGTTTGTTCTT TTATTGTGTATGGAAGGCATACCATTGAAAGAAAAAGAGAAAAACTTGAG ATCTGCCACTCGAATGGAGTGTTTATTATTTCTATAATGTTTTCTGTCTG CAACATAACATCTCTTCCATCTCCTTAGGTAGGCCTCTTATCGAATGTCA ACAACATCAGTCATCATACTCCTGCTAAGGGGATTTTTGTTACCTATCTT GTGGGGGGGGCGTACGGTATTTCGGAATTCCGGAAATCGATCTTCGGAAA TCGGGCAAAATTCCTTCGGTATTTCGGAATGCTGAAACTGTTTCGGTATC GGAAGTCCGTGAACTTTTACGGAATCTCGGAAATTTCAGCAAAATTATTC GGTATCTCGGAAATCGCAAACCCCCATACGCCCCTCCTTTCTGATCCATG GTTTTGAGCAAAATTTTTGTTCTTTTGGCAAGGAAACCATATCCAGCAAT ATCCAACGGACTATCAACCTTTTATAGTTGATTAAGAGCCAGTGTTACTT TCAAGGGCACGATCAATCTCTGCTTCGCATTAGGATCTAAAAGATCCAAT GATTCTTCGATAAAAATACATCTCTAAGAATTAAATTCTAATGCATTGAC ATTATTTTGAACACAGGACACGGGTTGACGGTGAAATTAAGAACATTTTA GACTCAAAAAGTTGAAAACATCCACAAGGCTTCAAAATAATTCGGATGTT CTTATAAAAAAAGTGTATTTTGTTGAAAATTTGAAAGGTGTGCAATGTTC GTTTCTTAAAGCGAGGCTACGAATTTTCTTTGCATGATAGGGCCCCCGGC TTGAGAGCTGAAGGGAGGGGGCCAAATATTGGAATAGATTGACGTTGCCC ACCATGGTTGGGTAACGGAGAAAAACTTTGAATTTTGAGGGTGAAAGAGG TATTTTAGGACCCATTTCGAGTCAATTTGAAACGAATTCATTGAAGTTTT CAAAATAATCTTTCTCGGCAAAAAAAGTGAGGGGACACGACTCAATGGGT ATATAAAACGTGGCACTCAATTGTGTATGAAAACAAACAGTGTTTGCAAT TGCAATTCATTGAGCAATAAGATATGTCGAATCAAAACACTTGTTATGTC AGACTCTTGTCAATTTTTATGGTATACTAACCCCCTTACGATGGTTGGGT TTTCCTCTGACCTCGTCAAAATAAAATTAATCAGACCATGAAATTAATTC AGCTTTCAGCAACTCAATTATTAAGTAATGATACTGTTTTTTTCCCAAAA TAATGTTTTAAAAGCATTTCTTTTACAAAATACACATACCACAATTAACT TGTGGGTTAAAGAACAATCAGTTTTTAATCACATCTTTTCTTTTCTTTTT TTCTTAATGCTTACATATTAAAAATTCCAATGGTTCGCTTCATGCTTCAA AATGAACTTGATTGCTATTTTTTCGTTTCTTGTTCATATATACTTTTTTC ACTGCATTGAAAAATATCTGAAAAAAGCCCGACAACTTCCTTATACTCTT GAGCCTATCAAGAGCGTAATCCTGCAATAACTTGATCTAAAATACAGCCC TTTCTCAGTACACTGTAACCCAATAAGAATTCTTTTGCAAGGTGACGAAG TTTTAGCTGATTTTTTAGTATCTCCCAACTATGCTATGGTATTTATTTTC TTTCTAAAAGATTAATTTTAAAGGAGCTATTAAGAACCGCGTACAGCACC TGACCCCGAGAATGTAGTAAACCCCGAGAATGTAGGTTTCTCATTTTTTA GTATTGTAGCCCTAACGATAGTTCAACTTCATAAAAATTTGTTTCAGAGC ATACTGTTACATCTTACTGATTATTTCTGGACAGAAAATTTTAACTTGAA TTANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN AACGAAAATCTGAATGGAAGTTGATTGGATATTACCCGAACTGAGACATT TTTTAAATAAATCCTCTCTAAATCGAAATCTATTGGAATTAAGTTATGAT GATTGGGTATTTTCTTAGTCCTAATGCACTAAGGAAATGGGGAAAATAGT TCATTTCAATATTTACTGTTCTAAGTTAGATATTTTGACGAAAATGTTTG ACCTAACTTTTGGGGTTAGTTGACCTACAATTTGGGGGCCTTTATAACCC GACATAAAAAGTCTGTCAAATTATATAAAACTTGTTTGTTGTACTTTAAT AACATGAAAGTAATACCTGAGAGATGATTAATATTGAAATGTTGAGCTTT TACGACGTGTCCCAGACCCGTTGGGGCCCCAGCCCAATCAGAAAATTTGC CTAAGTTTGGAGCAATAGAATTTCTATTCCAATTTGGACTTAAGTAGAAA TTTTTGGACCCGAAGTGGGAAAAAAGTTCCACCGGGGCTGTGAGGCAGGG GTGTTGTTACATTATTCACATATTTCAACACAAAATTTTCAACCTACAAA ATAAAAAGAACTTTCTTGTCTCCTCTTTTCGTCCTTCCTTTTACTTTTCC TCATTTGTAGTAAAATGAAATTAATATATTTGTTAATTTTTTGTCAGCGT ATATTTCTAAAGTATGAATTTCACTTAGAGAACAATAATTTCCGATGAAT ACCGAAATTCCATTCCCAACAACCGAATCTTTTCACCTACATTCTGGGGG TTAAAAAGTGAAAAAATCCAATTTTCAGAATAACAAAATGCTCTTTAGAA TATTATTTTTGCATAAAACATTTCTAAAATTTGCTGTTAGAATTAATACA ATTGAAAAAATATCAACATTATACTATTACTAGATTTAAAGCCATAAAAC CAAACCTACATTCTGGGGGCTATAACGAAAATGGGAGTCAACTTCAAGGA CCAAAAAAATTGGTCTATCTATCAAAAGTAATGAAACTAACCCCTGGGAA AGTATTTTGGGAGTTCAAAATTTCGTTAAAAATATTTAATATCTTTTAAA ATGCAAATCTACATCTTTCAGGTCTGATTCAAATTTCACCTACATTCTCG GGGTCAGGTGCTGTACGATTTTTATTTTCATATTTTCGGAAAGCTTTTTT ATAGTTATCAAATCACATCACCATTCCAAAGAACCATATCCACAAATTAT GAAGATGGGTTTTTTTATAATAACATCCGAAATTTTTGAAGCCTTTGGAT GTCCTTAACTTTTCGAGTTTTAAGCCTAAAATGTTCTTAAAATGTTCTTA TTTTTACCATTGTTTTAGTATTTTTTCCCAAGAAATTGGGCATTTTAGAG CCCATGAAGCCTTGAAAGGTTCTTTGATATTTAGGCCATCGAAGCCTTAT GTTCTTAAAAAGTTTGTTCTTACAAAAAAAACTTGTATTTGAAAAACACT ACTTATCTCAATTATGACTACACCCTTCAAAAGTTTTGCATTAGCATCTC AGTGAGGTGCTTACAGTGGCGAGACGTGAGTCTATTTTTGGTATGCATTT AATCTTTGATAGCGACTTGAGAAAAAACGTTCAAGTTGTTACTTCTAATT GCACTTGAAATGAAGCAAAACCACTATGTTGGCAGCAGAACATTTTTCTA AATCTCATTCTCATTCTCCATGAATGCCGGTCCCTTTATAAGAAAAACTC CACCATTTCTTTTGCGCTACTAGCACTGTTTCTTACTTTACTTTTAGTTT ATAGTCTTAAGAAAACTGGCATAGGCCAGGGAAAAGAAATAATTATATTT CTAAAAAAGATATATTTTCCTTGTCCTCTAAGAGTTACCTAAATTTGAAA ATGACTTTTGGTATCTCTGTTCATATCTTCTGATTATCTAGCCCAGCTCG AAAACTTTAAGCTTAACTTGATTGTTCATTCCTTTATCAATTCATTCACT CATTCATTCATTCATTCATTCGCCTCCCATTCTTGCTTAATCATCATGAA ACATGCGTAGTAAGGAAAGTAAATGTTGTTACAGTTTCTTGTTTCAGACA GCTGATTTAATTTGATTTTGAACCACTTAAATGTCAACAGTTTGCGAACG GTAGTAAAATTCCTTTGTTTACTTCTTGGAAAACAAATTCTTTGAAAACG ATACCACTCTGAGTATTCCAAGCTAAAAGTCAAATAAATGATGCCAACTA AAGTCAATAAAAACAGTTTTTTTAGTTCTTATAGAAAAATATTAACCGTC AATCTTATTGTTACCAAAGTGATTCGACCACCAAATGGGGTCATTTAACA TTTTCAAACAAGTCATTTTCTTTTAAAAAGAGATCGTTAATGGCCATTGA CAGTGTTATTCAAACCGATACCCCCTTAAAATGTTTCAAACGGAATTTAT CGTATATACAGATTCTGTTTTTAGTTGAGAATTCTATAAGAACAGCAGAC TGAAATTGATTTAAATTTAAAAACAAATTATGGAAATGCTGATTTCGAGC ACAATTTGGATGAAGAAAATTAAAACTCTACTGCGAATAGCGGACCAGGC TTGACCAGAAATGTATAGTTCTTAAAAGCAGTTCAAGATATTGAATGGCC ATTTTGAGTCTAATTGTTGTCCTATATTCTTGAGTTAAACCAAACCACAG ACCCCTCCTTCTTTCCCATTAAACAAGCCGAAATGGGGTTGCTGTAATAT TTTGGATGTCAAAAATTCTCAATTTTTTGTGGTGTCATCGTACTTGTAAT TTACGTAAGAAAAGTCAATCATGTACCAGTTTATCACTTCCTTACCTTTG TATGCCATTACCTTGATTTCGACCCTTAAATGCTTTTCTTCCAAATCAGT CAATCTGAAAAAGCTATGCGGTAATCCCTTTCTACACTTTTTTATATTGT TCCTCTAAAAAGGTCGAAATGTTTTTGCTTTTGTTAATTCAACTCCTTCA AAATCTTTAAAAACAATATGGAAATTTTCACTGAATAAGGACTTTCTTTT ACCACCTATGACTTCTGAAATTTATGTTAGGTAGAGACATGTGTCTTTGC CAAACACGCCGGGTGTTACCTTAAAGCAATTCGACGCCTTAGTAAGTACT AGTAACTGAAAGGAGAGGTATACAGAGTTACTTTAAGATGGAAACAAAGG GGATAGACGCACTGCATTGCACAAATTCAAAAAAATGTCAGCAGTAAATC AGCCAAAGTTATGTATGAAAATAAATATTGTGGTTTCGAGTTTGCTTTGT TTAGATTATTCCTATGTTTTGGGTATTAGATTTCATTGAAATCAGATCAC TTTTTTACCCTCAAAATGATGGCTCATCATAAAGGATCTATTGGCATCAA GTATCAAAACTTTTCTTTCAATCTGTACTCTTATTTCACAATGTAAAACA TTCCTAAAAGAGAGATGGACTTTAGTCGAAATAAAACTGAAAATTCAAAC TATTAGTGTAAGAATATCCCCCAAAATTGGTTCCATTTTTTCACCTATCA ATCGATACGAATAAATCCTGACAGAGCTAGCAAAATGAAAACCTTTTCTC TTGCAATTCTAAATATCCCTTGCCCCTAACTTTTCAATCAAACCAATGAT TACAAATAAGTAATGATTGTTCTTCAAATTAATCATCCTTTAGGTCATTA GTAGACAAGACTATGCCTTTTCTTTTGAGTACTTTGTACCTGGCATTGTA TGTTCTAGTTCTTCCACCATTTTTTCATCCAATAAGGTGCGTAAGTACAG CATACTTCGTTCCCTAATAGTACGGCATTTGTTCAAGAGATGTCTTTTTG TTATCTAATAAGAAGTGTTGGTACATTATAGACTGAAGTTGTTTTTTTCC TGTTTTAGATACGGTTGCCACTATGGCTTGTTACAGTGACGTCATCGTCA TGAGACATCCTACCAAAGGCATGGTTCAGGTAAGGATATCTTTATCATGG TAACGAAAACGTTTACTTTTTAGCTGACAAGTTTTTCGATCCTAAAATTT GAATAAAGTACTGTTGAATACAGTCTCCTGGCAAAGCTCCAATACAAAGA TTTGAACTTGCTAGAGGCTTCAACAGTTTTTAATCCAAACAAAATCAATA GCGTGCCATTCTTCACGTTATTTCAACATCCTTGATAATTTCGCGATCAC GAGAACCTTATTTGAAACGGTTTTCTGATGTTCTCAGATTGGGCAGATTC TTCAACTTCATATTTCTATAATTCTCATCTGTATCAGATAAAACATAGGA GTTGTTGTAGTAACAGTCGTATGATTTAGAGTACGTGCGTGAGTTTTGAA AATTCCATTCAAAATGTACTTGAGACTACTCGAGATGACTTTAATCGAGT GCCTTTTTGCGTAGGTTTTTTGAACCTTTCTTTATTGTGATTTGGAAAAG AGAAAAAGTTAACTGCATTTTTGTACCTCTGTAACGAACGTTCGGGCGTC ATCACTTGGGAAGCGGTCCTTCTTTGAACGAAAAACCTCCAAACCTTAAT ACTTCCGAGATACTCTGGAAGCCAACTCTCTGAAAAAGAACACTTTTTAA ACGATTTCTTTATGCCGCCATTTAAACCAAAAATGGTCTAGTGTGACAAG TACTCTTTTCCTGAAAATTCTTTTCCACGTTGGACCTGATTGTTTTTAAA GTGAGTTTTCCCTGATTCAAAACGTCAAAATGCTTCTTTGTACCTAATTA AATGTTTACGGGTGACCTTATTGCTTGTGAATGAAAATTATGATTATGAA AACATAGTGTCCTTCCCTCCTTTTTTTGAAAATCAAGGGGGCAAAGATTA GATGCAAATGGGAAAATCTCTAGTTGAGGGAAAAGATTTTCAGGCTTCAA AGCAGTAAAATATAGCATGTTTTATGCATTTTTTAGCAAAACAATGTAAA AACATGCTTTTTTCAGAGAAATGTCTCAATTTAAATTTTTAAAATGTCAA TTTTTAGGCAAAAACGCATGAAATTGGGGACTTTGCTGGACTTTGAGGCT TCGAAAATCTAGGAGGGGTGTAAAATGGGGAGTAACCAGAATTTTTCAAA TCTCAAAGGGGGGGGCAACAAACCCACTAGGACACTATAGAAAAGAATTA GCGTTCCACCAGTGGCAAACTAAGAAAATATTAACCATTTGATACATCTT TTAAGTTACTTTTAGTTAGAAAAACATCGATTACACGGTGTGCGTAACGT TAATAAACTGTACTTCGCCGTCTTTTTCCTACGAGAGAAGAATTGGAAAT GCACTCAGATTTTTTCTGTTATCACCTACAGCAAGCAGCGGAGAAGTCGC GACGCCCGATCATCAATGCGGGAGACGGGGTTGGAGAACACCCCACACAA GCTTTGTTAGATGTTTTCACTATCAGAGAAGAAATTGGTACCGTCAACGG AATTACCGTAAGTTTTTTCGCCGGAACACGTTTTTTTCGCTACATTACTG ATCGCTGTACCAAAGTTTACCTGTAGCGTAGCGTAAATGAATTATGAAAC TTCCTTAGATAACGGGTCTGTTAACAGGAAGAATATCTTGCGACATTAAA TGTCAAGAAGCCTATGCAATAGGTTGGCTCTGGTTAACTCTTCGACTCTT CTAAGTCGCAGTCGCTGAAATTGTTGGAATATCTCTTATCATTTTCCAAG TTCTAAGTTTAAAAAGTTAAGTGGTTCGTAACTAAATTGATGTCGTTACG CTTTCCTGCAATGAAAGCATTTCAGCCGGGTCTAAGCTTTATCAAAAAAA TATTTTTTTGAATGAATAAAAAAATGTTTTCTAGAGACACACGGCGTAAC ACACGGATAAAAATAAGACCCAGAAAGTTAGCATGTCATTTATCAATCAA GAAAGCAAATTGTTCGTAATCGCTTCTCTCCTCCCCTAAACCACCCTACC TTTAAATCCCCAATGGATTATCAGAAGTGAAGCATGAGATCTTTTGGATT ATCACCCGAGAATATTTATATAACTTGGGTCAACGATTTTCTTTTCACAG CGCATTGATATTTTACCTCGAAGATGGTCCCTTTCTTCATCATACCATAC CTTACGGTTATACAGTCCACTGAAGCCGTTTTTGATTAGCTAAGTTAGTC AAGCTAATCAAAAGTTTGTACCTTTTTCTTTCTAATTAAAAAGCTACGCA TAGTGTTCAAGCATTCAAGCATAGAATTTGTATCTTCCCTCTCTAAATGT TCTTCCACTTTAGGTGACAATGGTTGGTGATCTGAAGAATGGCCGTACCG TGCATTCATTGGCTCGCTTATTGACATTGTACCGAGTGAACTTACAATAC GTTTCACCTGACTCTCTTCCAATGCCTGACAACGTTCAAAACTATGTTCA CAAGCGTGGCATCCCACAGGTATGTGATTGACTCTCCAACGTTTTCTCGA CGCCCATCTAATGTTCAAAACATGTTCTTTTTGGGGTTGGTGGGTGGGGT TTGGAATAAGCGGGGTGGATGGAAAAATTCTCAAAACTTAATAAGCGGGG GGTTGGAATAGAAATGTCCTGGATTGAATTTTTTGAAAAGGAGGCTAATA CAGCAGAATAAGGGCAAGAGAGGAAACTTTCAAAAACATTTTCCCAAGAA TCAATAAGCGGGGGGGGGGNAGGGGGCAAAGATTAGATGCAAATGGGAAA ATCTCTAGTTGAGGGAAAAGATTTTCAGGCTTCAAAGCAGTAAAATATAG CATGTTTTATGCATTTTTTAGCAAAACAATGTAAAAACATGCTTTTTTCA GAGAAATGTCTCAATTTTAATTTTTAAAATGTCAATTTTTAGGCAAAAAC GCATGAAATTGGGGACTTTGCTGGACTTTGAGGCTTCGAAAATCTAGGAG GGGTGTAAAATGGGGAGTAACCAGAATTTTTCAAATCTCAAAGGGGGGGG CAACAAACCCACTAGGACACTATAGAAAAGAATTAGCGTTCCACCAGTGG CAAACTAAGAAAATATTAACCATTTGATACATCTTTTAAGTTACTTTTAG TTAGAAAAACATCGATTACACGGTGTGCGTAACGTTAATAAACTGTACTT CGCCGTCTTTTTCCTACGAGAGAAGAATTGGAAATGCACTCAGATTTTTT CTGTTATCACCTACAGCAAGCAGCGGAGAAGTCGCGACGCCCGATCATCA ATGCGGGAGACGGGGTTGGAGAACACCCCACACAAGCTTTGTTAGATGTT TTCACTATCAGAGAAGAAATTGGTACCGTCAACGGAATTACCGTAAGTTT TTTCGCCGGAACACGTTTTTTTCGCTACATTACTGATCGCTGTACCAAAG TTTACCTGTAGCGTAGCGTAAATGAATTATGAAACTTCCTTAGATAACGG GTCTGTTAACAGGAAGAATATCTTGCGACATTAAATGTCAAGAAGCCTAT GCAATAGGTTGGCTCTGGTTAACTCTTCGACTCTTCTAAGTCGCAGTCGC TGAAATTGTTGGAATATCTCTTATCATTTTCCAAGTTCTAAGTTTAAAAA GTTAAGTGGTTCGTAACTAAATTGATGTCGTTACGCTTTCCTGCAATGAA AGCATTTCAGCCGGGTCTAAGCTTTATCAAAAAAATATTTTTTTGAATGA ATGAAAAAATGTTTTCTAGAGACACACGGCGTAACACACGGATAAAAATA AGACCCAGAAAGTTAGCATGTCATTTATCAATCAAGAAAGCAAATTGTTC GTAATCGCTTCTCTCCTCCCCTAAACCACCCTACCTTTAAATCCCCAATG GATTATCAGAAGTGAAGCATGAGATCTTTTGGATTATCACCCGAGAATAT TTATATAACTTGGGTCAACGATTTTCTTTTCACAGCGCATTGATATTTTA CCTCGAAGATGGTCCCTTTCTTCATCATACCATACCTTACGGTTATACAG TCCACTGAAGCCGTTTTTGATTAGCTAAGTTAGTCAAGCTAATCAAAAGT TTGTACCTTTTTCTTTCTAATTAAAAAGCTACGCATAGTGTTCAAGCATT CAAGCATAGAATTTGTATCTTCCCTCTCTAAATGTTCTTCCACTTTAGGT GACAATGGTTGGTGATCTGAAGAATGGCCGTACCGTGCATTCATTGGCTC GATTATTGACACTGTACCGAGTGAACTTACAATATGTCTCACCTGACTCT CTTCCAATGCCTGAAAACGTTCAAAACTATGTTCACAAGTGTGGCATCCC ACAGGTATGTGATTAACTCTCTAATGTTTTCTCGACGCCCATCTAATGTT CAAAACATGAACGTTGTCAAATTTTCTCTTTGGGGTTTGGGGGGGGGGGT NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNGGGGGGGGGGGTCGTCGTCGT CGTTAGATCTTACAGGGTTCGATAAACTGTGAATTAGCTGGCTCGAATGA TGAAGGTTTTAAACATCCTCGGCCCTTTTTCGTTTCGAATTATAGAAAAA TTCAACTTTATTTTCCCTGATGGGGGGGGGGTGTTGCTGACACTAAGTGA TGATGAAGTTAAGAGTTAAACGGTGTGTGTCTTTTCGCTATACCGAACCG ATTCATCCCAGGATATGTGTGACGGTTATTTGAGTCGCAATTGAGCTTTT CAAGGTACGAAAGGACAATGATTTCCAACACTGAGATATTGGACTTTTTT TACTTCTGTATCAAAAAGTGACATTTTCATATTGTTTGATGGATGGGTAT GTTGAGAGTTATTCAACGTACAGAAGAGCATTATTGGATTTGACTTTGAA ACCCCATTGCACTGATCCACTTATCCACTCATAGCATTCAATCTGCACAA TTTATTAACATAGAACTGTCACATAAATTTATACTTTTCTTTTTGTCGGG GGTCTGCATACCTTCTCAAGAGAGCGAGATGAATGAAAGATTGATTGTCT ATCGTGGTATATTGAATTATAAATTTCTAATTTGTACTTAAATAGAGGTT TAGACGGTCATTTTGTTTTTGACCACTCACATTCTTTCGTTTCGGAATCC TTTCGCGTGTAGACCATCTCACAAGGCTTATCTAAATCTTTGATGGATGG AGGAGCTCTTTCTTGCCAACATCTCACTAGAAAATGAAATATAGATTACT CTCTAAACAGTGTATAAGGATATTTGTATTCGTTTACCCGTTTGAAGCTA ATAACCACTTTTTGAGGTAATCTGCTTAAAGGTTTTCTCTCGTTCTTTTT CCTTTCAATGAAAATATTCTAGTAAAATCATAGTATCGCTATAGAGGGTG GACCTACTTATGTGCAATTTAAAAAGACTCATATAAGAAACAATGATTAG TTTAGCGACAGTATTTGCTACAATAATGCGATACTTTACAAACCGTTTTT TAATTTGTTTAACAGTTTCAAAATCGGAATCTCAGCAGTAAGTCTCATAT CAAAGTCCTTTTTTCTACTAGTTGAAAAACTTCACTTTTTATTTAAATTA AAGCTTCTATCCTGCCATTGACTATTGGACTAGTAAAAATAGATCTCAGG GTGAATCAGATTAAATCTTGCTGTAAATTTGTCTCCTTGAACCCCTCTTT CATTTCAATTTTAAAACCGCCACAGGTGAGGTAAATTTCAGACGCGCCTC TCCTCTTTTGCTCTTTTTCAGGCGCCCACCATGAGTCTTTGCCAAACTTT ATAATCTCATTTTGAAGTTTTATTAGACACTTTGAAAATTTCATTTCTGC GTTTATAATTCTTTCACTAACTGGGATGGTCACCAATTTTTCTCCTTCAT TCTTAGTCTCAATTCCCAGTGTATCTTTATTGGGCCACCATTACCAAAAA GCTTCAGCGGAATTTCCCGGAACTGAACCTCTTCACTTATTTTATAAGAA CCGGTAAATCTTGGCTCAGCCTTGACTGCTCTTAATTTGATATTACCAGG AATTTTGTGATGTTCTTGATATGCTTCGTTTATATACTTTGCGAATTAAA ACACCCTTCAAAACAAACATTGAACATTAGCATCGACATTATGATAGTAG TTTTTTTGTTTGAGGCTGAAGTTATTCTGAATTTGTTCAGGTTGACTTAA TTTCAGCATTTCAGCATCGTAAAATGTGTACAACTAATTTGACTTTTTCT TTCCTATATCAAGGAATGTTGATTGATATTCAATTGCATTAGATAACGAA AATAGAATTTTATCAGTGCATAATCAGCCAGCTGAGTATGTCTGCACTTC ACATTATTGCTTGAATTAATCACGATGCCCTTAAATCGTGTCAAGTTCCA AAACGAATACCTTTTTTACTTTCCTACCCAAGATTGGTAAAAAAACCTAC CTACTTAATAGGATAAAACAAAGAACTTACTCTGGTCAAACTCTATGTAC TGTATCTTTATAAATTTTTTGGGGAAATGTTTAGAACACCCCTGCCTCAA AGCCCCGGTGGAACTTTTTTCCACAGTGGGGATAAAAATTGGAGATAGAA GTTCTCTTGTTCCATGGTTAAAAGATCCAGTGGCATGGTTTTGGATTTCA ATATGTAAACATTGAATTTTGAGTGGGGCTGAAATTCTAGGGTATTTTCC CACCGGGGACGAAATTTTTGACACATTTACCAGTGGGGCTGGGGTCCTGG CGGGTCTGTGACACAGGGGTGTTTTTGAAGAGTCTAGAGATTTCAACATC TAACGTTGACTATGGATTTTATTTTATTTTATGGGTTTTATTTTCTCGAC TATTCAGTCATGTCAGGAACGACATTTGATACGTTGTTAACTGTCATTTA TCTTTTATAAGGCCCTCTAGGTGTTTTAAAAAGGGTACTTTTACGAAATT CACAGTCCTCCCGGAAGTAATGTTCCTTAACCAATTTTGTCTTCAAAACA TGGTTGTCACGATTCACTCCTAAGGTTTTCCTATCCAAAAGGGATACATT TGTTACTAGGGTGGTCTTGATTCTTTTCTTCTGTCTCTAAGTCATTTGTG TAAATACAAATTTGGTGTCGTCACGAGATCATTCAATGACTCTGAATCAA TGAAAGTTTGTTTTGATATAGTCTACTATTTCTTAAAGATCAAAATATAA AGTGTCAATTCACTACAAAACTGATTCATTTTTATAGACGAGTGAGGAAC CCATGGGGGGTAAGTAAAAGGGGTTACGTAGATGCGTCGCTCGTCACTAG AGAAGAGGAGTCTGTTCCTCGTAGCATTCCTTAATGGGAAATTTTCAGGA AAAGTTAGAGCTTTTTGAGCAAAATTTCCGTCTCATCTAGGGTACATAGT TCTTCTCACAAAAGATTAAACAACTCCAATGGAAGGACCATTTCTGAACC TTACCAACATTACCCCTCGTCTTCGGTTAGCTGGTTAGAAATCATTCCCA TGAAGTTGTTTCTTTAGTCCTAGTCCTCACATTATCCAACCCCCGAGTTC CCTAGCAAAATCAGATGGCACAGTGAAGAAAAATGTCTTGAAATTAGATC ACCCATTCAAGTTACTTGATTCGGCAATCATCAAAAGTCTTGTGTCAATA TTTTCATTTTTCGAGCCTTGTAATCACAAAGAATAACAAGACATTACTAC TGTTGGTTGGCCTCCTCATATCGCCCATACATTGATTTCTAACAATCTTT GACAGATGTCTATTTATGCCTATTATCCGGGTGGAGACAAAACGCTGAAC GGCGGAATGCCGGAATGCCGGAACCGGAATAGCTGTTCCGGCCGGAATAG CTATTCCGCGGAATATGATTTTTTTATTTTTTTTTTATTTTTTGTANNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNTAAAAAAAAATCATTATTCCGCGGA ATAGCTATTCCGGCCGGAACAGCTATTCCGGTTCCGGCATTCCGTCGTTC CGCCGTTCAGCGTTTTGTCTATACCCCTATTATCCCTTGGTACAAAACCA ATCGATCACTCGTCGATCTTCGAATCATGACATATTACCCCTTAACAATG GACTCTGTTTTCTGTAAGACCAAGTCAGCTTTCGTCAATGTTCTTATTTT AAGGGCAACTTTAGGTCACTACCTTCAGGACGATGAATGTGTATAAAACT TTTTAATGGTCATTTGCTAAATATATGAAGGGTTAAATTGACAGCTTCAA GTTGGAAGGGGCCATCACTGTTTGTCATCAGAATCCATATTAAGAAACAA TTTGTTTTAAGCCTAAAGACTTAAAAATGGCCCTCAAGGAGAAAGGTGTT TACTTGCAAGGGTCAATGTTTACATAGATGTCCATTGGGTCACTTTTGGC TATTGGCCAATTGAAAAAGTCTATCCTATTGAGCTTTTTGAAAGGATCAT GTTTCGCTTATGGTATAACGTTTCAACTTTTTGTTTGTTTACAATCGGAT ACCAAAAGATTTGGCATCGTGTCAATCCTTAGAAAATATTATTCCACAAT GTGAAAAAATAGAAACATATTATAGACTTTAAAGTCGATAAGTTTTTATG GCCTCGTCCAATAGAAGGTTTAATATAATGCAGCTTAAGATCGAGCTTGT CCTTAGCTTGTCCTTGATTCTATTCGGTATCTTATTGCTAGAAACTTCAT TATTTTTCTAGTCTTTACATGAAATTAGCTCGTTCGACTTTCAATCATTT TTGACTGCAGCAAAAATTTTCCATATTTTAGTATTTTGTGTCAGTTTTCT TAAATTTGACATTCGAAAAGATTTATGCGTTATCGGCTATCAATATAGGC TTATGCATATCCAAGGGCTTAGCCTCTAAATAAAGACTTTAAATGTATGG AATTCCATATCGTGCGAGTGTGACCTTCATCGTATATTTCAGTACATCTC AGTCTTCCCATAGACTTTATTTATCAGACCAAGTTCAAAGTCTAAAATTC CTTTACTATTGCACATGTATTCAGGGCAAAACCGGAGAGGTCTTGTGGCG ACACCGTTACAAAGAAACAGTGTTCCCGATTCGAATCCTCGATCCTATGA TGGGTATTGTTTAAGAATTTTACAGTGATCGACATTCTCAATAGAATTTA GTTCATCTTCTTGCATTTGCCCCCCACCGATGATTTCCACGTTTTTTTAT AAGAACATTCAAAATTCTTGAACCTTCGGATCGTACTAACTTTTTGAATT TCAAGCCTAAAAATATTCTTAAAATGTTCTTATTTTTGTGAGTATTTTTG TGCAGTTTCCTAAGAAGTTATCGTATCATGGCTTGTTCTCAATATGGCCA TCAAAGCCCTGTGTTCATATATATTTTGTTCTTACAAAAAACGTGTATTG TTTGTGATTCTAACCAAGGACAATGATTGCACTTCAACCAATTCGTTCGG CTGTTTGTCAAAGAAAACCTTCTTCCTTCTAAAGAGTTCTTAAGCTATCC CTATCCAATATCCTTTCAATGACAATGTTCAACAAACATTATGTCATACT TGAGGAAGGAACCCTAAACCTTTTGTATATTGATATTTTTTGTTGCGCAA TTCTATTCCAGATTTTCTCTGGTTTGTTGACCTAGGGGATTTGATAATTT TGGCGCTCGATTTCGTTAATTAGATTTAACTCACTATAAAAAGATGTTCA CTTTTATAGTATACTCTCAATTATTCGAACTTACTTCCAGTCCCCGTCAA GGAGGAAACCTCTTAAAATACTTTCTATAATAAGAATCTCTCTGATTCGA ATAAATAAGATTTCCCGCTTGAGTTCGAATTGGCGACTGTCAACTGTATA TGAATTTTTTTGTATCAAGTTAGGTGCACCTTTAAATGTTTTGGGGTTTC ATACTGCCTTTCAGGTACGGAAAATTAAATGTCTTCGCGTTGGGAAGCAG CTTTTGGGTTGCGGTTTGATAATACCCATAATAGAAACTGCGAAATGTGT TTTCGTTATTTCATTTCTTTGTCATATCCTTACATAATGATTTATCTAAA ATAAGGTTATTAAGAGCCGGTTTAAAAAGGTCCGGTAGTTGAAAGGGTAT CAAACTTGTACATGAAAGCTAACAATTTGACTCAAAAGTATCGATGAGAA CGACTTGTGTACTGTTAAGTTAAGGTATTTCTTCATCTGTTGCTACAGTA GACGTTTGCACAGTTTTCAAATTAAAAGACTGCATACCTCAAACAGTCAT ACAGGGTGTAGATAGACGGTTGCCGGGGAGAAGTGCAAAGTGATGCAATT TCGTCCCATTTTATTAGTTGTAATCCTGTTATCAACTTAATTCGTTGATA AAAGTTTTGATGAGAAATACCTTTGATTTATAGTTAGCACTCATTCTATT TATCCTGTCTAATGATAGTTTGCCATCTTTAAAGTATACCGCGATAGTGG TTTAGTATATGCCATCATCTCCTTTGTCCATAACCTAAGATTGTACAAAG AATATCTTGGAAGCGTGGAACCATCCATTGTGTAGTTTAGAATGATTTGC ATTTGAAATCTCAGATTATAGGTATTCCTCCCCTAAGCGTTGTCTATTAA TTAGAACATGTACCTACTTACAATGGAGTTTCTTCAACTCGAGCCTCTAT AACTCGAATGTCTCCTTAACTCGAACGAGTTTTATGGTCCTTTCAGTTAA CAATGCCTTAAAAACCTTATGTACTCCATAACTCGAAATTTGTGTTTCAC TTTGCGTGTTCGAGTTATAGAGACTCAACTGTAGTATCTAGACAGCATGA CCAAAATATGACAAAGACGGTGTCACACAATTAGTGCAACTGTATTATTC AAGGTTATTAAAAAATTACAATCATTTTGCATGTAAAATATCCGGTGATT TCCAACGCAATTCACACTCATTTCTGCTCTTATTACGATGATTCTGCGTG ACGGATGTAAGGGTTGTCATTTTTTAGACATGGCAGTTTTCCAGTGAGAA TGAAGTGGTCGCTTCCAAAGCCCGGAAGATTTTAATATCCGCTTGTGTTT TCAATCACAAATTAAATCAAATAGTGTCTATTTCATAAAGAGAAAGGCGG CTTCTATTTTGTAGGTTACTTGTCCCTTTGTCTCCCGTTTTTCTTATTTT GGCGTATTTTTGTTTAGATTGTAAATCGTTTTGGAAGTTTTTTTCTCTCG CCACTTCAGTCGACACTCGATAACTTGATTTAACTCTCAACTTGTCCTGC TCGTCACCATTTAATTAGATCTAGAAGCGATTACCTTTTTCTGTTAGTTA GATAACTCATTAATTCGTTCAATCTCCTTGTCAAAGTAGAAAAAATCGCG CGACGTCATCTTTGTGTGACGTCATGTTTTTGTTTTTCGCACCTTTTGAG AGAGCTTTGATGACACCATTTTGTTTTTGAACAACTTCAAAAGAAGTTAT CAACCAACCAATCAATCAATCAATCAATCAATTTCATCCTAATATTTTTT CTTCTCGGTCTTTCTCTCTTCACAATTTTCAAATAATTATTTTTTTGGAA TTCTCTTTTTCTCCAGAGACAATTCAAGACAATTGAAGAGGCGTTACCGA CAACTGATGTGCTATACATGACACGAATTCAAAGAGAAAGATTTGCAGAC CAACAAGAATACGAGAAGGTAATTATCCCTCTCATCACGACACCTGGCCT CATCATTTAAAAATATTACCGTCCTTTTCTCGCGAATTTTCCGTCTCCTC AGAATATTCAAGGGGAACTGCGTCAATTCACATTCACACCTTAATGTTTA TCATCCATTCCGCGCACAACAACATGTTTCATAATGCTCTAAAGGGATGT GGCGAATATGATGATCTACCCTGGCTAGCTATTCAGTCGAAACATTCAAG ACCGCGTTTTTTCTTAGAAGCAAAAGCGACTGGGTTCTAATGTTTTTTTT AACGTTTTATTGGTGCGACGATTTCCAATCATATTTAAATTTCATCTGAA ATCTGGATGAGAAGTAACGAAGCAGCTTGCCAACATTGGCAGATTCTTTG ATGACGACCATTTCCCATTCCTACCCATCGTTAACTTTACTACTTTGTCT GTTACTCGTTTTTTTTATAAGAATAGACAATATATGTGCGTAAGAATCGG TGTCTAAAAGTGCACTAAGAAAGTTTAAGGCTTCGCAGTCTCTTAAACGC CCAATTTCTTAGAGATTCCCACATTATGCTGAAAATAGAACATTTTTTCC AAATCTAAAAAGTTTAGAATGCATGGATCTGAATGAGATTTGAGATCCTG TTATAAGAATAACTTACTGATATAAATGAGAATCAGGGAAACCTTGGGAG TTTGTAGTTTCTATGCCAAGCATGTGTAAAAAGGTTTCAATGCATAAGTT CTTCAGAACAAAATTTGCTGAATAACTAAACCATACGGCATAAATGAATC GGCAGCCGGTTCTCGGTATTTTTCTTCTTTTTTCGGGTATTCTCAAACGC GTGGGGTGTGTAATTACATGTTGCAATTTTATCTCTAGTGTGAAAAAATG AGGAAAACAAAAGCGAGAAAGTATTTTCTTTTCTATTGACATTGACTCAT TGTTCTATATATTGTTCTCCTGATATTGTTTAACTAGCTGTCCTTACTAA CGCCCCACCACGCCATCTATTCCATATTGACACAGTTGTCTTTTTTTCCT TTTTGCGACTGGTAGCGAAAATTCAAAACTTTCGGCTCCTTGAGAAAGCG CATAATGCTCATTCATCTCCATGTGCTTTCATTTTCGAAATTTGAAATTG AATCGGTCGGTTTAATCAGGTCATTAAATTAAAATTTTACCTATTATTAA TATTGGCTGGTCCCTCTGATACTTGGTAGTCGCCACCTGATATTAGAGAA GTCGCTCCTTCGATGTATTCATCGCAACTTTGGCGATAGATATATTTTTT AACTTTGGATTTTTGCCCCCTTTCCGGGCAGGTTCTTGTAACTAACACAG CCCCCTGGGAAATATTATTGAAACATTTTCATTAGCATTTTATCTGTTTA AGATTTCTTTTCTTTTCATCTAATCAACTCGAGAAATTGACATTTTAGTA ACCAGATTAAACCCTTGCTGGGCCAATTGAATTTCACTGATCCCCTTTTT CATGCTACACCACCTAATGTTTGCCAAAATTGCCAAAATTGTCGAAAGAA ATACAGTAACAAGATCAATGAATCCATTTTGATTAAAAATGCACCTTCGA ACACTTAAGGGTGGCTTGAAAGAAACTTTTTTAAATGAATATTAGTTCGA AATGGTAAAAAATTCACATTGTAACTCAATATGAAATACGGAATTGGCTT CTACATAAACATGCAATTTATTTACGACGATAGAGGGGGAGAAATTTCCA ACCGTGAATCTTTCGTTATGCTGTCAAACAGCCATTTATCAAAACAAGAA AAATATGATCCTTTTAACCGCGCACTCAACCATCTCGCAAATCATTCCAT TTATTACAAATATCAACAGTTTTTATCCCACATAAAATTTAAACCTTTTG TTTACCACCTTGTTGCAAAAGTGAGGCGTGATTTTTCGCGAATTTTTACG AAATTTAAGCAACGGGAAGACTATAAAATTCAAATTTTGGCTAAAACTCC AAAGACAATATAAGAAATTAAGCGGGAAAAAGCCCATTCGCGAAATTTAA TCTATCAACGCGATATTATTTGAAAAAGTGCCCGCAAAAAAAATGTATTC TTTGAAGTAAATTGGAAATGAATCCTAAAAGAAATGTTTTCAATCAAATC ATTCGAGTTGAGGCTCAAGGTCTCAAAATTCAGAACAACCGGGCTCCGCC AAAAAAATACAGACTTTTATAGAAAATGGCGTTCGCTTAACTGTTTTTTT TTTTCAATTTTTAGGTGCATGGTTATTTCGTGTTGACACCGAAAATGTTG ACGAAAGCGAAGAACAAGATGATCGTTATGCACCCATTCCCAAGAGTCAA CGAAATCAGGTATGAAACATCCTTCAAACTTCCCTCTCAGACGAAGTATG TACTAAAAGAAACTTTCCCGACTCAAAGTTAAGCAAAATTTTGGAAAATT TTGGAGAATATGAGTTAATGTTTACGTTTTGTGTAAATTTCAAGAAGCTA GGGGTTCTTTTGTTCCGATTCTAAATAAGCAGGACTCTCTTTATCCGTGT AACATCATTTTCGATGCTCAGATCTTTAAAACACTTTGTAGTTTTGTGGT CGTTTGAGCCTGATGTATTGTGTATGGCATTTAAGATAAATACTATACGA CAGAACGTTTTCTCTTTTCAGTACTGAAGTGGATTGCGACCCAAGGGCTG CTTATTTCCGTCAAATGGAATACGGGATGTTTGTTCGAATGGCTTTACTT TCCATGTTGACTGGTCGATTTTAATGGACAGAGAAAACCGAAAATTTACG TAATCTTTGTCATAAAAGAAAACGTCACAAAAAGCGAAAATATTGTAGCC ATCTGAGCACTAATTTTATAGCTCGACAAAAGAATATATTATAATGGATT GTAGGGCAATTTTGTAGTCATTAATTTTTAAGTCGGACAATTTTCGGTCA AAGAATTTATCACTTTCCCAAAAGAGACATTGCAAATTCGTTTCTAATTA TTTCGTTAATTGGTATTGTCGACAGTAATTAGATGTTTGTGATATTATTT TTGCGGTTCATATTTGAGATTTTTTTATTTTTGTAGCTTTTTTTCCAGAT CCCTTTTTTAGTTTTATATATTTTTACTTTTGGGATAAATAGGCTTTTTT ATTATCATATTATTGAAAAAAATAATCAAAAAATCTTGACATAAAAAAGG AATACAACATTTGATCATTTGCTTATGTGAAAGATTGTTTATTGTAGACC ACAATCCTCGCAAAACCAATTTCCTGAAAACCGTCACTTTCACCTAAAGT GCGGACTACATTCTTGCGAACTTTTACGAAAGGTATTAGCACTCTTCTTG CCGGAAATTTAGGAAGTTCTTTCAACCGTCAAAATACACTCTAGATTGCG GTTTTTCCATAGTGAATTTTCGTTTTGAATGAATAATTTCTTCTTTATCT TAAACTCTCACGATATAAGTTAGTACTATGAAATTAAGGGGAATGAATGA AAGAGTACTATATTCAAATCAGCC

Coding sequence (CDS) from alignment at sc0000012:62297..121470-

>TCONS_00001872 ID=TCONS_00001872|Name=TCONS_00001872|organism=Clytia hemisphaerica|type=CDS|length=135072bp|location=Sequence derived from alignment at sc0000012:62297..121470- (Clytia hemisphaerica)
TTGGCCATTAAGAACGCTCGCTGTGATTTCGCCTTGTACGCTGGTGCCAG
TTCAACCAATGCTCTAATGTTGCCAAAGATTGCACCAGGATGTGCTGGTC
TCAAAATGTACCTCAACGATACTTACACTACCTTGAAGATGGACAACCTC
NAAGATTGCACCAGGTTGTGCTGGTCTCAAAATGTACCTCAACGATACTT
ACACTACCTTGAAGATGGACAACCTCTCTGAGCATTGTTCAAAGTGGGCA
GCAAGATCGAAGTGAAAACACACATTGATTGCATTTCATCGGGAAACATT
GTGCGATTGCCAGGTCTCATTGATGTCCACGTACACTTGCGACAACCTGG
TGCCGAGTACAAAGAAGATTTCGATAGCGGTACTGCAGCCGCACTGGCCG
GTGGCGTCACCATGGTGCTGTGTATGCCGAACACCAAGCCAGCTGTGGTG
GATCAACCCACTTTCCAGCTTGCGCACCAAGTCCAAATCATTGATTGGCC
TTTCGAGGAGAATGGAACTGAGGGTCAGGAAGAGAGCATTCAAGACTACC
TCACACAGAACAAATTTGATTTGGTCATCAACATTCCAATGAGGGGTAGT
GGTACCAAGAAGAAGTCTCATTTCATCACACATGGATATCGCACCCGACG
AATGGCCATCGATCATTCCGTCTCATTGATCACCAACATTAAGTGTGCCA
AACTCTTCTGTGAAGCGAAGAAAGAAATGTTGCCAAGTGTTCGTTTACTG
GAGAAGATGGGATACGAATTGTATGCTAGCATGGGTACCGGTGACTTCTA
TCAAGAACATGGTGTACAGGTGCCACAATTTTCATTTTCACGACTTGCTG
GAGCTGACGTTCAACTTGGAGTAGAGATGGCAAGCACAGGAGAAGTAGCA
TGCTTCGGTGAAAATAGATACGAAGCTTACTTGAAGGCCTTGATGAGCAC
AGGTTTCAAATTACCCAAGAAAAACATACTGCTGACTGTTGGTAGTTATA
AGGACAATCAATTGAAGGTGATCGAATGCAATTTACGGGTGTCTCGGTCC
TTCCCTTTTGTTTCCAAAACTCTAGATTGTGATTTGGTTGCCTTGGCAAC
CAAAATCATCGTTGGTGCTCCTGCTGAACCTGCATTCAACATTATGGATA
AGTGTGAGAAGATCGGCTGTAAGGAAATTGACGTTGATGCCGTTGCCAAC
GACGGTGAAGTGATGGCCATGGTCGTCTCTGAACACGTTGAAAACGCGGG
TGTCCACTCTGGTGACGCAACCATGATCTGTCCACCACAAGACATCAATA
CGGAAACCATGGGACGGATCAAACAGATCTGTATTGCAGTTGGAAACGCC
CTCAATGTGTCTGGTCCTTTCAATATGCAACTTATTGCTAAGGAAGCCTA
TCAATTCTGCACCAAAGTTGGTTACCCAGTGCTGGTACGACCTTCATACG
TGTTGAGTGGAGCTGCCATGAATGTTGTTTATGCTGAAGATGATTTAGAA
TCATATCTTGGATCTGCTGTCTCCATCTCTAAGGAGCATCCAGTTGTCAT
CTCCAAATTTATATCCAATGCTAAAATGGAAAGAGTTGACCACGATGGAG
GTGAGGATCCTTGGCACATCGCCAGAAATGATTGACAACGCTGAAAACAG
ATTCAAATTCTCTCGTATGCTAGACAACATTGGAATCCTACAACCAACAC
AATCATGGATATCTACCATAAAGAAGACCCAGAAGGTATTATCTTATCAA
TGGGAGGACAGGTTGCCAACAACATTGCTATGCATCTCCACAGACAGGAA
CTTGGTAAGAGCACAATTATGGTGAATTACAATCCTGAAACTGTCAGTAC
AGACTATGATGAATGTGATCGATTGTACTTCGATGAAATCACATTTGAGT
TCTGAACTGGTTATCCGCAAGTACCGTTATGAATGCAACATTTTGCCCTG
TTTCAAGCAAATTGACACTGTTGCTGCAGAATTCCCAGCTGAAGCTAACT
ATCTGTATTTAACTTACAATGGAGATTGTGATGACGTCACATACGCAGAA
AGCCAAAACAAAGTCATGGTTATTGGGTCAGGTGTCTACAGAATCGGAAG
CAGTGTTGAATTTGATGCATGTGCTGTTGGATGTATTCGAGAATTGAAGA
GGGTTGGAGCTGGAAAGGACACCATTCCATGCAATATCCTACTGAAGGGG
AAGCAGCTTGGATTTTCAGATAAGCAAATTGCTAACTGCGTTCAAAGGTC
TTAGTTGAGCCCTCTGACAAAAGAATCTTTCATGTTGCTGCTGCACTCCG
TAGAGGATATTCTATTGATCAGCTGTATGAGCTCACTCGTATTGATAAGT
GGTTTTTGAGCAAGCTAGCAAAAATAATCAACTATGCAAAAATGCTGGAA
GAGAAATACCCAAAGATTGGATCTTCGATGAAGAGTGTTGGTGAAGTAAT
GGCTATTGGAAGAAGTTTTGAGGAAGCCATTCAAAAGAGTTTGAGAATGG
TTGACGATTCAAACCTTGGTTTTGATGCAAACAACCTCGAGTTGGATGAA
CAGTTCTACATCATTGAGGTCAATGCTCGTCTCTCCAGAAGTTCAGCTCT
TGCTTCCAAAGCAACTGGATACCCATTGGCTTACGTTGCTGCTAAACTTG
CACTTGGTATTCCTCTACCAAAACTGAGAAATTCTGTCACCAATTCAACT
ACCGCTTGTTTTGAGCCCTCTTTGGATTATTGTGTTGTGAAAGTTCCTCG
ATGGGATCTGGACAAATTTCAGAGGGTTTCAACAAAGGTTTGTAATATGG
AAAACTTTGACCCTTTGGGAATCCATACGGGTGAATCAATTGTTGTTGCA
CCAAGTCAAACACTAACAAATGAGGAATACAATATGCTTAGAAGAACAGC
CATCAAAGTCATCCGTAAACTTGGTGTTGTTGGTGAATGTAACATCCAGT
ATGCTTTACACCCTGACTCAAAAGAGGCTATCACAGCAGCTAACAGGCTA
GGATATCCAGTGTTGTTACGTGCAGCATTTGCACTAGGTGGACTTGGATC
TGGTTTTGCTTCCAATGACAATGAGCTCAAAAAGCTTGCAGCATCGGCTT
TTGCACATTCCAAACAGTGTCTAGTTGACAAGTCACTGAAAGGATGGAAA
GAAGTTGAATATGAAGTTGTTAGAGATGCTTATGACAACTGTATCACTGT
GATTGAAGTAGAAAGACCAGATGGCATTCTGTTATCATTTGGTGGACAAA
CAGCATTGAACTGTGGACTGCTATTGAAAGAGAGGGGAATTTTAGAGAAA
TACAATGTTGCTGTTCTTGGTACACCTACCAAATCGATTGAATGGACAGA
AGATAGGAAAATGTTTTCAGACAAGATGGGAGAGATTGGTGAGAAAGTTG
CACCAAGCTCAGTGGCTTATACTGTGGATGAGTCAAACCAAAGAAGGTCT
TGATTTTGGGATCTGGTGGCTTATCTATTGGTCAAGCCGGAGAATTTGAT
TATTCTGGCTCTCAAGCTATCAAAGCATTAAAAGAAGAGAAGATTCACAC
AGTTTTGATCAATCCTAATATTGCTACAGTGCAAACTTCCAAAGGACTTG
CAGATAAAACTTACTTCCTTCCTGTTAACTTTGAATTCACAAGCAAGATA
TGGTAACAGAGGACATAACCAACCTGCAACCCATTTGGAAACTCAACGTT
GCTTCATCACTTGCCAAAATCATGGCTTTGCAATTGACACAGACAGCTTA
CCAAAAGAATGGTCTGTTTTGTTTACAAATGAGAATGATGGCAGTAATGA
AGGCATTGTTCACAACACAAAGCCAATCTTCTCAGTTCAGTTTCATCCTG
AACATCAAGGAGGACCAAGAGATTTGGAGCTTTTGTTTGGCTTTTTTGTG
GATATTGTAAACAAACTGAAAATCGATTCTAACCTCTGCTTACGAACCAT
GCTGAAAGAAACGTTGACTTTCCACCCAGCAGAAGAAACAAGATCCAGAG
CATAATATGATGGTCTGTTTATGAGCAATGGTCCTGGAGATCCTAGCCTT
TGTCAAGTTTCAATTGACACCCTCCGTAAAGTCATTACAGAATTGCCAGA
TGTGCCAGTCTTTGGTATTTGCATGGGTCATCAGATCTTATCTCTTGCTG
CTGGATGTGGGTCCTACAAAATGAAGAACCTAAACTTTACAATCCTAAGG
GTAAAATAAAGATGATTGCTGTAGACTTTGGTATCAAATACAACCAGATC
CGGTGTTTGATTGATTGTGATTGTCAGGTTCTAGTTGTTCCATGGGATTA
TGACTATAGTACATTGTTAAAGAACAAAGATTGTTTTGGATGGAGAGGAT
GAAGCAAGTGTTCCATTTGATGATCCAAACAAAAGGAATTTGATTGCTGA
AGTCTCTTGCAAGGTATTGATACCAGAGCATTAACAAAGAAGTTGAGAGA
AAATGGAACAATGTTAGGAAAGTCTTCCAAACTGGTATGGTTGGTTACCC
AGAATCATTGACAGATCCTTCATACAACAGTCAAATCTTGGTATTGACGT
ATCCACTGATTGGTAATTATGGTATACCAAACGATTCTCGTGATGAACAT
GGCATGCTCAAATTTTTTGAATCTGAAAAGATTTGGAACAATGGTATGAT
TGTAGGAGACTTGACTGAGGACTACAGCCATTGGTTGGCAACCAAATCAC
TTTCAGAGTGGCTGAAGGAACACAAAATACCTGGAATTACTGATGGCGAC
ACTTATTCTTGATGATGGCACCAAATATCATGGTCAAATTTTTGGTGATG
AAAGAAGTATTGCAGGAGAAGTTGTTGGCCATTAAGAACGCTCGCTGTGA
TTTCGCCTTGTACGCTGGTGCCAGTTCAACCAATGCTCTAATGTTGCCAA
AGATTGCACCAGGATGTGCTGGTCTCAAAATGTACCTCAACGATACTTAC
ACTACCTTGAAGATGGACAACCTCNAAGATTGCACCAGGTTGTGCTGGTC
TCAAAATGTACCTCAACGATACTTACACTACCTTGAAGATGGACAACCTC
TCTGAGCATTGTTCAAAGTGGGCAGCAAGATCGAAGTGAAAACACACATT
GATTGCATTTCATCGGGAAACATTGTGCGATTGCCAGGTCTCATTGATGT
CCACGTACACTTGCGACAACCTGGTGCCGAGTACAAAGAAGATTTCGATA
GCGGTACTGCAGCCGCACTGGCCGGTGGCGTCACCATGGTGCTGTGTATG
CCGAACACCAAGCCAGCTGTGGTGGATCAACCCACTTTCCAGCTTGCGCA
CCAAGTCCAAATCATTGATTGGCCTTTCGAGGAGAATGGAACTGAGGGTC
AGGAAGAGAGCATTCAAGACTACCTCACACAGAACAAATTTGATTTGGTC
ATCAACATTCCAATGAGGGGTAGTGGTACCAAGAAGAAGTCTCATTTCAT
CACACATGGATATCGCACCCGACGAATGGCCATCGATCATTCCGTCTCAT
TGATCACCAACATTAAGTGTGCCAAACTCTTCTGTGAAGCGAAGAAAGAA
ATGTTGCCAAGTGTTCGTTTACTGGAGAAGATGGGATACGAATTGTATGC
TAGCATGGGTACCGGTGACTTCTATCAAGAACATGGTGTACAGGTGCCAC
AATTTTCATTTTCACGACTTGCTGGAGCTGACGTTCAACTTGGAGTAGAG
ATGGCAAGCACAGGAGAAGTAGCATGCTTCGGTGAAAATAGATACGAAGC
TTACTTGAAGGCCTTGATGAGCACAGGTTTCAAATTACCCAAGAAAAACA
TACTGCTGACTGTTGGTAGTTATAAGGACAATCAATTGAAGGTGATCGAA
TGCAATTTACGGGTGTCTCGGTCCTTCCCTTTTGTTTCCAAAACTCTAGA
TTGTGATTTGGTTGCCTTGGCAACCAAAATCATCGTTGGTGCTCCTGCTG
AACCTGCATTCAACATTATGGATAAGTGTGAGAAGATCGGCTGTAAGGAA
ATTGACGTTGATGCCGTTGCCAACGACGGTGAAGTGATGGCCATGGTCGT
CTCTGAACACGTTGAAAACGCGGGTGTCCACTCTGGTGACGCAACCATGA
TCTGTCCACCACAAGACATCAATACGGAAACCATGGGACGGATCAAACAG
ATCTGTATTGCAGTTGGAAACGCCCTCAATGTGTCTGGTCCTTTCAATAT
GCAACTTATTGCTAAGGAAGCCTATCAATTCTGCACCAAAGTTGGTTACC
CAGTGCTGGTACGACCTTCATACGTGTTGAGTGGAGCTGCCATGAATGTT
GTTTATGCTGAAGATGATTTAGAATCATATCTTGGATCTGCTGTCTCCAT
CTCTAAGGAGCATCCAGTTGTCATCTCCAAATTTATATCCAATGCTAAAA
TGGAAAGAGTTGACCACGATGGAGGTGAGGATCCTTGGCACATCGCCAGA
AATGATTGACAACGCTGAAAACAGATTCAAATTCTCTCGTATGCTAGACA
ACATTGGAATCCTACAACCAACACAATCATGGATATCTACCATAAAGAAG
ACCCAGAAGGTATTATCTTATCAATGGGAGGACAGGTTGCCAACAACATT
GCTATGCATCTCCACAGACAGGAACTTGGTAAGAGCACAATTATGGTGAA
TTACAATCCTGAAACTGTCAGTACAGACTATGATGAATGTGATCGATTGT
ACTTCGATGAAATCACATTTGAGTTCTGAACTGGTTATCCGCAAGTACCG
TTATGAATGCAACATTTTGCCCTGTTTCAAGCAAATTGACACTGTTGCTG
CAGAATTCCCAGCTGAAGCTAACTATCTGTATTTAACTTACAATGGAGAT
TGTGATGACGTCACATACGCAGAAAGCCAAAACAAAGTCATGGTTATTGG
GTCAGGTGTCTACAGAATCGGAAGCAGTGTTGAATTTGATGCATGTGCTG
TTGGATGTATTCGAGAATTGAAGAGGGTTGGAGCTGGAAAGGACACCATT
CCATGCAATATCCTACTGAAGGGGAAGCAGCTTGGATTTTCAGATAAGCA
AATTGCTAACTGCGTTCAAAGGTCTTAGTTGAGCCCTCTGACAAAAGAAT
CTTTCATGTTGCTGCTGCACTCCGTAGAGGATATTCTATTGATCAGCTGT
ATGAGCTCACTCGTATTGATAAGTGGTTTTTGAGCAAGCTAGCAAAAATA
ATCAACTATGCAAAAATGCTGGAAGAGAAATACCCAAAGATTGGATCTTC
GATGAAGAGTGTTGGTGAAGTAATGGCTATTGGAAGAAGTTTTGAGGAAG
CCATTCAAAAGAGTTTGAGAATGGTTGACGATTCAAACCTTGGTTTTGAT
GCAAACAACCTCGAGTTGGATGAACAGTTCTACATCATTGAGGTCAATGC
TCGTCTCTCCAGAAGTTCAGCTCTTGCTTCCAAAGCAACTGGATACCCAT
TGGCTTACGTTGCTGCTAAACTTGCACTTGGTATTCCTCTACCAAAACTG
AGAAATTCTGTCACCAATTCAACTACCGCTTGTTTTGAGCCCTCTTTGGA
TTATTGTGTTGTGAAAGTTCCTCGATGGGATCTGGACAAATTTCAGAGGG
TTTCAACAAAGGTTTGTAATATGGAAAACTTTGACCCTTTGGGAATCCAT
ACGGGTGAATCAATTGTTGTTGCACCAAGTCAAACACTAACAAATGAGGA
ATACAATATGCTTAGAAGAACAGCCATCAAAGTCATCCGTAAACTTGGTG
TTGTTGGTGAATGTAACATCCAGTATGCTTTACACCCTGACTCAAAAGAG
GCTATCACAGCAGCTAACAGGCTAGGATATCCAGTGTTGTTACGTGCAGC
ATTTGCACTAGGTGGACTTGGATCTGGTTTTGCTTCCAATGACAATGAGC
TCAAAAAGCTTGCAGCATCGGCTTTTGCACATTCCAAACAGTGTCTAGTT
GACAAGTCACTGAAAGGATGGAAAGAAGTTGAATATGAAGTTGTTAGAGA
TGCTTATGACAACTGTATCACTGTGATTGAAGTAGAAAGACCAGATGGCA
TTCTGTTATCATTTGGTGGACAAACAGCATTGAACTGTGGACTGCTATTG
AAAGAGAGGGGAATTTTAGAGAAATACAATGTTGCTGTTCTTGGTACACC
TACCAAATCGATTGAATGGACAGAAGATAGGAAAATGTTTTCAGACAAGA
TGGGAGAGATTGGTGAGAAAGTTGCACCAAGCTCAGTGGCTTATACTGTG
GATGAGTCAAACCAAAGAAGGTCTTGATTTTGGGATCTGGTGGCTTATCT
ATTGGTCAAGCCGGAGAATTTGATTATTCTGGCTCTCAAGCTATCAAAGC
ATTAAAAGAAGAGAAGATTCACACAGTTTTGATCAATCCTAATATTGCTA
CAGTGCAAACTTCCAAAGGACTTGCAGATAAAACTTACTTCCTTCCTGTT
AACTTTGAATTCACAAGCAAGATATGGTAACAGAGGACATAACCAACCTG
CAACCCATTTGGAAACTCAACGTTGCTTCATCACTTGCCAAAATCATGGC
TTTGCAATTGACACAGACAGCTTACCAAAAGAATGGTCTGTTTTGTTTAC
AAATGAGAATGATGGCAGTAATGAAGGCATTGTTCACAACACAAAGCCAA
TCTTCTCAGTTCAGTTTCATCCTGAACATCAAGGAGGACCAAGAGATTTG
GAGCTTTTGTTTGGCTTTTTTGTGGATATTGTAAACAAACTGAAAATCGA
TTCTAACCTCTGCTTACGAACCATGCTGAAAGAAACGTTGACTTTCCACC
CAGCAGAAGAAACAAGATCCAGAGCATAATATGATGGTCTGTTTATGAGC
AATGGTCCTGGAGATCCTAGCCTTTGTCAAGTTTCAATTGACACCCTCCG
TAAAGTCATTACAGAATTGCCAGATGTGCCAGTCTTTGGTATTTGCATGG
GTCATCAGATCTTATCTCTTGCTGCTGGATGTGGGTCCTACAAAATGAAG
AACCTAAACTTTACAATCCTAAGGGTAAAATAAAGATGATTGCTGTAGAC
TTTGGTATCAAATACAACCAGATCCGGTGTTTGATTGATTGTGATTGTCA
GGTTCTAGTTGTTCCATGGGATTATGACTATAGTACATTGTTAAAGAACA
AAGATTGTTTTGGATGGAGAGGATGAAGCAAGTGTTCCATTTGATGATCC
AAACAAAAGGAATTTGATTGCTGAAGTCTCTTGCAAGGTATTGATACCAG
AGCATTAACAAAGAAGTTGAGAGAAAATGGAACAATGTTAGGAAAGTCTT
CCAAACTGGTATGGTTGGTTACCCAGAATCATTGACAGATCCTTCATACA
ACAGTCAAATCTTGGTATTGACGTATCCACTGATTGGTAATTATGGTATA
CCAAACGATTCTCGTGATGAACATGGCATGCTCAAATTTTTTGAATCTGA
AAAGATTTGGAACAATGGTATGATTGTAGGAGACTTGACTGAGGACTACA
GCCATTGGTTGGCAACCAAATCACTTTCAGAGTGGCTGAAGGAACACAAA
ATACCTGGAATTACTGATGGCGACACTTATTCTTGATGATGGCACCAAAT
ATCATGGTCAAATTTTTGGTGATGAAAGAAGTATTGCAGGAGAAGTTGTT
GGCCATTAAGAACGCTCGCTGTGATTTCGCCTTGTACGCTGGTGCCAGTT
CAACCAATGCTCTAATGTTGCCAAAGATTGCACCAGGATGTGCTGGTCTC
AAAATGTACCTCAACGATACTTACACTACCTTGAAGATGGACAACCTCNA
AGATTGCACCAGGTTGTGCTGGTCTCAAAATGTACCTCAACGATACTTAC
ACTACCTTGAAGATGGACAACCTCTCTGAGCATTGTTCAAAGTGGGCAGC
AAGATCGAAGTGAAAACACACATTGATTGCATTTCATCGGGAAACATTGT
GCGATTGCCAGGTCTCATTGATGTCCACGTACACTTGCGACAACCTGGTG
CCGAGTACAAAGAAGATTTCGATAGCGGTACTGCAGCCGCACTGGCCGGT
GGCGTCACCATGGTGCTGTGTATGCCGAACACCAAGCCAGCTGTGGTGGA
TCAACCCACTTTCCAGCTTGCGCACCAAGTCCAAATCATTGATTGGCCTT
TCGAGGAGAATGGAACTGAGGGTCAGGAAGAGAGCATTCAAGACTACCTC
ACACAGAACAAATTTGATTTGGTCATCAACATTCCAATGAGGGGTAGTGG
TACCAAGAAGAAGTCTCATTTCATCACACATGGATATCGCACCCGACGAA
TGGCCATCGATCATTCCGTCTCATTGATCACCAACATTAAGTGTGCCAAA
CTCTTCTGTGAAGCGAAGAAAGAAATGTTGCCAAGTGTTCGTTTACTGGA
GAAGATGGGATACGAATTGTATGCTAGCATGGGTACCGGTGACTTCTATC
AAGAACATGGTGTACAGGTGCCACAATTTTCATTTTCACGACTTGCTGGA
GCTGACGTTCAACTTGGAGTAGAGATGGCAAGCACAGGAGAAGTAGCATG
CTTCGGTGAAAATAGATACGAAGCTTACTTGAAGGCCTTGATGAGCACAG
GTTTCAAATTACCCAAGAAAAACATACTGCTGACTGTTGGTAGTTATAAG
GACAATCAATTGAAGGTGATCGAATGCAATTTACGGGTGTCTCGGTCCTT
CCCTTTTGTTTCCAAAACTCTAGATTGTGATTTGGTTGCCTTGGCAACCA
AAATCATCGTTGGTGCTCCTGCTGAACCTGCATTCAACATTATGGATAAG
TGTGAGAAGATCGGCTGTAAGGAAATTGACGTTGATGCCGTTGCCAACGA
CGGTGAAGTGATGGCCATGGTCGTCTCTGAACACGTTGAAAACGCGGGTG
TCCACTCTGGTGACGCAACCATGATCTGTCCACCACAAGACATCAATACG
GAAACCATGGGACGGATCAAACAGATCTGTATTGCAGTTGGAAACGCCCT
CAATGTGTCTGGTCCTTTCAATATGCAACTTATTGCTAAGGAAGCCTATC
AATTCTGCACCAAAGTTGGTTACCCAGTGCTGGTACGACCTTCATACGTG
TTGAGTGGAGCTGCCATGAATGTTGTTTATGCTGAAGATGATTTAGAATC
ATATCTTGGATCTGCTGTCTCCATCTCTAAGGAGCATCCAGTTGTCATCT
CCAAATTTATATCCAATGCTAAAATGGAAAGAGTTGACCACGATGGAGGT
GAGGATCCTTGGCACATCGCCAGAAATGATTGACAACGCTGAAAACAGAT
TCAAATTCTCTCGTATGCTAGACAACATTGGAATCCTACAACCAACACAA
TCATGGATATCTACCATAAAGAAGACCCAGAAGGTATTATCTTATCAATG
GGAGGACAGGTTGCCAACAACATTGCTATGCATCTCCACAGACAGGAACT
TGGTAAGAGCACAATTATGGTGAATTACAATCCTGAAACTGTCAGTACAG
ACTATGATGAATGTGATCGATTGTACTTCGATGAAATCACATTTGAGTTC
TGAACTGGTTATCCGCAAGTACCGTTATGAATGCAACATTTTGCCCTGTT
TCAAGCAAATTGACACTGTTGCTGCAGAATTCCCAGCTGAAGCTAACTAT
CTGTATTTAACTTACAATGGAGATTGTGATGACGTCACATACGCAGAAAG
CCAAAACAAAGTCATGGTTATTGGGTCAGGTGTCTACAGAATCGGAAGCA
GTGTTGAATTTGATGCATGTGCTGTTGGATGTATTCGAGAATTGAAGAGG
GTTGGAGCTGGAAAGGACACCATTCCATGCAATATCCTACTGAAGGGGAA
GCAGCTTGGATTTTCAGATAAGCAAATTGCTAACTGCGTTCAAAGGTCTT
AGTTGAGCCCTCTGACAAAAGAATCTTTCATGTTGCTGCTGCACTCCGTA
GAGGATATTCTATTGATCAGCTGTATGAGCTCACTCGTATTGATAAGTGG
TTTTTGAGCAAGCTAGCAAAAATAATCAACTATGCAAAAATGCTGGAAGA
GAAATACCCAAAGATTGGATCTTCGATGAAGAGTGTTGGTGAAGTAATGG
CTATTGGAAGAAGTTTTGAGGAAGCCATTCAAAAGAGTTTGAGAATGGTT
GACGATTCAAACCTTGGTTTTGATGCAAACAACCTCGAGTTGGATGAACA
GTTCTACATCATTGAGGTCAATGCTCGTCTCTCCAGAAGTTCAGCTCTTG
CTTCCAAAGCAACTGGATACCCATTGGCTTACGTTGCTGCTAAACTTGCA
CTTGGTATTCCTCTACCAAAACTGAGAAATTCTGTCACCAATTCAACTAC
CGCTTGTTTTGAGCCCTCTTTGGATTATTGTGTTGTGAAAGTTCCTCGAT
GGGATCTGGACAAATTTCAGAGGGTTTCAACAAAGGTTTGTAATATGGAA
AACTTTGACCCTTTGGGAATCCATACGGGTGAATCAATTGTTGTTGCACC
AAGTCAAACACTAACAAATGAGGAATACAATATGCTTAGAAGAACAGCCA
TCAAAGTCATCCGTAAACTTGGTGTTGTTGGTGAATGTAACATCCAGTAT
GCTTTACACCCTGACTCAAAAGAGGCTATCACAGCAGCTAACAGGCTAGG
ATATCCAGTGTTGTTACGTGCAGCATTTGCACTAGGTGGACTTGGATCTG
GTTTTGCTTCCAATGACAATGAGCTCAAAAAGCTTGCAGCATCGGCTTTT
GCACATTCCAAACAGTGTCTAGTTGACAAGTCACTGAAAGGATGGAAAGA
AGTTGAATATGAAGTTGTTAGAGATGCTTATGACAACTGTATCACTGTGA
TTGAAGTAGAAAGACCAGATGGCATTCTGTTATCATTTGGTGGACAAACA
GCATTGAACTGTGGACTGCTATTGAAAGAGAGGGGAATTTTAGAGAAATA
CAATGTTGCTGTTCTTGGTACACCTACCAAATCGATTGAATGGACAGAAG
ATAGGAAAATGTTTTCAGACAAGATGGGAGAGATTGGTGAGAAAGTTGCA
CCAAGCTCAGTGGCTTATACTGTGGATGAGTCAAACCAAAGAAGGTCTTG
ATTTTGGGATCTGGTGGCTTATCTATTGGTCAAGCCGGAGAATTTGATTA
TTCTGGCTCTCAAGCTATCAAAGCATTAAAAGAAGAGAAGATTCACACAG
TTTTGATCAATCCTAATATTGCTACAGTGCAAACTTCCAAAGGACTTGCA
GATAAAACTTACTTCCTTCCTGTTAACTTTGAATTCACAAGCAAGATATG
GTAACAGAGGACATAACCAACCTGCAACCCATTTGGAAACTCAACGTTGC
TTCATCACTTGCCAAAATCATGGCTTTGCAATTGACACAGACAGCTTACC
AAAAGAATGGTCTGTTTTGTTTACAAATGAGAATGATGGCAGTAATGAAG
GCATTGTTCACAACACAAAGCCAATCTTCTCAGTTCAGTTTCATCCTGAA
CATCAAGGAGGACCAAGAGATTTGGAGCTTTTGTTTGGCTTTTTTGTGGA
TATTGTAAACAAACTGAAAATCGATTCTAACCTCTGCTTACGAACCATGC
TGAAAGAAACGTTGACTTTCCACCCAGCAGAAGAAACAAGATCCAGAGCA
TAATATGATGGTCTGTTTATGAGCAATGGTCCTGGAGATCCTAGCCTTTG
TCAAGTTTCAATTGACACCCTCCGTAAAGTCATTACAGAATTGCCAGATG
TGCCAGTCTTTGGTATTTGCATGGGTCATCAGATCTTATCTCTTGCTGCT
GGATGTGGGTCCTACAAAATGAAGAACCTAAACTTTACAATCCTAAGGGT
AAAATAAAGATGATTGCTGTAGACTTTGGTATCAAATACAACCAGATCCG
GTGTTTGATTGATTGTGATTGTCAGGTTCTAGTTGTTCCATGGGATTATG
ACTATAGTACATTGTTAAAGAACAAAGATTGTTTTGGATGGAGAGGATGA
AGCAAGTGTTCCATTTGATGATCCAAACAAAAGGAATTTGATTGCTGAAG
TCTCTTGCAAGGTATTGATACCAGAGCATTAACAAAGAAGTTGAGAGAAA
ATGGAACAATGTTAGGAAAGTCTTCCAAACTGGTATGGTTGGTTACCCAG
AATCATTGACAGATCCTTCATACAACAGTCAAATCTTGGTATTGACGTAT
CCACTGATTGGTAATTATGGTATACCAAACGATTCTCGTGATGAACATGG
CATGCTCAAATTTTTTGAATCTGAAAAGATTTGGAACAATGGTATGATTG
TAGGAGACTTGACTGAGGACTACAGCCATTGGTTGGCAACCAAATCACTT
TCAGAGTGGCTGAAGGAACACAAAATACCTGGAATTACTGATGGCGACAC
TTATTCTTGATGATGGCACCAAATATCATGGTCAAATTTTTGGTGATGAA
AGAAGTATTGCAGGAGAAGTTGTTGGCCATTAAGAACGCTCGCTGTGATT
TCGCCTTGTACGCTGGTGCCAGTTCAACCAATGCTCTAATGTTGCCAAAG
ATTGCACCAGGATGTGCTGGTCTCAAAATGTACCTCAACGATACTTACAC
TACCTTGAAGATGGACAACCTCNAAGATTGCACCAGGTTGTGCTGGTCTC
AAAATGTACCTCAACGATACTTACACTACCTTGAAGATGGACAACCTCTC
TGAGCATTGTTCAAAGTGGGCAGCAAGATCGAAGTGAAAACACACATTGA
TTGCATTTCATCGGGAAACATTGTGCGATTGCCAGGTCTCATTGATGTCC
ACGTACACTTGCGACAACCTGGTGCCGAGTACAAAGAAGATTTCGATAGC
GGTACTGCAGCCGCACTGGCCGGTGGCGTCACCATGGTGCTGTGTATGCC
GAACACCAAGCCAGCTGTGGTGGATCAACCCACTTTCCAGCTTGCGCACC
AAGTCCAAATCATTGATTGGCCTTTCGAGGAGAATGGAACTGAGGGTCAG
GAAGAGAGCATTCAAGACTACCTCACACAGAACAAATTTGATTTGGTCAT
CAACATTCCAATGAGGGGTAGTGGTACCAAGAAGAAGTCTCATTTCATCA
CACATGGATATCGCACCCGACGAATGGCCATCGATCATTCCGTCTCATTG
ATCACCAACATTAAGTGTGCCAAACTCTTCTGTGAAGCGAAGAAAGAAAT
GTTGCCAAGTGTTCGTTTACTGGAGAAGATGGGATACGAATTGTATGCTA
GCATGGGTACCGGTGACTTCTATCAAGAACATGGTGTACAGGTGCCACAA
TTTTCATTTTCACGACTTGCTGGAGCTGACGTTCAACTTGGAGTAGAGAT
GGCAAGCACAGGAGAAGTAGCATGCTTCGGTGAAAATAGATACGAAGCTT
ACTTGAAGGCCTTGATGAGCACAGGTTTCAAATTACCCAAGAAAAACATA
CTGCTGACTGTTGGTAGTTATAAGGACAATCAATTGAAGGTGATCGAATG
CAATTTACGGGTGTCTCGGTCCTTCCCTTTTGTTTCCAAAACTCTAGATT
GTGATTTGGTTGCCTTGGCAACCAAAATCATCGTTGGTGCTCCTGCTGAA
CCTGCATTCAACATTATGGATAAGTGTGAGAAGATCGGCTGTAAGGAAAT
TGACGTTGATGCCGTTGCCAACGACGGTGAAGTGATGGCCATGGTCGTCT
CTGAACACGTTGAAAACGCGGGTGTCCACTCTGGTGACGCAACCATGATC
TGTCCACCACAAGACATCAATACGGAAACCATGGGACGGATCAAACAGAT
CTGTATTGCAGTTGGAAACGCCCTCAATGTGTCTGGTCCTTTCAATATGC
AACTTATTGCTAAGGAAGCCTATCAATTCTGCACCAAAGTTGGTTACCCA
GTGCTGGTACGACCTTCATACGTGTTGAGTGGAGCTGCCATGAATGTTGT
TTATGCTGAAGATGATTTAGAATCATATCTTGGATCTGCTGTCTCCATCT
CTAAGGAGCATCCAGTTGTCATCTCCAAATTTATATCCAATGCTAAAATG
GAAAGAGTTGACCACGATGGAGGTGAGGATCCTTGGCACATCGCCAGAAA
TGATTGACAACGCTGAAAACAGATTCAAATTCTCTCGTATGCTAGACAAC
ATTGGAATCCTACAACCAACACAATCATGGATATCTACCATAAAGAAGAC
CCAGAAGGTATTATCTTATCAATGGGAGGACAGGTTGCCAACAACATTGC
TATGCATCTCCACAGACAGGAACTTGGTAAGAGCACAATTATGGTGAATT
ACAATCCTGAAACTGTCAGTACAGACTATGATGAATGTGATCGATTGTAC
TTCGATGAAATCACATTTGAGTTCTGAACTGGTTATCCGCAAGTACCGTT
ATGAATGCAACATTTTGCCCTGTTTCAAGCAAATTGACACTGTTGCTGCA
GAATTCCCAGCTGAAGCTAACTATCTGTATTTAACTTACAATGGAGATTG
TGATGACGTCACATACGCAGAAAGCCAAAACAAAGTCATGGTTATTGGGT
CAGGTGTCTACAGAATCGGAAGCAGTGTTGAATTTGATGCATGTGCTGTT
GGATGTATTCGAGAATTGAAGAGGGTTGGAGCTGGAAAGGACACCATTCC
ATGCAATATCCTACTGAAGGGGAAGCAGCTTGGATTTTCAGATAAGCAAA
TTGCTAACTGCGTTCAAAGGTCTTAGTTGAGCCCTCTGACAAAAGAATCT
TTCATGTTGCTGCTGCACTCCGTAGAGGATATTCTATTGATCAGCTGTAT
GAGCTCACTCGTATTGATAAGTGGTTTTTGAGCAAGCTAGCAAAAATAAT
CAACTATGCAAAAATGCTGGAAGAGAAATACCCAAAGATTGGATCTTCGA
TGAAGAGTGTTGGTGAAGTAATGGCTATTGGAAGAAGTTTTGAGGAAGCC
ATTCAAAAGAGTTTGAGAATGGTTGACGATTCAAACCTTGGTTTTGATGC
AAACAACCTCGAGTTGGATGAACAGTTCTACATCATTGAGGTCAATGCTC
GTCTCTCCAGAAGTTCAGCTCTTGCTTCCAAAGCAACTGGATACCCATTG
GCTTACGTTGCTGCTAAACTTGCACTTGGTATTCCTCTACCAAAACTGAG
AAATTCTGTCACCAATTCAACTACCGCTTGTTTTGAGCCCTCTTTGGATT
ATTGTGTTGTGAAAGTTCCTCGATGGGATCTGGACAAATTTCAGAGGGTT
TCAACAAAGGTTTGTAATATGGAAAACTTTGACCCTTTGGGAATCCATAC
GGGTGAATCAATTGTTGTTGCACCAAGTCAAACACTAACAAATGAGGAAT
ACAATATGCTTAGAAGAACAGCCATCAAAGTCATCCGTAAACTTGGTGTT
GTTGGTGAATGTAACATCCAGTATGCTTTACACCCTGACTCAAAAGAGGC
TATCACAGCAGCTAACAGGCTAGGATATCCAGTGTTGTTACGTGCAGCAT
TTGCACTAGGTGGACTTGGATCTGGTTTTGCTTCCAATGACAATGAGCTC
AAAAAGCTTGCAGCATCGGCTTTTGCACATTCCAAACAGTGTCTAGTTGA
CAAGTCACTGAAAGGATGGAAAGAAGTTGAATATGAAGTTGTTAGAGATG
CTTATGACAACTGTATCACTGTGATTGAAGTAGAAAGACCAGATGGCATT
CTGTTATCATTTGGTGGACAAACAGCATTGAACTGTGGACTGCTATTGAA
AGAGAGGGGAATTTTAGAGAAATACAATGTTGCTGTTCTTGGTACACCTA
CCAAATCGATTGAATGGACAGAAGATAGGAAAATGTTTTCAGACAAGATG
GGAGAGATTGGTGAGAAAGTTGCACCAAGCTCAGTGGCTTATACTGTGGA
TGAGTCAAACCAAAGAAGGTCTTGATTTTGGGATCTGGTGGCTTATCTAT
TGGTCAAGCCGGAGAATTTGATTATTCTGGCTCTCAAGCTATCAAAGCAT
TAAAAGAAGAGAAGATTCACACAGTTTTGATCAATCCTAATATTGCTACA
GTGCAAACTTCCAAAGGACTTGCAGATAAAACTTACTTCCTTCCTGTTAA
CTTTGAATTCACAAGCAAGATATGGTAACAGAGGACATAACCAACCTGCA
ACCCATTTGGAAACTCAACGTTGCTTCATCACTTGCCAAAATCATGGCTT
TGCAATTGACACAGACAGCTTACCAAAAGAATGGTCTGTTTTGTTTACAA
ATGAGAATGATGGCAGTAATGAAGGCATTGTTCACAACACAAAGCCAATC
TTCTCAGTTCAGTTTCATCCTGAACATCAAGGAGGACCAAGAGATTTGGA
GCTTTTGTTTGGCTTTTTTGTGGATATTGTAAACAAACTGAAAATCGATT
CTAACCTCTGCTTACGAACCATGCTGAAAGAAACGTTGACTTTCCACCCA
GCAGAAGAAACAAGATCCAGAGCATAATATGATGGTCTGTTTATGAGCAA
TGGTCCTGGAGATCCTAGCCTTTGTCAAGTTTCAATTGACACCCTCCGTA
AAGTCATTACAGAATTGCCAGATGTGCCAGTCTTTGGTATTTGCATGGGT
CATCAGATCTTATCTCTTGCTGCTGGATGTGGGTCCTACAAAATGAAGAA
CCTAAACTTTACAATCCTAAGGGTAAAATAAAGATGATTGCTGTAGACTT
TGGTATCAAATACAACCAGATCCGGTGTTTGATTGATTGTGATTGTCAGG
TTCTAGTTGTTCCATGGGATTATGACTATAGTACATTGTTAAAGAACAAA
GATTGTTTTGGATGGAGAGGATGAAGCAAGTGTTCCATTTGATGATCCAA
ACAAAAGGAATTTGATTGCTGAAGTCTCTTGCAAGGTATTGATACCAGAG
CATTAACAAAGAAGTTGAGAGAAAATGGAACAATGTTAGGAAAGTCTTCC
AAACTGGTATGGTTGGTTACCCAGAATCATTGACAGATCCTTCATACAAC
AGTCAAATCTTGGTATTGACGTATCCACTGATTGGTAATTATGGTATACC
AAACGATTCTCGTGATGAACATGGCATGCTCAAATTTTTTGAATCTGAAA
AGATTTGGAACAATGGTATGATTGTAGGAGACTTGACTGAGGACTACAGC
CATTGGTTGGCAACCAAATCACTTTCAGAGTGGCTGAAGGAACACAAAAT
ACCTGGAATTACTGATGGCGACACTTATTCTTGATGATGGCACCAAATAT
CATGGTCAAATTTTTGGTGATGAAAGAAGTATTGCAGGAGAAGTTGTTGG
CCATTAAGAACGCTCGCTGTGATTTCGCCTTGTACGCTGGTGCCAGTTCA
ACCAATGCTCTAATGTTGCCAAAGATTGCACCAGGATGTGCTGGTCTCAA
AATGTACCTCAACGATACTTACACTACCTTGAAGATGGACAACCTCNAAG
ATTGCACCAGGTTGTGCTGGTCTCAAAATGTACCTCAACGATACTTACAC
TACCTTGAAGATGGACAACCTCTCTGAGCATTGTTCAAAGTGGGCAGCAA
GATCGAAGTGAAAACACACATTGATTGCATTTCATCGGGAAACATTGTGC
GATTGCCAGGTCTCATTGATGTCCACGTACACTTGCGACAACCTGGTGCC
GAGTACAAAGAAGATTTCGATAGCGGTACTGCAGCCGCACTGGCCGGTGG
CGTCACCATGGTGCTGTGTATGCCGAACACCAAGCCAGCTGTGGTGGATC
AACCCACTTTCCAGCTTGCGCACCAAGTCCAAATCATTGATTGGCCTTTC
GAGGAGAATGGAACTGAGGGTCAGGAAGAGAGCATTCAAGACTACCTCAC
ACAGAACAAATTTGATTTGGTCATCAACATTCCAATGAGGGGTAGTGGTA
CCAAGAAGAAGTCTCATTTCATCACACATGGATATCGCACCCGACGAATG
GCCATCGATCATTCCGTCTCATTGATCACCAACATTAAGTGTGCCAAACT
CTTCTGTGAAGCGAAGAAAGAAATGTTGCCAAGTGTTCGTTTACTGGAGA
AGATGGGATACGAATTGTATGCTAGCATGGGTACCGGTGACTTCTATCAA
GAACATGGTGTACAGGTGCCACAATTTTCATTTTCACGACTTGCTGGAGC
TGACGTTCAACTTGGAGTAGAGATGGCAAGCACAGGAGAAGTAGCATGCT
TCGGTGAAAATAGATACGAAGCTTACTTGAAGGCCTTGATGAGCACAGGT
TTCAAATTACCCAAGAAAAACATACTGCTGACTGTTGGTAGTTATAAGGA
CAATCAATTGAAGGTGATCGAATGCAATTTACGGGTGTCTCGGTCCTTCC
CTTTTGTTTCCAAAACTCTAGATTGTGATTTGGTTGCCTTGGCAACCAAA
ATCATCGTTGGTGCTCCTGCTGAACCTGCATTCAACATTATGGATAAGTG
TGAGAAGATCGGCTGTAAGGAAATTGACGTTGATGCCGTTGCCAACGACG
GTGAAGTGATGGCCATGGTCGTCTCTGAACACGTTGAAAACGCGGGTGTC
CACTCTGGTGACGCAACCATGATCTGTCCACCACAAGACATCAATACGGA
AACCATGGGACGGATCAAACAGATCTGTATTGCAGTTGGAAACGCCCTCA
ATGTGTCTGGTCCTTTCAATATGCAACTTATTGCTAAGGAAGCCTATCAA
TTCTGCACCAAAGTTGGTTACCCAGTGCTGGTACGACCTTCATACGTGTT
GAGTGGAGCTGCCATGAATGTTGTTTATGCTGAAGATGATTTAGAATCAT
ATCTTGGATCTGCTGTCTCCATCTCTAAGGAGCATCCAGTTGTCATCTCC
AAATTTATATCCAATGCTAAAATGGAAAGAGTTGACCACGATGGAGGTGA
GGATCCTTGGCACATCGCCAGAAATGATTGACAACGCTGAAAACAGATTC
AAATTCTCTCGTATGCTAGACAACATTGGAATCCTACAACCAACACAATC
ATGGATATCTACCATAAAGAAGACCCAGAAGGTATTATCTTATCAATGGG
AGGACAGGTTGCCAACAACATTGCTATGCATCTCCACAGACAGGAACTTG
GTAAGAGCACAATTATGGTGAATTACAATCCTGAAACTGTCAGTACAGAC
TATGATGAATGTGATCGATTGTACTTCGATGAAATCACATTTGAGTTCTG
AACTGGTTATCCGCAAGTACCGTTATGAATGCAACATTTTGCCCTGTTTC
AAGCAAATTGACACTGTTGCTGCAGAATTCCCAGCTGAAGCTAACTATCT
GTATTTAACTTACAATGGAGATTGTGATGACGTCACATACGCAGAAAGCC
AAAACAAAGTCATGGTTATTGGGTCAGGTGTCTACAGAATCGGAAGCAGT
GTTGAATTTGATGCATGTGCTGTTGGATGTATTCGAGAATTGAAGAGGGT
TGGAGCTGGAAAGGACACCATTCCATGCAATATCCTACTGAAGGGGAAGC
AGCTTGGATTTTCAGATAAGCAAATTGCTAACTGCGTTCAAAGGTCTTAG
TTGAGCCCTCTGACAAAAGAATCTTTCATGTTGCTGCTGCACTCCGTAGA
GGATATTCTATTGATCAGCTGTATGAGCTCACTCGTATTGATAAGTGGTT
TTTGAGCAAGCTAGCAAAAATAATCAACTATGCAAAAATGCTGGAAGAGA
AATACCCAAAGATTGGATCTTCGATGAAGAGTGTTGGTGAAGTAATGGCT
ATTGGAAGAAGTTTTGAGGAAGCCATTCAAAAGAGTTTGAGAATGGTTGA
CGATTCAAACCTTGGTTTTGATGCAAACAACCTCGAGTTGGATGAACAGT
TCTACATCATTGAGGTCAATGCTCGTCTCTCCAGAAGTTCAGCTCTTGCT
TCCAAAGCAACTGGATACCCATTGGCTTACGTTGCTGCTAAACTTGCACT
TGGTATTCCTCTACCAAAACTGAGAAATTCTGTCACCAATTCAACTACCG
CTTGTTTTGAGCCCTCTTTGGATTATTGTGTTGTGAAAGTTCCTCGATGG
GATCTGGACAAATTTCAGAGGGTTTCAACAAAGGTTTGTAATATGGAAAA
CTTTGACCCTTTGGGAATCCATACGGGTGAATCAATTGTTGTTGCACCAA
GTCAAACACTAACAAATGAGGAATACAATATGCTTAGAAGAACAGCCATC
AAAGTCATCCGTAAACTTGGTGTTGTTGGTGAATGTAACATCCAGTATGC
TTTACACCCTGACTCAAAAGAGGCTATCACAGCAGCTAACAGGCTAGGAT
ATCCAGTGTTGTTACGTGCAGCATTTGCACTAGGTGGACTTGGATCTGGT
TTTGCTTCCAATGACAATGAGCTCAAAAAGCTTGCAGCATCGGCTTTTGC
ACATTCCAAACAGTGTCTAGTTGACAAGTCACTGAAAGGATGGAAAGAAG
TTGAATATGAAGTTGTTAGAGATGCTTATGACAACTGTATCACTGTGATT
GAAGTAGAAAGACCAGATGGCATTCTGTTATCATTTGGTGGACAAACAGC
ATTGAACTGTGGACTGCTATTGAAAGAGAGGGGAATTTTAGAGAAATACA
ATGTTGCTGTTCTTGGTACACCTACCAAATCGATTGAATGGACAGAAGAT
AGGAAAATGTTTTCAGACAAGATGGGAGAGATTGGTGAGAAAGTTGCACC
AAGCTCAGTGGCTTATACTGTGGATGAGTCAAACCAAAGAAGGTCTTGAT
TTTGGGATCTGGTGGCTTATCTATTGGTCAAGCCGGAGAATTTGATTATT
CTGGCTCTCAAGCTATCAAAGCATTAAAAGAAGAGAAGATTCACACAGTT
TTGATCAATCCTAATATTGCTACAGTGCAAACTTCCAAAGGACTTGCAGA
TAAAACTTACTTCCTTCCTGTTAACTTTGAATTCACAAGCAAGATATGGT
AACAGAGGACATAACCAACCTGCAACCCATTTGGAAACTCAACGTTGCTT
CATCACTTGCCAAAATCATGGCTTTGCAATTGACACAGACAGCTTACCAA
AAGAATGGTCTGTTTTGTTTACAAATGAGAATGATGGCAGTAATGAAGGC
ATTGTTCACAACACAAAGCCAATCTTCTCAGTTCAGTTTCATCCTGAACA
TCAAGGAGGACCAAGAGATTTGGAGCTTTTGTTTGGCTTTTTTGTGGATA
TTGTAAACAAACTGAAAATCGATTCTAACCTCTGCTTACGAACCATGCTG
AAAGAAACGTTGACTTTCCACCCAGCAGAAGAAACAAGATCCAGAGCATA
ATATGATGGTCTGTTTATGAGCAATGGTCCTGGAGATCCTAGCCTTTGTC
AAGTTTCAATTGACACCCTCCGTAAAGTCATTACAGAATTGCCAGATGTG
CCAGTCTTTGGTATTTGCATGGGTCATCAGATCTTATCTCTTGCTGCTGG
ATGTGGGTCCTACAAAATGAAGAACCTAAACTTTACAATCCTAAGGGTAA
AATAAAGATGATTGCTGTAGACTTTGGTATCAAATACAACCAGATCCGGT
GTTTGATTGATTGTGATTGTCAGGTTCTAGTTGTTCCATGGGATTATGAC
TATAGTACATTGTTAAAGAACAAAGATTGTTTTGGATGGAGAGGATGAAG
CAAGTGTTCCATTTGATGATCCAAACAAAAGGAATTTGATTGCTGAAGTC
TCTTGCAAGGTATTGATACCAGAGCATTAACAAAGAAGTTGAGAGAAAAT
GGAACAATGTTAGGAAAGTCTTCCAAACTGGTATGGTTGGTTACCCAGAA
TCATTGACAGATCCTTCATACAACAGTCAAATCTTGGTATTGACGTATCC
ACTGATTGGTAATTATGGTATACCAAACGATTCTCGTGATGAACATGGCA
TGCTCAAATTTTTTGAATCTGAAAAGATTTGGAACAATGGTATGATTGTA
GGAGACTTGACTGAGGACTACAGCCATTGGTTGGCAACCAAATCACTTTC
AGAGTGGCTGAAGGAACACAAAATACCTGGAATTACTGATGGCGACACTT
ATTCTTGATGATGGCACCAAATATCATGGTCAAATTTTTGGTGATGAAAG
AAGTATTGCAGGAGAAGTTGTTGGCCATTAAGAACGCTCGCTGTGATTTC
GCCTTGTACGCTGGTGCCAGTTCAACCAATGCTCTAATGTTGCCAAAGAT
TGCACCAGGATGTGCTGGTCTCAAAATGTACCTCAACGATACTTACACTA
CCTTGAAGATGGACAACCTCNAAGATTGCACCAGGTTGTGCTGGTCTCAA
AATGTACCTCAACGATACTTACACTACCTTGAAGATGGACAACCTCTCTG
AGCATTGTTCAAAGTGGGCAGCAAGATCGAAGTGAAAACACACATTGATT
GCATTTCATCGGGAAACATTGTGCGATTGCCAGGTCTCATTGATGTCCAC
GTACACTTGCGACAACCTGGTGCCGAGTACAAAGAAGATTTCGATAGCGG
TACTGCAGCCGCACTGGCCGGTGGCGTCACCATGGTGCTGTGTATGCCGA
ACACCAAGCCAGCTGTGGTGGATCAACCCACTTTCCAGCTTGCGCACCAA
GTCCAAATCATTGATTGGCCTTTCGAGGAGAATGGAACTGAGGGTCAGGA
AGAGAGCATTCAAGACTACCTCACACAGAACAAATTTGATTTGGTCATCA
ACATTCCAATGAGGGGTAGTGGTACCAAGAAGAAGTCTCATTTCATCACA
CATGGATATCGCACCCGACGAATGGCCATCGATCATTCCGTCTCATTGAT
CACCAACATTAAGTGTGCCAAACTCTTCTGTGAAGCGAAGAAAGAAATGT
TGCCAAGTGTTCGTTTACTGGAGAAGATGGGATACGAATTGTATGCTAGC
ATGGGTACCGGTGACTTCTATCAAGAACATGGTGTACAGGTGCCACAATT
TTCATTTTCACGACTTGCTGGAGCTGACGTTCAACTTGGAGTAGAGATGG
CAAGCACAGGAGAAGTAGCATGCTTCGGTGAAAATAGATACGAAGCTTAC
TTGAAGGCCTTGATGAGCACAGGTTTCAAATTACCCAAGAAAAACATACT
GCTGACTGTTGGTAGTTATAAGGACAATCAATTGAAGGTGATCGAATGCA
ATTTACGGGTGTCTCGGTCCTTCCCTTTTGTTTCCAAAACTCTAGATTGT
GATTTGGTTGCCTTGGCAACCAAAATCATCGTTGGTGCTCCTGCTGAACC
TGCATTCAACATTATGGATAAGTGTGAGAAGATCGGCTGTAAGGAAATTG
ACGTTGATGCCGTTGCCAACGACGGTGAAGTGATGGCCATGGTCGTCTCT
GAACACGTTGAAAACGCGGGTGTCCACTCTGGTGACGCAACCATGATCTG
TCCACCACAAGACATCAATACGGAAACCATGGGACGGATCAAACAGATCT
GTATTGCAGTTGGAAACGCCCTCAATGTGTCTGGTCCTTTCAATATGCAA
CTTATTGCTAAGGAAGCCTATCAATTCTGCACCAAAGTTGGTTACCCAGT
GCTGGTACGACCTTCATACGTGTTGAGTGGAGCTGCCATGAATGTTGTTT
ATGCTGAAGATGATTTAGAATCATATCTTGGATCTGCTGTCTCCATCTCT
AAGGAGCATCCAGTTGTCATCTCCAAATTTATATCCAATGCTAAAATGGA
AAGAGTTGACCACGATGGAGGTGAGGATCCTTGGCACATCGCCAGAAATG
ATTGACAACGCTGAAAACAGATTCAAATTCTCTCGTATGCTAGACAACAT
TGGAATCCTACAACCAACACAATCATGGATATCTACCATAAAGAAGACCC
AGAAGGTATTATCTTATCAATGGGAGGACAGGTTGCCAACAACATTGCTA
TGCATCTCCACAGACAGGAACTTGGTAAGAGCACAATTATGGTGAATTAC
AATCCTGAAACTGTCAGTACAGACTATGATGAATGTGATCGATTGTACTT
CGATGAAATCACATTTGAGTTCTGAACTGGTTATCCGCAAGTACCGTTAT
GAATGCAACATTTTGCCCTGTTTCAAGCAAATTGACACTGTTGCTGCAGA
ATTCCCAGCTGAAGCTAACTATCTGTATTTAACTTACAATGGAGATTGTG
ATGACGTCACATACGCAGAAAGCCAAAACAAAGTCATGGTTATTGGGTCA
GGTGTCTACAGAATCGGAAGCAGTGTTGAATTTGATGCATGTGCTGTTGG
ATGTATTCGAGAATTGAAGAGGGTTGGAGCTGGAAAGGACACCATTCCAT
GCAATATCCTACTGAAGGGGAAGCAGCTTGGATTTTCAGATAAGCAAATT
GCTAACTGCGTTCAAAGGTCTTAGTTGAGCCCTCTGACAAAAGAATCTTT
CATGTTGCTGCTGCACTCCGTAGAGGATATTCTATTGATCAGCTGTATGA
GCTCACTCGTATTGATAAGTGGTTTTTGAGCAAGCTAGCAAAAATAATCA
ACTATGCAAAAATGCTGGAAGAGAAATACCCAAAGATTGGATCTTCGATG
AAGAGTGTTGGTGAAGTAATGGCTATTGGAAGAAGTTTTGAGGAAGCCAT
TCAAAAGAGTTTGAGAATGGTTGACGATTCAAACCTTGGTTTTGATGCAA
ACAACCTCGAGTTGGATGAACAGTTCTACATCATTGAGGTCAATGCTCGT
CTCTCCAGAAGTTCAGCTCTTGCTTCCAAAGCAACTGGATACCCATTGGC
TTACGTTGCTGCTAAACTTGCACTTGGTATTCCTCTACCAAAACTGAGAA
ATTCTGTCACCAATTCAACTACCGCTTGTTTTGAGCCCTCTTTGGATTAT
TGTGTTGTGAAAGTTCCTCGATGGGATCTGGACAAATTTCAGAGGGTTTC
AACAAAGGTTTGTAATATGGAAAACTTTGACCCTTTGGGAATCCATACGG
GTGAATCAATTGTTGTTGCACCAAGTCAAACACTAACAAATGAGGAATAC
AATATGCTTAGAAGAACAGCCATCAAAGTCATCCGTAAACTTGGTGTTGT
TGGTGAATGTAACATCCAGTATGCTTTACACCCTGACTCAAAAGAGGCTA
TCACAGCAGCTAACAGGCTAGGATATCCAGTGTTGTTACGTGCAGCATTT
GCACTAGGTGGACTTGGATCTGGTTTTGCTTCCAATGACAATGAGCTCAA
AAAGCTTGCAGCATCGGCTTTTGCACATTCCAAACAGTGTCTAGTTGACA
AGTCACTGAAAGGATGGAAAGAAGTTGAATATGAAGTTGTTAGAGATGCT
TATGACAACTGTATCACTGTGATTGAAGTAGAAAGACCAGATGGCATTCT
GTTATCATTTGGTGGACAAACAGCATTGAACTGTGGACTGCTATTGAAAG
AGAGGGGAATTTTAGAGAAATACAATGTTGCTGTTCTTGGTACACCTACC
AAATCGATTGAATGGACAGAAGATAGGAAAATGTTTTCAGACAAGATGGG
AGAGATTGGTGAGAAAGTTGCACCAAGCTCAGTGGCTTATACTGTGGATG
AGTCAAACCAAAGAAGGTCTTGATTTTGGGATCTGGTGGCTTATCTATTG
GTCAAGCCGGAGAATTTGATTATTCTGGCTCTCAAGCTATCAAAGCATTA
AAAGAAGAGAAGATTCACACAGTTTTGATCAATCCTAATATTGCTACAGT
GCAAACTTCCAAAGGACTTGCAGATAAAACTTACTTCCTTCCTGTTAACT
TTGAATTCACAAGCAAGATATGGTAACAGAGGACATAACCAACCTGCAAC
CCATTTGGAAACTCAACGTTGCTTCATCACTTGCCAAAATCATGGCTTTG
CAATTGACACAGACAGCTTACCAAAAGAATGGTCTGTTTTGTTTACAAAT
GAGAATGATGGCAGTAATGAAGGCATTGTTCACAACACAAAGCCAATCTT
CTCAGTTCAGTTTCATCCTGAACATCAAGGAGGACCAAGAGATTTGGAGC
TTTTGTTTGGCTTTTTTGTGGATATTGTAAACAAACTGAAAATCGATTCT
AACCTCTGCTTACGAACCATGCTGAAAGAAACGTTGACTTTCCACCCAGC
AGAAGAAACAAGATCCAGAGCATAATATGATGGTCTGTTTATGAGCAATG
GTCCTGGAGATCCTAGCCTTTGTCAAGTTTCAATTGACACCCTCCGTAAA
GTCATTACAGAATTGCCAGATGTGCCAGTCTTTGGTATTTGCATGGGTCA
TCAGATCTTATCTCTTGCTGCTGGATGTGGGTCCTACAAAATGAAGAACC
TAAACTTTACAATCCTAAGGGTAAAATAAAGATGATTGCTGTAGACTTTG
GTATCAAATACAACCAGATCCGGTGTTTGATTGATTGTGATTGTCAGGTT
CTAGTTGTTCCATGGGATTATGACTATAGTACATTGTTAAAGAACAAAGA
TTGTTTTGGATGGAGAGGATGAAGCAAGTGTTCCATTTGATGATCCAAAC
AAAAGGAATTTGATTGCTGAAGTCTCTTGCAAGGTATTGATACCAGAGCA
TTAACAAAGAAGTTGAGAGAAAATGGAACAATGTTAGGAAAGTCTTCCAA
ACTGGTATGGTTGGTTACCCAGAATCATTGACAGATCCTTCATACAACAG
TCAAATCTTGGTATTGACGTATCCACTGATTGGTAATTATGGTATACCAA
ACGATTCTCGTGATGAACATGGCATGCTCAAATTTTTTGAATCTGAAAAG
ATTTGGAACAATGGTATGATTGTAGGAGACTTGACTGAGGACTACAGCCA
TTGGTTGGCAACCAAATCACTTTCAGAGTGGCTGAAGGAACACAAAATAC
CTGGAATTACTGATGGCGACACTTATTCTTGATGATGGCACCAAATATCA
TGGTCAAATTTTTGGTGATGAAAGAAGTATTGCAGGAGAAGTTGTTGGCC
ATTAAGAACGCTCGCTGTGATTTCGCCTTGTACGCTGGTGCCAGTTCAAC
CAATGCTCTAATGTTGCCAAAGATTGCACCAGGATGTGCTGGTCTCAAAA
TGTACCTCAACGATACTTACACTACCTTGAAGATGGACAACCTCNAAGAT
TGCACCAGGTTGTGCTGGTCTCAAAATGTACCTCAACGATACTTACACTA
CCTTGAAGATGGACAACCTCTCTGAGCATTGTTCAAAGTGGGCAGCAAGA
TCGAAGTGAAAACACACATTGATTGCATTTCATCGGGAAACATTGTGCGA
TTGCCAGGTCTCATTGATGTCCACGTACACTTGCGACAACCTGGTGCCGA
GTACAAAGAAGATTTCGATAGCGGTACTGCAGCCGCACTGGCCGGTGGCG
TCACCATGGTGCTGTGTATGCCGAACACCAAGCCAGCTGTGGTGGATCAA
CCCACTTTCCAGCTTGCGCACCAAGTCCAAATCATTGATTGGCCTTTCGA
GGAGAATGGAACTGAGGGTCAGGAAGAGAGCATTCAAGACTACCTCACAC
AGAACAAATTTGATTTGGTCATCAACATTCCAATGAGGGGTAGTGGTACC
AAGAAGAAGTCTCATTTCATCACACATGGATATCGCACCCGACGAATGGC
CATCGATCATTCCGTCTCATTGATCACCAACATTAAGTGTGCCAAACTCT
TCTGTGAAGCGAAGAAAGAAATGTTGCCAAGTGTTCGTTTACTGGAGAAG
ATGGGATACGAATTGTATGCTAGCATGGGTACCGGTGACTTCTATCAAGA
ACATGGTGTACAGGTGCCACAATTTTCATTTTCACGACTTGCTGGAGCTG
ACGTTCAACTTGGAGTAGAGATGGCAAGCACAGGAGAAGTAGCATGCTTC
GGTGAAAATAGATACGAAGCTTACTTGAAGGCCTTGATGAGCACAGGTTT
CAAATTACCCAAGAAAAACATACTGCTGACTGTTGGTAGTTATAAGGACA
ATCAATTGAAGGTGATCGAATGCAATTTACGGGTGTCTCGGTCCTTCCCT
TTTGTTTCCAAAACTCTAGATTGTGATTTGGTTGCCTTGGCAACCAAAAT
CATCGTTGGTGCTCCTGCTGAACCTGCATTCAACATTATGGATAAGTGTG
AGAAGATCGGCTGTAAGGAAATTGACGTTGATGCCGTTGCCAACGACGGT
GAAGTGATGGCCATGGTCGTCTCTGAACACGTTGAAAACGCGGGTGTCCA
CTCTGGTGACGCAACCATGATCTGTCCACCACAAGACATCAATACGGAAA
CCATGGGACGGATCAAACAGATCTGTATTGCAGTTGGAAACGCCCTCAAT
GTGTCTGGTCCTTTCAATATGCAACTTATTGCTAAGGAAGCCTATCAATT
CTGCACCAAAGTTGGTTACCCAGTGCTGGTACGACCTTCATACGTGTTGA
GTGGAGCTGCCATGAATGTTGTTTATGCTGAAGATGATTTAGAATCATAT
CTTGGATCTGCTGTCTCCATCTCTAAGGAGCATCCAGTTGTCATCTCCAA
ATTTATATCCAATGCTAAAATGGAAAGAGTTGACCACGATGGAGGTGAGG
ATCCTTGGCACATCGCCAGAAATGATTGACAACGCTGAAAACAGATTCAA
ATTCTCTCGTATGCTAGACAACATTGGAATCCTACAACCAACACAATCAT
GGATATCTACCATAAAGAAGACCCAGAAGGTATTATCTTATCAATGGGAG
GACAGGTTGCCAACAACATTGCTATGCATCTCCACAGACAGGAACTTGGT
AAGAGCACAATTATGGTGAATTACAATCCTGAAACTGTCAGTACAGACTA
TGATGAATGTGATCGATTGTACTTCGATGAAATCACATTTGAGTTCTGAA
CTGGTTATCCGCAAGTACCGTTATGAATGCAACATTTTGCCCTGTTTCAA
GCAAATTGACACTGTTGCTGCAGAATTCCCAGCTGAAGCTAACTATCTGT
ATTTAACTTACAATGGAGATTGTGATGACGTCACATACGCAGAAAGCCAA
AACAAAGTCATGGTTATTGGGTCAGGTGTCTACAGAATCGGAAGCAGTGT
TGAATTTGATGCATGTGCTGTTGGATGTATTCGAGAATTGAAGAGGGTTG
GAGCTGGAAAGGACACCATTCCATGCAATATCCTACTGAAGGGGAAGCAG
CTTGGATTTTCAGATAAGCAAATTGCTAACTGCGTTCAAAGGTCTTAGTT
GAGCCCTCTGACAAAAGAATCTTTCATGTTGCTGCTGCACTCCGTAGAGG
ATATTCTATTGATCAGCTGTATGAGCTCACTCGTATTGATAAGTGGTTTT
TGAGCAAGCTAGCAAAAATAATCAACTATGCAAAAATGCTGGAAGAGAAA
TACCCAAAGATTGGATCTTCGATGAAGAGTGTTGGTGAAGTAATGGCTAT
TGGAAGAAGTTTTGAGGAAGCCATTCAAAAGAGTTTGAGAATGGTTGACG
ATTCAAACCTTGGTTTTGATGCAAACAACCTCGAGTTGGATGAACAGTTC
TACATCATTGAGGTCAATGCTCGTCTCTCCAGAAGTTCAGCTCTTGCTTC
CAAAGCAACTGGATACCCATTGGCTTACGTTGCTGCTAAACTTGCACTTG
GTATTCCTCTACCAAAACTGAGAAATTCTGTCACCAATTCAACTACCGCT
TGTTTTGAGCCCTCTTTGGATTATTGTGTTGTGAAAGTTCCTCGATGGGA
TCTGGACAAATTTCAGAGGGTTTCAACAAAGGTTTGTAATATGGAAAACT
TTGACCCTTTGGGAATCCATACGGGTGAATCAATTGTTGTTGCACCAAGT
CAAACACTAACAAATGAGGAATACAATATGCTTAGAAGAACAGCCATCAA
AGTCATCCGTAAACTTGGTGTTGTTGGTGAATGTAACATCCAGTATGCTT
TACACCCTGACTCAAAAGAGGCTATCACAGCAGCTAACAGGCTAGGATAT
CCAGTGTTGTTACGTGCAGCATTTGCACTAGGTGGACTTGGATCTGGTTT
TGCTTCCAATGACAATGAGCTCAAAAAGCTTGCAGCATCGGCTTTTGCAC
ATTCCAAACAGTGTCTAGTTGACAAGTCACTGAAAGGATGGAAAGAAGTT
GAATATGAAGTTGTTAGAGATGCTTATGACAACTGTATCACTGTGATTGA
AGTAGAAAGACCAGATGGCATTCTGTTATCATTTGGTGGACAAACAGCAT
TGAACTGTGGACTGCTATTGAAAGAGAGGGGAATTTTAGAGAAATACAAT
GTTGCTGTTCTTGGTACACCTACCAAATCGATTGAATGGACAGAAGATAG
GAAAATGTTTTCAGACAAGATGGGAGAGATTGGTGAGAAAGTTGCACCAA
GCTCAGTGGCTTATACTGTGGATGAGTCAAACCAAAGAAGGTCTTGATTT
TGGGATCTGGTGGCTTATCTATTGGTCAAGCCGGAGAATTTGATTATTCT
GGCTCTCAAGCTATCAAAGCATTAAAAGAAGAGAAGATTCACACAGTTTT
GATCAATCCTAATATTGCTACAGTGCAAACTTCCAAAGGACTTGCAGATA
AAACTTACTTCCTTCCTGTTAACTTTGAATTCACAAGCAAGATATGGTAA
CAGAGGACATAACCAACCTGCAACCCATTTGGAAACTCAACGTTGCTTCA
TCACTTGCCAAAATCATGGCTTTGCAATTGACACAGACAGCTTACCAAAA
GAATGGTCTGTTTTGTTTACAAATGAGAATGATGGCAGTAATGAAGGCAT
TGTTCACAACACAAAGCCAATCTTCTCAGTTCAGTTTCATCCTGAACATC
AAGGAGGACCAAGAGATTTGGAGCTTTTGTTTGGCTTTTTTGTGGATATT
GTAAACAAACTGAAAATCGATTCTAACCTCTGCTTACGAACCATGCTGAA
AGAAACGTTGACTTTCCACCCAGCAGAAGAAACAAGATCCAGAGCATAAT
ATGATGGTCTGTTTATGAGCAATGGTCCTGGAGATCCTAGCCTTTGTCAA
GTTTCAATTGACACCCTCCGTAAAGTCATTACAGAATTGCCAGATGTGCC
AGTCTTTGGTATTTGCATGGGTCATCAGATCTTATCTCTTGCTGCTGGAT
GTGGGTCCTACAAAATGAAGAACCTAAACTTTACAATCCTAAGGGTAAAA
TAAAGATGATTGCTGTAGACTTTGGTATCAAATACAACCAGATCCGGTGT
TTGATTGATTGTGATTGTCAGGTTCTAGTTGTTCCATGGGATTATGACTA
TAGTACATTGTTAAAGAACAAAGATTGTTTTGGATGGAGAGGATGAAGCA
AGTGTTCCATTTGATGATCCAAACAAAAGGAATTTGATTGCTGAAGTCTC
TTGCAAGGTATTGATACCAGAGCATTAACAAAGAAGTTGAGAGAAAATGG
AACAATGTTAGGAAAGTCTTCCAAACTGGTATGGTTGGTTACCCAGAATC
ATTGACAGATCCTTCATACAACAGTCAAATCTTGGTATTGACGTATCCAC
TGATTGGTAATTATGGTATACCAAACGATTCTCGTGATGAACATGGCATG
CTCAAATTTTTTGAATCTGAAAAGATTTGGAACAATGGTATGATTGTAGG
AGACTTGACTGAGGACTACAGCCATTGGTTGGCAACCAAATCACTTTCAG
AGTGGCTGAAGGAACACAAAATACCTGGAATTACTGATGGCGACACTTAT
TCTTGATGATGGCACCAAATATCATGGTCAAATTTTTGGTGATGAAAGAA
GTATTGCAGGAGAAGTTGTTGGCCATTAAGAACGCTCGCTGTGATTTCGC
CTTGTACGCTGGTGCCAGTTCAACCAATGCTCTAATGTTGCCAAAGATTG
CACCAGGATGTGCTGGTCTCAAAATGTACCTCAACGATACTTACACTACC
TTGAAGATGGACAACCTCNAAGATTGCACCAGGTTGTGCTGGTCTCAAAA
TGTACCTCAACGATACTTACACTACCTTGAAGATGGACAACCTCTCTGAG
CATTGTTCAAAGTGGGCAGCAAGATCGAAGTGAAAACACACATTGATTGC
ATTTCATCGGGAAACATTGTGCGATTGCCAGGTCTCATTGATGTCCACGT
ACACTTGCGACAACCTGGTGCCGAGTACAAAGAAGATTTCGATAGCGGTA
CTGCAGCCGCACTGGCCGGTGGCGTCACCATGGTGCTGTGTATGCCGAAC
ACCAAGCCAGCTGTGGTGGATCAACCCACTTTCCAGCTTGCGCACCAAGT
CCAAATCATTGATTGGCCTTTCGAGGAGAATGGAACTGAGGGTCAGGAAG
AGAGCATTCAAGACTACCTCACACAGAACAAATTTGATTTGGTCATCAAC
ATTCCAATGAGGGGTAGTGGTACCAAGAAGAAGTCTCATTTCATCACACA
TGGATATCGCACCCGACGAATGGCCATCGATCATTCCGTCTCATTGATCA
CCAACATTAAGTGTGCCAAACTCTTCTGTGAAGCGAAGAAAGAAATGTTG
CCAAGTGTTCGTTTACTGGAGAAGATGGGATACGAATTGTATGCTAGCAT
GGGTACCGGTGACTTCTATCAAGAACATGGTGTACAGGTGCCACAATTTT
CATTTTCACGACTTGCTGGAGCTGACGTTCAACTTGGAGTAGAGATGGCA
AGCACAGGAGAAGTAGCATGCTTCGGTGAAAATAGATACGAAGCTTACTT
GAAGGCCTTGATGAGCACAGGTTTCAAATTACCCAAGAAAAACATACTGC
TGACTGTTGGTAGTTATAAGGACAATCAATTGAAGGTGATCGAATGCAAT
TTACGGGTGTCTCGGTCCTTCCCTTTTGTTTCCAAAACTCTAGATTGTGA
TTTGGTTGCCTTGGCAACCAAAATCATCGTTGGTGCTCCTGCTGAACCTG
CATTCAACATTATGGATAAGTGTGAGAAGATCGGCTGTAAGGAAATTGAC
GTTGATGCCGTTGCCAACGACGGTGAAGTGATGGCCATGGTCGTCTCTGA
ACACGTTGAAAACGCGGGTGTCCACTCTGGTGACGCAACCATGATCTGTC
CACCACAAGACATCAATACGGAAACCATGGGACGGATCAAACAGATCTGT
ATTGCAGTTGGAAACGCCCTCAATGTGTCTGGTCCTTTCAATATGCAACT
TATTGCTAAGGAAGCCTATCAATTCTGCACCAAAGTTGGTTACCCAGTGC
TGGTACGACCTTCATACGTGTTGAGTGGAGCTGCCATGAATGTTGTTTAT
GCTGAAGATGATTTAGAATCATATCTTGGATCTGCTGTCTCCATCTCTAA
GGAGCATCCAGTTGTCATCTCCAAATTTATATCCAATGCTAAAATGGAAA
GAGTTGACCACGATGGAGGTGAGGATCCTTGGCACATCGCCAGAAATGAT
TGACAACGCTGAAAACAGATTCAAATTCTCTCGTATGCTAGACAACATTG
GAATCCTACAACCAACACAATCATGGATATCTACCATAAAGAAGACCCAG
AAGGTATTATCTTATCAATGGGAGGACAGGTTGCCAACAACATTGCTATG
CATCTCCACAGACAGGAACTTGGTAAGAGCACAATTATGGTGAATTACAA
TCCTGAAACTGTCAGTACAGACTATGATGAATGTGATCGATTGTACTTCG
ATGAAATCACATTTGAGTTCTGAACTGGTTATCCGCAAGTACCGTTATGA
ATGCAACATTTTGCCCTGTTTCAAGCAAATTGACACTGTTGCTGCAGAAT
TCCCAGCTGAAGCTAACTATCTGTATTTAACTTACAATGGAGATTGTGAT
GACGTCACATACGCAGAAAGCCAAAACAAAGTCATGGTTATTGGGTCAGG
TGTCTACAGAATCGGAAGCAGTGTTGAATTTGATGCATGTGCTGTTGGAT
GTATTCGAGAATTGAAGAGGGTTGGAGCTGGAAAGGACACCATTCCATGC
AATATCCTACTGAAGGGGAAGCAGCTTGGATTTTCAGATAAGCAAATTGC
TAACTGCGTTCAAAGGTCTTAGTTGAGCCCTCTGACAAAAGAATCTTTCA
TGTTGCTGCTGCACTCCGTAGAGGATATTCTATTGATCAGCTGTATGAGC
TCACTCGTATTGATAAGTGGTTTTTGAGCAAGCTAGCAAAAATAATCAAC
TATGCAAAAATGCTGGAAGAGAAATACCCAAAGATTGGATCTTCGATGAA
GAGTGTTGGTGAAGTAATGGCTATTGGAAGAAGTTTTGAGGAAGCCATTC
AAAAGAGTTTGAGAATGGTTGACGATTCAAACCTTGGTTTTGATGCAAAC
AACCTCGAGTTGGATGAACAGTTCTACATCATTGAGGTCAATGCTCGTCT
CTCCAGAAGTTCAGCTCTTGCTTCCAAAGCAACTGGATACCCATTGGCTT
ACGTTGCTGCTAAACTTGCACTTGGTATTCCTCTACCAAAACTGAGAAAT
TCTGTCACCAATTCAACTACCGCTTGTTTTGAGCCCTCTTTGGATTATTG
TGTTGTGAAAGTTCCTCGATGGGATCTGGACAAATTTCAGAGGGTTTCAA
CAAAGGTTTGTAATATGGAAAACTTTGACCCTTTGGGAATCCATACGGGT
GAATCAATTGTTGTTGCACCAAGTCAAACACTAACAAATGAGGAATACAA
TATGCTTAGAAGAACAGCCATCAAAGTCATCCGTAAACTTGGTGTTGTTG
GTGAATGTAACATCCAGTATGCTTTACACCCTGACTCAAAAGAGGCTATC
ACAGCAGCTAACAGGCTAGGATATCCAGTGTTGTTACGTGCAGCATTTGC
ACTAGGTGGACTTGGATCTGGTTTTGCTTCCAATGACAATGAGCTCAAAA
AGCTTGCAGCATCGGCTTTTGCACATTCCAAACAGTGTCTAGTTGACAAG
TCACTGAAAGGATGGAAAGAAGTTGAATATGAAGTTGTTAGAGATGCTTA
TGACAACTGTATCACTGTGATTGAAGTAGAAAGACCAGATGGCATTCTGT
TATCATTTGGTGGACAAACAGCATTGAACTGTGGACTGCTATTGAAAGAG
AGGGGAATTTTAGAGAAATACAATGTTGCTGTTCTTGGTACACCTACCAA
ATCGATTGAATGGACAGAAGATAGGAAAATGTTTTCAGACAAGATGGGAG
AGATTGGTGAGAAAGTTGCACCAAGCTCAGTGGCTTATACTGTGGATGAG
TCAAACCAAAGAAGGTCTTGATTTTGGGATCTGGTGGCTTATCTATTGGT
CAAGCCGGAGAATTTGATTATTCTGGCTCTCAAGCTATCAAAGCATTAAA
AGAAGAGAAGATTCACACAGTTTTGATCAATCCTAATATTGCTACAGTGC
AAACTTCCAAAGGACTTGCAGATAAAACTTACTTCCTTCCTGTTAACTTT
GAATTCACAAGCAAGATATGGTAACAGAGGACATAACCAACCTGCAACCC
ATTTGGAAACTCAACGTTGCTTCATCACTTGCCAAAATCATGGCTTTGCA
ATTGACACAGACAGCTTACCAAAAGAATGGTCTGTTTTGTTTACAAATGA
GAATGATGGCAGTAATGAAGGCATTGTTCACAACACAAAGCCAATCTTCT
CAGTTCAGTTTCATCCTGAACATCAAGGAGGACCAAGAGATTTGGAGCTT
TTGTTTGGCTTTTTTGTGGATATTGTAAACAAACTGAAAATCGATTCTAA
CCTCTGCTTACGAACCATGCTGAAAGAAACGTTGACTTTCCACCCAGCAG
AAGAAACAAGATCCAGAGCATAATATGATGGTCTGTTTATGAGCAATGGT
CCTGGAGATCCTAGCCTTTGTCAAGTTTCAATTGACACCCTCCGTAAAGT
CATTACAGAATTGCCAGATGTGCCAGTCTTTGGTATTTGCATGGGTCATC
AGATCTTATCTCTTGCTGCTGGATGTGGGTCCTACAAAATGAAGAACCTA
AACTTTACAATCCTAAGGGTAAAATAAAGATGATTGCTGTAGACTTTGGT
ATCAAATACAACCAGATCCGGTGTTTGATTGATTGTGATTGTCAGGTTCT
AGTTGTTCCATGGGATTATGACTATAGTACATTGTTAAAGAACAAAGATT
GTTTTGGATGGAGAGGATGAAGCAAGTGTTCCATTTGATGATCCAAACAA
AAGGAATTTGATTGCTGAAGTCTCTTGCAAGGTATTGATACCAGAGCATT
AACAAAGAAGTTGAGAGAAAATGGAACAATGTTAGGAAAGTCTTCCAAAC
TGGTATGGTTGGTTACCCAGAATCATTGACAGATCCTTCATACAACAGTC
AAATCTTGGTATTGACGTATCCACTGATTGGTAATTATGGTATACCAAAC
GATTCTCGTGATGAACATGGCATGCTCAAATTTTTTGAATCTGAAAAGAT
TTGGAACAATGGTATGATTGTAGGAGACTTGACTGAGGACTACAGCCATT
GGTTGGCAACCAAATCACTTTCAGAGTGGCTGAAGGAACACAAAATACCT
GGAATTACTGATGGCGACACTTATTCTTGATGATGGCACCAAATATCATG
GTCAAATTTTTGGTGATGAAAGAAGTATTGCAGGAGAAGTTGTTGGCCAT
TAAGAACGCTCGCTGTGATTTCGCCTTGTACGCTGGTGCCAGTTCAACCA
ATGCTCTAATGTTGCCAAAGATTGCACCAGGATGTGCTGGTCTCAAAATG
TACCTCAACGATACTTACACTACCTTGAAGATGGACAACCTCNAAGATTG
CACCAGGTTGTGCTGGTCTCAAAATGTACCTCAACGATACTTACACTACC
TTGAAGATGGACAACCTCTCTGAGCATTGTTCAAAGTGGGCAGCAAGATC
GAAGTGAAAACACACATTGATTGCATTTCATCGGGAAACATTGTGCGATT
GCCAGGTCTCATTGATGTCCACGTACACTTGCGACAACCTGGTGCCGAGT
ACAAAGAAGATTTCGATAGCGGTACTGCAGCCGCACTGGCCGGTGGCGTC
ACCATGGTGCTGTGTATGCCGAACACCAAGCCAGCTGTGGTGGATCAACC
CACTTTCCAGCTTGCGCACCAAGTCCAAATCATTGATTGGCCTTTCGAGG
AGAATGGAACTGAGGGTCAGGAAGAGAGCATTCAAGACTACCTCACACAG
AACAAATTTGATTTGGTCATCAACATTCCAATGAGGGGTAGTGGTACCAA
GAAGAAGTCTCATTTCATCACACATGGATATCGCACCCGACGAATGGCCA
TCGATCATTCCGTCTCATTGATCACCAACATTAAGTGTGCCAAACTCTTC
TGTGAAGCGAAGAAAGAAATGTTGCCAAGTGTTCGTTTACTGGAGAAGAT
GGGATACGAATTGTATGCTAGCATGGGTACCGGTGACTTCTATCAAGAAC
ATGGTGTACAGGTGCCACAATTTTCATTTTCACGACTTGCTGGAGCTGAC
GTTCAACTTGGAGTAGAGATGGCAAGCACAGGAGAAGTAGCATGCTTCGG
TGAAAATAGATACGAAGCTTACTTGAAGGCCTTGATGAGCACAGGTTTCA
AATTACCCAAGAAAAACATACTGCTGACTGTTGGTAGTTATAAGGACAAT
CAATTGAAGGTGATCGAATGCAATTTACGGGTGTCTCGGTCCTTCCCTTT
TGTTTCCAAAACTCTAGATTGTGATTTGGTTGCCTTGGCAACCAAAATCA
TCGTTGGTGCTCCTGCTGAACCTGCATTCAACATTATGGATAAGTGTGAG
AAGATCGGCTGTAAGGAAATTGACGTTGATGCCGTTGCCAACGACGGTGA
AGTGATGGCCATGGTCGTCTCTGAACACGTTGAAAACGCGGGTGTCCACT
CTGGTGACGCAACCATGATCTGTCCACCACAAGACATCAATACGGAAACC
ATGGGACGGATCAAACAGATCTGTATTGCAGTTGGAAACGCCCTCAATGT
GTCTGGTCCTTTCAATATGCAACTTATTGCTAAGGAAGCCTATCAATTCT
GCACCAAAGTTGGTTACCCAGTGCTGGTACGACCTTCATACGTGTTGAGT
GGAGCTGCCATGAATGTTGTTTATGCTGAAGATGATTTAGAATCATATCT
TGGATCTGCTGTCTCCATCTCTAAGGAGCATCCAGTTGTCATCTCCAAAT
TTATATCCAATGCTAAAATGGAAAGAGTTGACCACGATGGAGGTGAGGAT
CCTTGGCACATCGCCAGAAATGATTGACAACGCTGAAAACAGATTCAAAT
TCTCTCGTATGCTAGACAACATTGGAATCCTACAACCAACACAATCATGG
ATATCTACCATAAAGAAGACCCAGAAGGTATTATCTTATCAATGGGAGGA
CAGGTTGCCAACAACATTGCTATGCATCTCCACAGACAGGAACTTGGTAA
GAGCACAATTATGGTGAATTACAATCCTGAAACTGTCAGTACAGACTATG
ATGAATGTGATCGATTGTACTTCGATGAAATCACATTTGAGTTCTGAACT
GGTTATCCGCAAGTACCGTTATGAATGCAACATTTTGCCCTGTTTCAAGC
AAATTGACACTGTTGCTGCAGAATTCCCAGCTGAAGCTAACTATCTGTAT
TTAACTTACAATGGAGATTGTGATGACGTCACATACGCAGAAAGCCAAAA
CAAAGTCATGGTTATTGGGTCAGGTGTCTACAGAATCGGAAGCAGTGTTG
AATTTGATGCATGTGCTGTTGGATGTATTCGAGAATTGAAGAGGGTTGGA
GCTGGAAAGGACACCATTCCATGCAATATCCTACTGAAGGGGAAGCAGCT
TGGATTTTCAGATAAGCAAATTGCTAACTGCGTTCAAAGGTCTTAGTTGA
GCCCTCTGACAAAAGAATCTTTCATGTTGCTGCTGCACTCCGTAGAGGAT
ATTCTATTGATCAGCTGTATGAGCTCACTCGTATTGATAAGTGGTTTTTG
AGCAAGCTAGCAAAAATAATCAACTATGCAAAAATGCTGGAAGAGAAATA
CCCAAAGATTGGATCTTCGATGAAGAGTGTTGGTGAAGTAATGGCTATTG
GAAGAAGTTTTGAGGAAGCCATTCAAAAGAGTTTGAGAATGGTTGACGAT
TCAAACCTTGGTTTTGATGCAAACAACCTCGAGTTGGATGAACAGTTCTA
CATCATTGAGGTCAATGCTCGTCTCTCCAGAAGTTCAGCTCTTGCTTCCA
AAGCAACTGGATACCCATTGGCTTACGTTGCTGCTAAACTTGCACTTGGT
ATTCCTCTACCAAAACTGAGAAATTCTGTCACCAATTCAACTACCGCTTG
TTTTGAGCCCTCTTTGGATTATTGTGTTGTGAAAGTTCCTCGATGGGATC
TGGACAAATTTCAGAGGGTTTCAACAAAGGTTTGTAATATGGAAAACTTT
GACCCTTTGGGAATCCATACGGGTGAATCAATTGTTGTTGCACCAAGTCA
AACACTAACAAATGAGGAATACAATATGCTTAGAAGAACAGCCATCAAAG
TCATCCGTAAACTTGGTGTTGTTGGTGAATGTAACATCCAGTATGCTTTA
CACCCTGACTCAAAAGAGGCTATCACAGCAGCTAACAGGCTAGGATATCC
AGTGTTGTTACGTGCAGCATTTGCACTAGGTGGACTTGGATCTGGTTTTG
CTTCCAATGACAATGAGCTCAAAAAGCTTGCAGCATCGGCTTTTGCACAT
TCCAAACAGTGTCTAGTTGACAAGTCACTGAAAGGATGGAAAGAAGTTGA
ATATGAAGTTGTTAGAGATGCTTATGACAACTGTATCACTGTGATTGAAG
TAGAAAGACCAGATGGCATTCTGTTATCATTTGGTGGACAAACAGCATTG
AACTGTGGACTGCTATTGAAAGAGAGGGGAATTTTAGAGAAATACAATGT
TGCTGTTCTTGGTACACCTACCAAATCGATTGAATGGACAGAAGATAGGA
AAATGTTTTCAGACAAGATGGGAGAGATTGGTGAGAAAGTTGCACCAAGC
TCAGTGGCTTATACTGTGGATGAGTCAAACCAAAGAAGGTCTTGATTTTG
GGATCTGGTGGCTTATCTATTGGTCAAGCCGGAGAATTTGATTATTCTGG
CTCTCAAGCTATCAAAGCATTAAAAGAAGAGAAGATTCACACAGTTTTGA
TCAATCCTAATATTGCTACAGTGCAAACTTCCAAAGGACTTGCAGATAAA
ACTTACTTCCTTCCTGTTAACTTTGAATTCACAAGCAAGATATGGTAACA
GAGGACATAACCAACCTGCAACCCATTTGGAAACTCAACGTTGCTTCATC
ACTTGCCAAAATCATGGCTTTGCAATTGACACAGACAGCTTACCAAAAGA
ATGGTCTGTTTTGTTTACAAATGAGAATGATGGCAGTAATGAAGGCATTG
TTCACAACACAAAGCCAATCTTCTCAGTTCAGTTTCATCCTGAACATCAA
GGAGGACCAAGAGATTTGGAGCTTTTGTTTGGCTTTTTTGTGGATATTGT
AAACAAACTGAAAATCGATTCTAACCTCTGCTTACGAACCATGCTGAAAG
AAACGTTGACTTTCCACCCAGCAGAAGAAACAAGATCCAGAGCATAATAT
GATGGTCTGTTTATGAGCAATGGTCCTGGAGATCCTAGCCTTTGTCAAGT
TTCAATTGACACCCTCCGTAAAGTCATTACAGAATTGCCAGATGTGCCAG
TCTTTGGTATTTGCATGGGTCATCAGATCTTATCTCTTGCTGCTGGATGT
GGGTCCTACAAAATGAAGAACCTAAACTTTACAATCCTAAGGGTAAAATA
AAGATGATTGCTGTAGACTTTGGTATCAAATACAACCAGATCCGGTGTTT
GATTGATTGTGATTGTCAGGTTCTAGTTGTTCCATGGGATTATGACTATA
GTACATTGTTAAAGAACAAAGATTGTTTTGGATGGAGAGGATGAAGCAAG
TGTTCCATTTGATGATCCAAACAAAAGGAATTTGATTGCTGAAGTCTCTT
GCAAGGTATTGATACCAGAGCATTAACAAAGAAGTTGAGAGAAAATGGAA
CAATGTTAGGAAAGTCTTCCAAACTGGTATGGTTGGTTACCCAGAATCAT
TGACAGATCCTTCATACAACAGTCAAATCTTGGTATTGACGTATCCACTG
ATTGGTAATTATGGTATACCAAACGATTCTCGTGATGAACATGGCATGCT
CAAATTTTTTGAATCTGAAAAGATTTGGAACAATGGTATGATTGTAGGAG
ACTTGACTGAGGACTACAGCCATTGGTTGGCAACCAAATCACTTTCAGAG
TGGCTGAAGGAACACAAAATACCTGGAATTACTGATGGCGACACTTATTC
TTGATGATGGCACCAAATATCATGGTCAAATTTTTGGTGATGAAAGAAGT
ATTGCAGGAGAAGTTGTTGGCCATTAAGAACGCTCGCTGTGATTTCGCCT
TGTACGCTGGTGCCAGTTCAACCAATGCTCTAATGTTGCCAAAGATTGCA
CCAGGATGTGCTGGTCTCAAAATGTACCTCAACGATACTTACACTACCTT
GAAGATGGACAACCTCNAAGATTGCACCAGGTTGTGCTGGTCTCAAAATG
TACCTCAACGATACTTACACTACCTTGAAGATGGACAACCTCTCTGAGCA
TTGTTCAAAGTGGGCAGCAAGATCGAAGTGAAAACACACATTGATTGCAT
TTCATCGGGAAACATTGTGCGATTGCCAGGTCTCATTGATGTCCACGTAC
ACTTGCGACAACCTGGTGCCGAGTACAAAGAAGATTTCGATAGCGGTACT
GCAGCCGCACTGGCCGGTGGCGTCACCATGGTGCTGTGTATGCCGAACAC
CAAGCCAGCTGTGGTGGATCAACCCACTTTCCAGCTTGCGCACCAAGTCC
AAATCATTGATTGGCCTTTCGAGGAGAATGGAACTGAGGGTCAGGAAGAG
AGCATTCAAGACTACCTCACACAGAACAAATTTGATTTGGTCATCAACAT
TCCAATGAGGGGTAGTGGTACCAAGAAGAAGTCTCATTTCATCACACATG
GATATCGCACCCGACGAATGGCCATCGATCATTCCGTCTCATTGATCACC
AACATTAAGTGTGCCAAACTCTTCTGTGAAGCGAAGAAAGAAATGTTGCC
AAGTGTTCGTTTACTGGAGAAGATGGGATACGAATTGTATGCTAGCATGG
GTACCGGTGACTTCTATCAAGAACATGGTGTACAGGTGCCACAATTTTCA
TTTTCACGACTTGCTGGAGCTGACGTTCAACTTGGAGTAGAGATGGCAAG
CACAGGAGAAGTAGCATGCTTCGGTGAAAATAGATACGAAGCTTACTTGA
AGGCCTTGATGAGCACAGGTTTCAAATTACCCAAGAAAAACATACTGCTG
ACTGTTGGTAGTTATAAGGACAATCAATTGAAGGTGATCGAATGCAATTT
ACGGGTGTCTCGGTCCTTCCCTTTTGTTTCCAAAACTCTAGATTGTGATT
TGGTTGCCTTGGCAACCAAAATCATCGTTGGTGCTCCTGCTGAACCTGCA
TTCAACATTATGGATAAGTGTGAGAAGATCGGCTGTAAGGAAATTGACGT
TGATGCCGTTGCCAACGACGGTGAAGTGATGGCCATGGTCGTCTCTGAAC
ACGTTGAAAACGCGGGTGTCCACTCTGGTGACGCAACCATGATCTGTCCA
CCACAAGACATCAATACGGAAACCATGGGACGGATCAAACAGATCTGTAT
TGCAGTTGGAAACGCCCTCAATGTGTCTGGTCCTTTCAATATGCAACTTA
TTGCTAAGGAAGCCTATCAATTCTGCACCAAAGTTGGTTACCCAGTGCTG
GTACGACCTTCATACGTGTTGAGTGGAGCTGCCATGAATGTTGTTTATGC
TGAAGATGATTTAGAATCATATCTTGGATCTGCTGTCTCCATCTCTAAGG
AGCATCCAGTTGTCATCTCCAAATTTATATCCAATGCTAAAATGGAAAGA
GTTGACCACGATGGAGGTGAGGATCCTTGGCACATCGCCAGAAATGATTG
ACAACGCTGAAAACAGATTCAAATTCTCTCGTATGCTAGACAACATTGGA
ATCCTACAACCAACACAATCATGGATATCTACCATAAAGAAGACCCAGAA
GGTATTATCTTATCAATGGGAGGACAGGTTGCCAACAACATTGCTATGCA
TCTCCACAGACAGGAACTTGGTAAGAGCACAATTATGGTGAATTACAATC
CTGAAACTGTCAGTACAGACTATGATGAATGTGATCGATTGTACTTCGAT
GAAATCACATTTGAGTTCTGAACTGGTTATCCGCAAGTACCGTTATGAAT
GCAACATTTTGCCCTGTTTCAAGCAAATTGACACTGTTGCTGCAGAATTC
CCAGCTGAAGCTAACTATCTGTATTTAACTTACAATGGAGATTGTGATGA
CGTCACATACGCAGAAAGCCAAAACAAAGTCATGGTTATTGGGTCAGGTG
TCTACAGAATCGGAAGCAGTGTTGAATTTGATGCATGTGCTGTTGGATGT
ATTCGAGAATTGAAGAGGGTTGGAGCTGGAAAGGACACCATTCCATGCAA
TATCCTACTGAAGGGGAAGCAGCTTGGATTTTCAGATAAGCAAATTGCTA
ACTGCGTTCAAAGGTCTTAGTTGAGCCCTCTGACAAAAGAATCTTTCATG
TTGCTGCTGCACTCCGTAGAGGATATTCTATTGATCAGCTGTATGAGCTC
ACTCGTATTGATAAGTGGTTTTTGAGCAAGCTAGCAAAAATAATCAACTA
TGCAAAAATGCTGGAAGAGAAATACCCAAAGATTGGATCTTCGATGAAGA
GTGTTGGTGAAGTAATGGCTATTGGAAGAAGTTTTGAGGAAGCCATTCAA
AAGAGTTTGAGAATGGTTGACGATTCAAACCTTGGTTTTGATGCAAACAA
CCTCGAGTTGGATGAACAGTTCTACATCATTGAGGTCAATGCTCGTCTCT
CCAGAAGTTCAGCTCTTGCTTCCAAAGCAACTGGATACCCATTGGCTTAC
GTTGCTGCTAAACTTGCACTTGGTATTCCTCTACCAAAACTGAGAAATTC
TGTCACCAATTCAACTACCGCTTGTTTTGAGCCCTCTTTGGATTATTGTG
TTGTGAAAGTTCCTCGATGGGATCTGGACAAATTTCAGAGGGTTTCAACA
AAGGTTTGTAATATGGAAAACTTTGACCCTTTGGGAATCCATACGGGTGA
ATCAATTGTTGTTGCACCAAGTCAAACACTAACAAATGAGGAATACAATA
TGCTTAGAAGAACAGCCATCAAAGTCATCCGTAAACTTGGTGTTGTTGGT
GAATGTAACATCCAGTATGCTTTACACCCTGACTCAAAAGAGGCTATCAC
AGCAGCTAACAGGCTAGGATATCCAGTGTTGTTACGTGCAGCATTTGCAC
TAGGTGGACTTGGATCTGGTTTTGCTTCCAATGACAATGAGCTCAAAAAG
CTTGCAGCATCGGCTTTTGCACATTCCAAACAGTGTCTAGTTGACAAGTC
ACTGAAAGGATGGAAAGAAGTTGAATATGAAGTTGTTAGAGATGCTTATG
ACAACTGTATCACTGTGATTGAAGTAGAAAGACCAGATGGCATTCTGTTA
TCATTTGGTGGACAAACAGCATTGAACTGTGGACTGCTATTGAAAGAGAG
GGGAATTTTAGAGAAATACAATGTTGCTGTTCTTGGTACACCTACCAAAT
CGATTGAATGGACAGAAGATAGGAAAATGTTTTCAGACAAGATGGGAGAG
ATTGGTGAGAAAGTTGCACCAAGCTCAGTGGCTTATACTGTGGATGAGTC
AAACCAAAGAAGGTCTTGATTTTGGGATCTGGTGGCTTATCTATTGGTCA
AGCCGGAGAATTTGATTATTCTGGCTCTCAAGCTATCAAAGCATTAAAAG
AAGAGAAGATTCACACAGTTTTGATCAATCCTAATATTGCTACAGTGCAA
ACTTCCAAAGGACTTGCAGATAAAACTTACTTCCTTCCTGTTAACTTTGA
ATTCACAAGCAAGATATGGTAACAGAGGACATAACCAACCTGCAACCCAT
TTGGAAACTCAACGTTGCTTCATCACTTGCCAAAATCATGGCTTTGCAAT
TGACACAGACAGCTTACCAAAAGAATGGTCTGTTTTGTTTACAAATGAGA
ATGATGGCAGTAATGAAGGCATTGTTCACAACACAAAGCCAATCTTCTCA
GTTCAGTTTCATCCTGAACATCAAGGAGGACCAAGAGATTTGGAGCTTTT
GTTTGGCTTTTTTGTGGATATTGTAAACAAACTGAAAATCGATTCTAACC
TCTGCTTACGAACCATGCTGAAAGAAACGTTGACTTTCCACCCAGCAGAA
GAAACAAGATCCAGAGCATAATATGATGGTCTGTTTATGAGCAATGGTCC
TGGAGATCCTAGCCTTTGTCAAGTTTCAATTGACACCCTCCGTAAAGTCA
TTACAGAATTGCCAGATGTGCCAGTCTTTGGTATTTGCATGGGTCATCAG
ATCTTATCTCTTGCTGCTGGATGTGGGTCCTACAAAATGAAGAACCTAAA
CTTTACAATCCTAAGGGTAAAATAAAGATGATTGCTGTAGACTTTGGTAT
CAAATACAACCAGATCCGGTGTTTGATTGATTGTGATTGTCAGGTTCTAG
TTGTTCCATGGGATTATGACTATAGTACATTGTTAAAGAACAAAGATTGT
TTTGGATGGAGAGGATGAAGCAAGTGTTCCATTTGATGATCCAAACAAAA
GGAATTTGATTGCTGAAGTCTCTTGCAAGGTATTGATACCAGAGCATTAA
CAAAGAAGTTGAGAGAAAATGGAACAATGTTAGGAAAGTCTTCCAAACTG
GTATGGTTGGTTACCCAGAATCATTGACAGATCCTTCATACAACAGTCAA
ATCTTGGTATTGACGTATCCACTGATTGGTAATTATGGTATACCAAACGA
TTCTCGTGATGAACATGGCATGCTCAAATTTTTTGAATCTGAAAAGATTT
GGAACAATGGTATGATTGTAGGAGACTTGACTGAGGACTACAGCCATTGG
TTGGCAACCAAATCACTTTCAGAGTGGCTGAAGGAACACAAAATACCTGG
AATTACTGATGGCGACACTTATTCTTGATGATGGCACCAAATATCATGGT
CAAATTTTTGGTGATGAAAGAAGTATTGCAGGAGAAGTTGTTGGCCATTA
AGAACGCTCGCTGTGATTTCGCCTTGTACGCTGGTGCCAGTTCAACCAAT
GCTCTAATGTTGCCAAAGATTGCACCAGGATGTGCTGGTCTCAAAATGTA
CCTCAACGATACTTACACTACCTTGAAGATGGACAACCTCNAAGATTGCA
CCAGGTTGTGCTGGTCTCAAAATGTACCTCAACGATACTTACACTACCTT
GAAGATGGACAACCTCTCTGAGCATTGTTCAAAGTGGGCAGCAAGATCGA
AGTGAAAACACACATTGATTGCATTTCATCGGGAAACATTGTGCGATTGC
CAGGTCTCATTGATGTCCACGTACACTTGCGACAACCTGGTGCCGAGTAC
AAAGAAGATTTCGATAGCGGTACTGCAGCCGCACTGGCCGGTGGCGTCAC
CATGGTGCTGTGTATGCCGAACACCAAGCCAGCTGTGGTGGATCAACCCA
CTTTCCAGCTTGCGCACCAAGTCCAAATCATTGATTGGCCTTTCGAGGAG
AATGGAACTGAGGGTCAGGAAGAGAGCATTCAAGACTACCTCACACAGAA
CAAATTTGATTTGGTCATCAACATTCCAATGAGGGGTAGTGGTACCAAGA
AGAAGTCTCATTTCATCACACATGGATATCGCACCCGACGAATGGCCATC
GATCATTCCGTCTCATTGATCACCAACATTAAGTGTGCCAAACTCTTCTG
TGAAGCGAAGAAAGAAATGTTGCCAAGTGTTCGTTTACTGGAGAAGATGG
GATACGAATTGTATGCTAGCATGGGTACCGGTGACTTCTATCAAGAACAT
GGTGTACAGGTGCCACAATTTTCATTTTCACGACTTGCTGGAGCTGACGT
TCAACTTGGAGTAGAGATGGCAAGCACAGGAGAAGTAGCATGCTTCGGTG
AAAATAGATACGAAGCTTACTTGAAGGCCTTGATGAGCACAGGTTTCAAA
TTACCCAAGAAAAACATACTGCTGACTGTTGGTAGTTATAAGGACAATCA
ATTGAAGGTGATCGAATGCAATTTACGGGTGTCTCGGTCCTTCCCTTTTG
TTTCCAAAACTCTAGATTGTGATTTGGTTGCCTTGGCAACCAAAATCATC
GTTGGTGCTCCTGCTGAACCTGCATTCAACATTATGGATAAGTGTGAGAA
GATCGGCTGTAAGGAAATTGACGTTGATGCCGTTGCCAACGACGGTGAAG
TGATGGCCATGGTCGTCTCTGAACACGTTGAAAACGCGGGTGTCCACTCT
GGTGACGCAACCATGATCTGTCCACCACAAGACATCAATACGGAAACCAT
GGGACGGATCAAACAGATCTGTATTGCAGTTGGAAACGCCCTCAATGTGT
CTGGTCCTTTCAATATGCAACTTATTGCTAAGGAAGCCTATCAATTCTGC
ACCAAAGTTGGTTACCCAGTGCTGGTACGACCTTCATACGTGTTGAGTGG
AGCTGCCATGAATGTTGTTTATGCTGAAGATGATTTAGAATCATATCTTG
GATCTGCTGTCTCCATCTCTAAGGAGCATCCAGTTGTCATCTCCAAATTT
ATATCCAATGCTAAAATGGAAAGAGTTGACCACGATGGAGGTGAGGATCC
TTGGCACATCGCCAGAAATGATTGACAACGCTGAAAACAGATTCAAATTC
TCTCGTATGCTAGACAACATTGGAATCCTACAACCAACACAATCATGGAT
ATCTACCATAAAGAAGACCCAGAAGGTATTATCTTATCAATGGGAGGACA
GGTTGCCAACAACATTGCTATGCATCTCCACAGACAGGAACTTGGTAAGA
GCACAATTATGGTGAATTACAATCCTGAAACTGTCAGTACAGACTATGAT
GAATGTGATCGATTGTACTTCGATGAAATCACATTTGAGTTCTGAACTGG
TTATCCGCAAGTACCGTTATGAATGCAACATTTTGCCCTGTTTCAAGCAA
ATTGACACTGTTGCTGCAGAATTCCCAGCTGAAGCTAACTATCTGTATTT
AACTTACAATGGAGATTGTGATGACGTCACATACGCAGAAAGCCAAAACA
AAGTCATGGTTATTGGGTCAGGTGTCTACAGAATCGGAAGCAGTGTTGAA
TTTGATGCATGTGCTGTTGGATGTATTCGAGAATTGAAGAGGGTTGGAGC
TGGAAAGGACACCATTCCATGCAATATCCTACTGAAGGGGAAGCAGCTTG
GATTTTCAGATAAGCAAATTGCTAACTGCGTTCAAAGGTCTTAGTTGAGC
CCTCTGACAAAAGAATCTTTCATGTTGCTGCTGCACTCCGTAGAGGATAT
TCTATTGATCAGCTGTATGAGCTCACTCGTATTGATAAGTGGTTTTTGAG
CAAGCTAGCAAAAATAATCAACTATGCAAAAATGCTGGAAGAGAAATACC
CAAAGATTGGATCTTCGATGAAGAGTGTTGGTGAAGTAATGGCTATTGGA
AGAAGTTTTGAGGAAGCCATTCAAAAGAGTTTGAGAATGGTTGACGATTC
AAACCTTGGTTTTGATGCAAACAACCTCGAGTTGGATGAACAGTTCTACA
TCATTGAGGTCAATGCTCGTCTCTCCAGAAGTTCAGCTCTTGCTTCCAAA
GCAACTGGATACCCATTGGCTTACGTTGCTGCTAAACTTGCACTTGGTAT
TCCTCTACCAAAACTGAGAAATTCTGTCACCAATTCAACTACCGCTTGTT
TTGAGCCCTCTTTGGATTATTGTGTTGTGAAAGTTCCTCGATGGGATCTG
GACAAATTTCAGAGGGTTTCAACAAAGGTTTGTAATATGGAAAACTTTGA
CCCTTTGGGAATCCATACGGGTGAATCAATTGTTGTTGCACCAAGTCAAA
CACTAACAAATGAGGAATACAATATGCTTAGAAGAACAGCCATCAAAGTC
ATCCGTAAACTTGGTGTTGTTGGTGAATGTAACATCCAGTATGCTTTACA
CCCTGACTCAAAAGAGGCTATCACAGCAGCTAACAGGCTAGGATATCCAG
TGTTGTTACGTGCAGCATTTGCACTAGGTGGACTTGGATCTGGTTTTGCT
TCCAATGACAATGAGCTCAAAAAGCTTGCAGCATCGGCTTTTGCACATTC
CAAACAGTGTCTAGTTGACAAGTCACTGAAAGGATGGAAAGAAGTTGAAT
ATGAAGTTGTTAGAGATGCTTATGACAACTGTATCACTGTGATTGAAGTA
GAAAGACCAGATGGCATTCTGTTATCATTTGGTGGACAAACAGCATTGAA
CTGTGGACTGCTATTGAAAGAGAGGGGAATTTTAGAGAAATACAATGTTG
CTGTTCTTGGTACACCTACCAAATCGATTGAATGGACAGAAGATAGGAAA
ATGTTTTCAGACAAGATGGGAGAGATTGGTGAGAAAGTTGCACCAAGCTC
AGTGGCTTATACTGTGGATGAGTCAAACCAAAGAAGGTCTTGATTTTGGG
ATCTGGTGGCTTATCTATTGGTCAAGCCGGAGAATTTGATTATTCTGGCT
CTCAAGCTATCAAAGCATTAAAAGAAGAGAAGATTCACACAGTTTTGATC
AATCCTAATATTGCTACAGTGCAAACTTCCAAAGGACTTGCAGATAAAAC
TTACTTCCTTCCTGTTAACTTTGAATTCACAAGCAAGATATGGTAACAGA
GGACATAACCAACCTGCAACCCATTTGGAAACTCAACGTTGCTTCATCAC
TTGCCAAAATCATGGCTTTGCAATTGACACAGACAGCTTACCAAAAGAAT
GGTCTGTTTTGTTTACAAATGAGAATGATGGCAGTAATGAAGGCATTGTT
CACAACACAAAGCCAATCTTCTCAGTTCAGTTTCATCCTGAACATCAAGG
AGGACCAAGAGATTTGGAGCTTTTGTTTGGCTTTTTTGTGGATATTGTAA
ACAAACTGAAAATCGATTCTAACCTCTGCTTACGAACCATGCTGAAAGAA
ACGTTGACTTTCCACCCAGCAGAAGAAACAAGATCCAGAGCATAATATGA
TGGTCTGTTTATGAGCAATGGTCCTGGAGATCCTAGCCTTTGTCAAGTTT
CAATTGACACCCTCCGTAAAGTCATTACAGAATTGCCAGATGTGCCAGTC
TTTGGTATTTGCATGGGTCATCAGATCTTATCTCTTGCTGCTGGATGTGG
GTCCTACAAAATGAAGAACCTAAACTTTACAATCCTAAGGGTAAAATAAA
GATGATTGCTGTAGACTTTGGTATCAAATACAACCAGATCCGGTGTTTGA
TTGATTGTGATTGTCAGGTTCTAGTTGTTCCATGGGATTATGACTATAGT
ACATTGTTAAAGAACAAAGATTGTTTTGGATGGAGAGGATGAAGCAAGTG
TTCCATTTGATGATCCAAACAAAAGGAATTTGATTGCTGAAGTCTCTTGC
AAGGTATTGATACCAGAGCATTAACAAAGAAGTTGAGAGAAAATGGAACA
ATGTTAGGAAAGTCTTCCAAACTGGTATGGTTGGTTACCCAGAATCATTG
ACAGATCCTTCATACAACAGTCAAATCTTGGTATTGACGTATCCACTGAT
TGGTAATTATGGTATACCAAACGATTCTCGTGATGAACATGGCATGCTCA
AATTTTTTGAATCTGAAAAGATTTGGAACAATGGTATGATTGTAGGAGAC
TTGACTGAGGACTACAGCCATTGGTTGGCAACCAAATCACTTTCAGAGTG
GCTGAAGGAACACAAAATACCTGGAATTACTGATGGCGACACTTATTCTT
GATGATGGCACCAAATATCATGGTCAAATTTTTGGTGATGAAAGAAGTAT
TGCAGGAGAAGTTGTTGGCCATTAAGAACGCTCGCTGTGATTTCGCCTTG
TACGCTGGTGCCAGTTCAACCAATGCTCTAATGTTGCCAAAGATTGCACC
AGGATGTGCTGGTCTCAAAATGTACCTCAACGATACTTACACTACCTTGA
AGATGGACAACCTCNAAGATTGCACCAGGTTGTGCTGGTCTCAAAATGTA
CCTCAACGATACTTACACTACCTTGAAGATGGACAACCTCTCTGAGCATT
GTTCAAAGTGGGCAGCAAGATCGAAGTGAAAACACACATTGATTGCATTT
CATCGGGAAACATTGTGCGATTGCCAGGTCTCATTGATGTCCACGTACAC
TTGCGACAACCTGGTGCCGAGTACAAAGAAGATTTCGATAGCGGTACTGC
AGCCGCACTGGCCGGTGGCGTCACCATGGTGCTGTGTATGCCGAACACCA
AGCCAGCTGTGGTGGATCAACCCACTTTCCAGCTTGCGCACCAAGTCCAA
ATCATTGATTGGCCTTTCGAGGAGAATGGAACTGAGGGTCAGGAAGAGAG
CATTCAAGACTACCTCACACAGAACAAATTTGATTTGGTCATCAACATTC
CAATGAGGGGTAGTGGTACCAAGAAGAAGTCTCATTTCATCACACATGGA
TATCGCACCCGACGAATGGCCATCGATCATTCCGTCTCATTGATCACCAA
CATTAAGTGTGCCAAACTCTTCTGTGAAGCGAAGAAAGAAATGTTGCCAA
GTGTTCGTTTACTGGAGAAGATGGGATACGAATTGTATGCTAGCATGGGT
ACCGGTGACTTCTATCAAGAACATGGTGTACAGGTGCCACAATTTTCATT
TTCACGACTTGCTGGAGCTGACGTTCAACTTGGAGTAGAGATGGCAAGCA
CAGGAGAAGTAGCATGCTTCGGTGAAAATAGATACGAAGCTTACTTGAAG
GCCTTGATGAGCACAGGTTTCAAATTACCCAAGAAAAACATACTGCTGAC
TGTTGGTAGTTATAAGGACAATCAATTGAAGGTGATCGAATGCAATTTAC
GGGTGTCTCGGTCCTTCCCTTTTGTTTCCAAAACTCTAGATTGTGATTTG
GTTGCCTTGGCAACCAAAATCATCGTTGGTGCTCCTGCTGAACCTGCATT
CAACATTATGGATAAGTGTGAGAAGATCGGCTGTAAGGAAATTGACGTTG
ATGCCGTTGCCAACGACGGTGAAGTGATGGCCATGGTCGTCTCTGAACAC
GTTGAAAACGCGGGTGTCCACTCTGGTGACGCAACCATGATCTGTCCACC
ACAAGACATCAATACGGAAACCATGGGACGGATCAAACAGATCTGTATTG
CAGTTGGAAACGCCCTCAATGTGTCTGGTCCTTTCAATATGCAACTTATT
GCTAAGGAAGCCTATCAATTCTGCACCAAAGTTGGTTACCCAGTGCTGGT
ACGACCTTCATACGTGTTGAGTGGAGCTGCCATGAATGTTGTTTATGCTG
AAGATGATTTAGAATCATATCTTGGATCTGCTGTCTCCATCTCTAAGGAG
CATCCAGTTGTCATCTCCAAATTTATATCCAATGCTAAAATGGAAAGAGT
TGACCACGATGGAGGTGAGGATCCTTGGCACATCGCCAGAAATGATTGAC
AACGCTGAAAACAGATTCAAATTCTCTCGTATGCTAGACAACATTGGAAT
CCTACAACCAACACAATCATGGATATCTACCATAAAGAAGACCCAGAAGG
TATTATCTTATCAATGGGAGGACAGGTTGCCAACAACATTGCTATGCATC
TCCACAGACAGGAACTTGGTAAGAGCACAATTATGGTGAATTACAATCCT
GAAACTGTCAGTACAGACTATGATGAATGTGATCGATTGTACTTCGATGA
AATCACATTTGAGTTCTGAACTGGTTATCCGCAAGTACCGTTATGAATGC
AACATTTTGCCCTGTTTCAAGCAAATTGACACTGTTGCTGCAGAATTCCC
AGCTGAAGCTAACTATCTGTATTTAACTTACAATGGAGATTGTGATGACG
TCACATACGCAGAAAGCCAAAACAAAGTCATGGTTATTGGGTCAGGTGTC
TACAGAATCGGAAGCAGTGTTGAATTTGATGCATGTGCTGTTGGATGTAT
TCGAGAATTGAAGAGGGTTGGAGCTGGAAAGGACACCATTCCATGCAATA
TCCTACTGAAGGGGAAGCAGCTTGGATTTTCAGATAAGCAAATTGCTAAC
TGCGTTCAAAGGTCTTAGTTGAGCCCTCTGACAAAAGAATCTTTCATGTT
GCTGCTGCACTCCGTAGAGGATATTCTATTGATCAGCTGTATGAGCTCAC
TCGTATTGATAAGTGGTTTTTGAGCAAGCTAGCAAAAATAATCAACTATG
CAAAAATGCTGGAAGAGAAATACCCAAAGATTGGATCTTCGATGAAGAGT
GTTGGTGAAGTAATGGCTATTGGAAGAAGTTTTGAGGAAGCCATTCAAAA
GAGTTTGAGAATGGTTGACGATTCAAACCTTGGTTTTGATGCAAACAACC
TCGAGTTGGATGAACAGTTCTACATCATTGAGGTCAATGCTCGTCTCTCC
AGAAGTTCAGCTCTTGCTTCCAAAGCAACTGGATACCCATTGGCTTACGT
TGCTGCTAAACTTGCACTTGGTATTCCTCTACCAAAACTGAGAAATTCTG
TCACCAATTCAACTACCGCTTGTTTTGAGCCCTCTTTGGATTATTGTGTT
GTGAAAGTTCCTCGATGGGATCTGGACAAATTTCAGAGGGTTTCAACAAA
GGTTTGTAATATGGAAAACTTTGACCCTTTGGGAATCCATACGGGTGAAT
CAATTGTTGTTGCACCAAGTCAAACACTAACAAATGAGGAATACAATATG
CTTAGAAGAACAGCCATCAAAGTCATCCGTAAACTTGGTGTTGTTGGTGA
ATGTAACATCCAGTATGCTTTACACCCTGACTCAAAAGAGGCTATCACAG
CAGCTAACAGGCTAGGATATCCAGTGTTGTTACGTGCAGCATTTGCACTA
GGTGGACTTGGATCTGGTTTTGCTTCCAATGACAATGAGCTCAAAAAGCT
TGCAGCATCGGCTTTTGCACATTCCAAACAGTGTCTAGTTGACAAGTCAC
TGAAAGGATGGAAAGAAGTTGAATATGAAGTTGTTAGAGATGCTTATGAC
AACTGTATCACTGTGATTGAAGTAGAAAGACCAGATGGCATTCTGTTATC
ATTTGGTGGACAAACAGCATTGAACTGTGGACTGCTATTGAAAGAGAGGG
GAATTTTAGAGAAATACAATGTTGCTGTTCTTGGTACACCTACCAAATCG
ATTGAATGGACAGAAGATAGGAAAATGTTTTCAGACAAGATGGGAGAGAT
TGGTGAGAAAGTTGCACCAAGCTCAGTGGCTTATACTGTGGATGAGTCAA
ACCAAAGAAGGTCTTGATTTTGGGATCTGGTGGCTTATCTATTGGTCAAG
CCGGAGAATTTGATTATTCTGGCTCTCAAGCTATCAAAGCATTAAAAGAA
GAGAAGATTCACACAGTTTTGATCAATCCTAATATTGCTACAGTGCAAAC
TTCCAAAGGACTTGCAGATAAAACTTACTTCCTTCCTGTTAACTTTGAAT
TCACAAGCAAGATATGGTAACAGAGGACATAACCAACCTGCAACCCATTT
GGAAACTCAACGTTGCTTCATCACTTGCCAAAATCATGGCTTTGCAATTG
ACACAGACAGCTTACCAAAAGAATGGTCTGTTTTGTTTACAAATGAGAAT
GATGGCAGTAATGAAGGCATTGTTCACAACACAAAGCCAATCTTCTCAGT
TCAGTTTCATCCTGAACATCAAGGAGGACCAAGAGATTTGGAGCTTTTGT
TTGGCTTTTTTGTGGATATTGTAAACAAACTGAAAATCGATTCTAACCTC
TGCTTACGAACCATGCTGAAAGAAACGTTGACTTTCCACCCAGCAGAAGA
AACAAGATCCAGAGCATAATATGATGGTCTGTTTATGAGCAATGGTCCTG
GAGATCCTAGCCTTTGTCAAGTTTCAATTGACACCCTCCGTAAAGTCATT
ACAGAATTGCCAGATGTGCCAGTCTTTGGTATTTGCATGGGTCATCAGAT
CTTATCTCTTGCTGCTGGATGTGGGTCCTACAAAATGAAGAACCTAAACT
TTACAATCCTAAGGGTAAAATAAAGATGATTGCTGTAGACTTTGGTATCA
AATACAACCAGATCCGGTGTTTGATTGATTGTGATTGTCAGGTTCTAGTT
GTTCCATGGGATTATGACTATAGTACATTGTTAAAGAACAAAGATTGTTT
TGGATGGAGAGGATGAAGCAAGTGTTCCATTTGATGATCCAAACAAAAGG
AATTTGATTGCTGAAGTCTCTTGCAAGGTATTGATACCAGAGCATTAACA
AAGAAGTTGAGAGAAAATGGAACAATGTTAGGAAAGTCTTCCAAACTGGT
ATGGTTGGTTACCCAGAATCATTGACAGATCCTTCATACAACAGTCAAAT
CTTGGTATTGACGTATCCACTGATTGGTAATTATGGTATACCAAACGATT
CTCGTGATGAACATGGCATGCTCAAATTTTTTGAATCTGAAAAGATTTGG
AACAATGGTATGATTGTAGGAGACTTGACTGAGGACTACAGCCATTGGTT
GGCAACCAAATCACTTTCAGAGTGGCTGAAGGAACACAAAATACCTGGAA
TTACTGATGGCGACACTTATTCTTGATGATGGCACCAAATATCATGGTCA
AATTTTTGGTGATGAAAGAAGTATTGCAGGAGAAGTTGTTGGCCATTAAG
AACGCTCGCTGTGATTTCGCCTTGTACGCTGGTGCCAGTTCAACCAATGC
TCTAATGTTGCCAAAGATTGCACCAGGATGTGCTGGTCTCAAAATGTACC
TCAACGATACTTACACTACCTTGAAGATGGACAACCTCNAAGATTGCACC
AGGTTGTGCTGGTCTCAAAATGTACCTCAACGATACTTACACTACCTTGA
AGATGGACAACCTCTCTGAGCATTGTTCAAAGTGGGCAGCAAGATCGAAG
TGAAAACACACATTGATTGCATTTCATCGGGAAACATTGTGCGATTGCCA
GGTCTCATTGATGTCCACGTACACTTGCGACAACCTGGTGCCGAGTACAA
AGAAGATTTCGATAGCGGTACTGCAGCCGCACTGGCCGGTGGCGTCACCA
TGGTGCTGTGTATGCCGAACACCAAGCCAGCTGTGGTGGATCAACCCACT
TTCCAGCTTGCGCACCAAGTCCAAATCATTGATTGGCCTTTCGAGGAGAA
TGGAACTGAGGGTCAGGAAGAGAGCATTCAAGACTACCTCACACAGAACA
AATTTGATTTGGTCATCAACATTCCAATGAGGGGTAGTGGTACCAAGAAG
AAGTCTCATTTCATCACACATGGATATCGCACCCGACGAATGGCCATCGA
TCATTCCGTCTCATTGATCACCAACATTAAGTGTGCCAAACTCTTCTGTG
AAGCGAAGAAAGAAATGTTGCCAAGTGTTCGTTTACTGGAGAAGATGGGA
TACGAATTGTATGCTAGCATGGGTACCGGTGACTTCTATCAAGAACATGG
TGTACAGGTGCCACAATTTTCATTTTCACGACTTGCTGGAGCTGACGTTC
AACTTGGAGTAGAGATGGCAAGCACAGGAGAAGTAGCATGCTTCGGTGAA
AATAGATACGAAGCTTACTTGAAGGCCTTGATGAGCACAGGTTTCAAATT
ACCCAAGAAAAACATACTGCTGACTGTTGGTAGTTATAAGGACAATCAAT
TGAAGGTGATCGAATGCAATTTACGGGTGTCTCGGTCCTTCCCTTTTGTT
TCCAAAACTCTAGATTGTGATTTGGTTGCCTTGGCAACCAAAATCATCGT
TGGTGCTCCTGCTGAACCTGCATTCAACATTATGGATAAGTGTGAGAAGA
TCGGCTGTAAGGAAATTGACGTTGATGCCGTTGCCAACGACGGTGAAGTG
ATGGCCATGGTCGTCTCTGAACACGTTGAAAACGCGGGTGTCCACTCTGG
TGACGCAACCATGATCTGTCCACCACAAGACATCAATACGGAAACCATGG
GACGGATCAAACAGATCTGTATTGCAGTTGGAAACGCCCTCAATGTGTCT
GGTCCTTTCAATATGCAACTTATTGCTAAGGAAGCCTATCAATTCTGCAC
CAAAGTTGGTTACCCAGTGCTGGTACGACCTTCATACGTGTTGAGTGGAG
CTGCCATGAATGTTGTTTATGCTGAAGATGATTTAGAATCATATCTTGGA
TCTGCTGTCTCCATCTCTAAGGAGCATCCAGTTGTCATCTCCAAATTTAT
ATCCAATGCTAAAATGGAAAGAGTTGACCACGATGGAGGTGAGGATCCTT
GGCACATCGCCAGAAATGATTGACAACGCTGAAAACAGATTCAAATTCTC
TCGTATGCTAGACAACATTGGAATCCTACAACCAACACAATCATGGATAT
CTACCATAAAGAAGACCCAGAAGGTATTATCTTATCAATGGGAGGACAGG
TTGCCAACAACATTGCTATGCATCTCCACAGACAGGAACTTGGTAAGAGC
ACAATTATGGTGAATTACAATCCTGAAACTGTCAGTACAGACTATGATGA
ATGTGATCGATTGTACTTCGATGAAATCACATTTGAGTTCTGAACTGGTT
ATCCGCAAGTACCGTTATGAATGCAACATTTTGCCCTGTTTCAAGCAAAT
TGACACTGTTGCTGCAGAATTCCCAGCTGAAGCTAACTATCTGTATTTAA
CTTACAATGGAGATTGTGATGACGTCACATACGCAGAAAGCCAAAACAAA
GTCATGGTTATTGGGTCAGGTGTCTACAGAATCGGAAGCAGTGTTGAATT
TGATGCATGTGCTGTTGGATGTATTCGAGAATTGAAGAGGGTTGGAGCTG
GAAAGGACACCATTCCATGCAATATCCTACTGAAGGGGAAGCAGCTTGGA
TTTTCAGATAAGCAAATTGCTAACTGCGTTCAAAGGTCTTAGTTGAGCCC
TCTGACAAAAGAATCTTTCATGTTGCTGCTGCACTCCGTAGAGGATATTC
TATTGATCAGCTGTATGAGCTCACTCGTATTGATAAGTGGTTTTTGAGCA
AGCTAGCAAAAATAATCAACTATGCAAAAATGCTGGAAGAGAAATACCCA
AAGATTGGATCTTCGATGAAGAGTGTTGGTGAAGTAATGGCTATTGGAAG
AAGTTTTGAGGAAGCCATTCAAAAGAGTTTGAGAATGGTTGACGATTCAA
ACCTTGGTTTTGATGCAAACAACCTCGAGTTGGATGAACAGTTCTACATC
ATTGAGGTCAATGCTCGTCTCTCCAGAAGTTCAGCTCTTGCTTCCAAAGC
AACTGGATACCCATTGGCTTACGTTGCTGCTAAACTTGCACTTGGTATTC
CTCTACCAAAACTGAGAAATTCTGTCACCAATTCAACTACCGCTTGTTTT
GAGCCCTCTTTGGATTATTGTGTTGTGAAAGTTCCTCGATGGGATCTGGA
CAAATTTCAGAGGGTTTCAACAAAGGTTTGTAATATGGAAAACTTTGACC
CTTTGGGAATCCATACGGGTGAATCAATTGTTGTTGCACCAAGTCAAACA
CTAACAAATGAGGAATACAATATGCTTAGAAGAACAGCCATCAAAGTCAT
CCGTAAACTTGGTGTTGTTGGTGAATGTAACATCCAGTATGCTTTACACC
CTGACTCAAAAGAGGCTATCACAGCAGCTAACAGGCTAGGATATCCAGTG
TTGTTACGTGCAGCATTTGCACTAGGTGGACTTGGATCTGGTTTTGCTTC
CAATGACAATGAGCTCAAAAAGCTTGCAGCATCGGCTTTTGCACATTCCA
AACAGTGTCTAGTTGACAAGTCACTGAAAGGATGGAAAGAAGTTGAATAT
GAAGTTGTTAGAGATGCTTATGACAACTGTATCACTGTGATTGAAGTAGA
AAGACCAGATGGCATTCTGTTATCATTTGGTGGACAAACAGCATTGAACT
GTGGACTGCTATTGAAAGAGAGGGGAATTTTAGAGAAATACAATGTTGCT
GTTCTTGGTACACCTACCAAATCGATTGAATGGACAGAAGATAGGAAAAT
GTTTTCAGACAAGATGGGAGAGATTGGTGAGAAAGTTGCACCAAGCTCAG
TGGCTTATACTGTGGATGAGTCAAACCAAAGAAGGTCTTGATTTTGGGAT
CTGGTGGCTTATCTATTGGTCAAGCCGGAGAATTTGATTATTCTGGCTCT
CAAGCTATCAAAGCATTAAAAGAAGAGAAGATTCACACAGTTTTGATCAA
TCCTAATATTGCTACAGTGCAAACTTCCAAAGGACTTGCAGATAAAACTT
ACTTCCTTCCTGTTAACTTTGAATTCACAAGCAAGATATGGTAACAGAGG
ACATAACCAACCTGCAACCCATTTGGAAACTCAACGTTGCTTCATCACTT
GCCAAAATCATGGCTTTGCAATTGACACAGACAGCTTACCAAAAGAATGG
TCTGTTTTGTTTACAAATGAGAATGATGGCAGTAATGAAGGCATTGTTCA
CAACACAAAGCCAATCTTCTCAGTTCAGTTTCATCCTGAACATCAAGGAG
GACCAAGAGATTTGGAGCTTTTGTTTGGCTTTTTTGTGGATATTGTAAAC
AAACTGAAAATCGATTCTAACCTCTGCTTACGAACCATGCTGAAAGAAAC
GTTGACTTTCCACCCAGCAGAAGAAACAAGATCCAGAGCATAATATGATG
GTCTGTTTATGAGCAATGGTCCTGGAGATCCTAGCCTTTGTCAAGTTTCA
ATTGACACCCTCCGTAAAGTCATTACAGAATTGCCAGATGTGCCAGTCTT
TGGTATTTGCATGGGTCATCAGATCTTATCTCTTGCTGCTGGATGTGGGT
CCTACAAAATGAAGAACCTAAACTTTACAATCCTAAGGGTAAAATAAAGA
TGATTGCTGTAGACTTTGGTATCAAATACAACCAGATCCGGTGTTTGATT
GATTGTGATTGTCAGGTTCTAGTTGTTCCATGGGATTATGACTATAGTAC
ATTGTTAAAGAACAAAGATTGTTTTGGATGGAGAGGATGAAGCAAGTGTT
CCATTTGATGATCCAAACAAAAGGAATTTGATTGCTGAAGTCTCTTGCAA
GGTATTGATACCAGAGCATTAACAAAGAAGTTGAGAGAAAATGGAACAAT
GTTAGGAAAGTCTTCCAAACTGGTATGGTTGGTTACCCAGAATCATTGAC
AGATCCTTCATACAACAGTCAAATCTTGGTATTGACGTATCCACTGATTG
GTAATTATGGTATACCAAACGATTCTCGTGATGAACATGGCATGCTCAAA
TTTTTTGAATCTGAAAAGATTTGGAACAATGGTATGATTGTAGGAGACTT
GACTGAGGACTACAGCCATTGGTTGGCAACCAAATCACTTTCAGAGTGGC
TGAAGGAACACAAAATACCTGGAATTACTGATGGCGACACTTATTCTTGA
TGATGGCACCAAATATCATGGTCAAATTTTTGGTGATGAAAGAAGTATTG
CAGGAGAAGTTGTTGGCCATTAAGAACGCTCGCTGTGATTTCGCCTTGTA
CGCTGGTGCCAGTTCAACCAATGCTCTAATGTTGCCAAAGATTGCACCAG
GATGTGCTGGTCTCAAAATGTACCTCAACGATACTTACACTACCTTGAAG
ATGGACAACCTCNAAGATTGCACCAGGTTGTGCTGGTCTCAAAATGTACC
TCAACGATACTTACACTACCTTGAAGATGGACAACCTCTCTGAGCATTGT
TCAAAGTGGGCAGCAAGATCGAAGTGAAAACACACATTGATTGCATTTCA
TCGGGAAACATTGTGCGATTGCCAGGTCTCATTGATGTCCACGTACACTT
GCGACAACCTGGTGCCGAGTACAAAGAAGATTTCGATAGCGGTACTGCAG
CCGCACTGGCCGGTGGCGTCACCATGGTGCTGTGTATGCCGAACACCAAG
CCAGCTGTGGTGGATCAACCCACTTTCCAGCTTGCGCACCAAGTCCAAAT
CATTGATTGGCCTTTCGAGGAGAATGGAACTGAGGGTCAGGAAGAGAGCA
TTCAAGACTACCTCACACAGAACAAATTTGATTTGGTCATCAACATTCCA
ATGAGGGGTAGTGGTACCAAGAAGAAGTCTCATTTCATCACACATGGATA
TCGCACCCGACGAATGGCCATCGATCATTCCGTCTCATTGATCACCAACA
TTAAGTGTGCCAAACTCTTCTGTGAAGCGAAGAAAGAAATGTTGCCAAGT
GTTCGTTTACTGGAGAAGATGGGATACGAATTGTATGCTAGCATGGGTAC
CGGTGACTTCTATCAAGAACATGGTGTACAGGTGCCACAATTTTCATTTT
CACGACTTGCTGGAGCTGACGTTCAACTTGGAGTAGAGATGGCAAGCACA
GGAGAAGTAGCATGCTTCGGTGAAAATAGATACGAAGCTTACTTGAAGGC
CTTGATGAGCACAGGTTTCAAATTACCCAAGAAAAACATACTGCTGACTG
TTGGTAGTTATAAGGACAATCAATTGAAGGTGATCGAATGCAATTTACGG
GTGTCTCGGTCCTTCCCTTTTGTTTCCAAAACTCTAGATTGTGATTTGGT
TGCCTTGGCAACCAAAATCATCGTTGGTGCTCCTGCTGAACCTGCATTCA
ACATTATGGATAAGTGTGAGAAGATCGGCTGTAAGGAAATTGACGTTGAT
GCCGTTGCCAACGACGGTGAAGTGATGGCCATGGTCGTCTCTGAACACGT
TGAAAACGCGGGTGTCCACTCTGGTGACGCAACCATGATCTGTCCACCAC
AAGACATCAATACGGAAACCATGGGACGGATCAAACAGATCTGTATTGCA
GTTGGAAACGCCCTCAATGTGTCTGGTCCTTTCAATATGCAACTTATTGC
TAAGGAAGCCTATCAATTCTGCACCAAAGTTGGTTACCCAGTGCTGGTAC
GACCTTCATACGTGTTGAGTGGAGCTGCCATGAATGTTGTTTATGCTGAA
GATGATTTAGAATCATATCTTGGATCTGCTGTCTCCATCTCTAAGGAGCA
TCCAGTTGTCATCTCCAAATTTATATCCAATGCTAAAATGGAAAGAGTTG
ACCACGATGGAGGTGAGGATCCTTGGCACATCGCCAGAAATGATTGACAA
CGCTGAAAACAGATTCAAATTCTCTCGTATGCTAGACAACATTGGAATCC
TACAACCAACACAATCATGGATATCTACCATAAAGAAGACCCAGAAGGTA
TTATCTTATCAATGGGAGGACAGGTTGCCAACAACATTGCTATGCATCTC
CACAGACAGGAACTTGGTAAGAGCACAATTATGGTGAATTACAATCCTGA
AACTGTCAGTACAGACTATGATGAATGTGATCGATTGTACTTCGATGAAA
TCACATTTGAGTTCTGAACTGGTTATCCGCAAGTACCGTTATGAATGCAA
CATTTTGCCCTGTTTCAAGCAAATTGACACTGTTGCTGCAGAATTCCCAG
CTGAAGCTAACTATCTGTATTTAACTTACAATGGAGATTGTGATGACGTC
ACATACGCAGAAAGCCAAAACAAAGTCATGGTTATTGGGTCAGGTGTCTA
CAGAATCGGAAGCAGTGTTGAATTTGATGCATGTGCTGTTGGATGTATTC
GAGAATTGAAGAGGGTTGGAGCTGGAAAGGACACCATTCCATGCAATATC
CTACTGAAGGGGAAGCAGCTTGGATTTTCAGATAAGCAAATTGCTAACTG
CGTTCAAAGGTCTTAGTTGAGCCCTCTGACAAAAGAATCTTTCATGTTGC
TGCTGCACTCCGTAGAGGATATTCTATTGATCAGCTGTATGAGCTCACTC
GTATTGATAAGTGGTTTTTGAGCAAGCTAGCAAAAATAATCAACTATGCA
AAAATGCTGGAAGAGAAATACCCAAAGATTGGATCTTCGATGAAGAGTGT
TGGTGAAGTAATGGCTATTGGAAGAAGTTTTGAGGAAGCCATTCAAAAGA
GTTTGAGAATGGTTGACGATTCAAACCTTGGTTTTGATGCAAACAACCTC
GAGTTGGATGAACAGTTCTACATCATTGAGGTCAATGCTCGTCTCTCCAG
AAGTTCAGCTCTTGCTTCCAAAGCAACTGGATACCCATTGGCTTACGTTG
CTGCTAAACTTGCACTTGGTATTCCTCTACCAAAACTGAGAAATTCTGTC
ACCAATTCAACTACCGCTTGTTTTGAGCCCTCTTTGGATTATTGTGTTGT
GAAAGTTCCTCGATGGGATCTGGACAAATTTCAGAGGGTTTCAACAAAGG
TTTGTAATATGGAAAACTTTGACCCTTTGGGAATCCATACGGGTGAATCA
ATTGTTGTTGCACCAAGTCAAACACTAACAAATGAGGAATACAATATGCT
TAGAAGAACAGCCATCAAAGTCATCCGTAAACTTGGTGTTGTTGGTGAAT
GTAACATCCAGTATGCTTTACACCCTGACTCAAAAGAGGCTATCACAGCA
GCTAACAGGCTAGGATATCCAGTGTTGTTACGTGCAGCATTTGCACTAGG
TGGACTTGGATCTGGTTTTGCTTCCAATGACAATGAGCTCAAAAAGCTTG
CAGCATCGGCTTTTGCACATTCCAAACAGTGTCTAGTTGACAAGTCACTG
AAAGGATGGAAAGAAGTTGAATATGAAGTTGTTAGAGATGCTTATGACAA
CTGTATCACTGTGATTGAAGTAGAAAGACCAGATGGCATTCTGTTATCAT
TTGGTGGACAAACAGCATTGAACTGTGGACTGCTATTGAAAGAGAGGGGA
ATTTTAGAGAAATACAATGTTGCTGTTCTTGGTACACCTACCAAATCGAT
TGAATGGACAGAAGATAGGAAAATGTTTTCAGACAAGATGGGAGAGATTG
GTGAGAAAGTTGCACCAAGCTCAGTGGCTTATACTGTGGATGAGTCAAAC
CAAAGAAGGTCTTGATTTTGGGATCTGGTGGCTTATCTATTGGTCAAGCC
GGAGAATTTGATTATTCTGGCTCTCAAGCTATCAAAGCATTAAAAGAAGA
GAAGATTCACACAGTTTTGATCAATCCTAATATTGCTACAGTGCAAACTT
CCAAAGGACTTGCAGATAAAACTTACTTCCTTCCTGTTAACTTTGAATTC
ACAAGCAAGATATGGTAACAGAGGACATAACCAACCTGCAACCCATTTGG
AAACTCAACGTTGCTTCATCACTTGCCAAAATCATGGCTTTGCAATTGAC
ACAGACAGCTTACCAAAAGAATGGTCTGTTTTGTTTACAAATGAGAATGA
TGGCAGTAATGAAGGCATTGTTCACAACACAAAGCCAATCTTCTCAGTTC
AGTTTCATCCTGAACATCAAGGAGGACCAAGAGATTTGGAGCTTTTGTTT
GGCTTTTTTGTGGATATTGTAAACAAACTGAAAATCGATTCTAACCTCTG
CTTACGAACCATGCTGAAAGAAACGTTGACTTTCCACCCAGCAGAAGAAA
CAAGATCCAGAGCATAATATGATGGTCTGTTTATGAGCAATGGTCCTGGA
GATCCTAGCCTTTGTCAAGTTTCAATTGACACCCTCCGTAAAGTCATTAC
AGAATTGCCAGATGTGCCAGTCTTTGGTATTTGCATGGGTCATCAGATCT
TATCTCTTGCTGCTGGATGTGGGTCCTACAAAATGAAGAACCTAAACTTT
ACAATCCTAAGGGTAAAATAAAGATGATTGCTGTAGACTTTGGTATCAAA
TACAACCAGATCCGGTGTTTGATTGATTGTGATTGTCAGGTTCTAGTTGT
TCCATGGGATTATGACTATAGTACATTGTTAAAGAACAAAGATTGTTTTG
GATGGAGAGGATGAAGCAAGTGTTCCATTTGATGATCCAAACAAAAGGAA
TTTGATTGCTGAAGTCTCTTGCAAGGTATTGATACCAGAGCATTAACAAA
GAAGTTGAGAGAAAATGGAACAATGTTAGGAAAGTCTTCCAAACTGGTAT
GGTTGGTTACCCAGAATCATTGACAGATCCTTCATACAACAGTCAAATCT
TGGTATTGACGTATCCACTGATTGGTAATTATGGTATACCAAACGATTCT
CGTGATGAACATGGCATGCTCAAATTTTTTGAATCTGAAAAGATTTGGAA
CAATGGTATGATTGTAGGAGACTTGACTGAGGACTACAGCCATTGGTTGG
CAACCAAATCACTTTCAGAGTGGCTGAAGGAACACAAAATACCTGGAATT
ACTGATGGCGACACTTATTCTTGATGATGGCACCAAATATCATGGTCAAA
TTTTTGGTGATGAAAGAAGTATTGCAGGAGAAGTTGTTGGCCATTAAGAA
CGCTCGCTGTGATTTCGCCTTGTACGCTGGTGCCAGTTCAACCAATGCTC
TAATGTTGCCAAAGATTGCACCAGGATGTGCTGGTCTCAAAATGTACCTC
AACGATACTTACACTACCTTGAAGATGGACAACCTCNAAGATTGCACCAG
GTTGTGCTGGTCTCAAAATGTACCTCAACGATACTTACACTACCTTGAAG
ATGGACAACCTCTCTGAGCATTGTTCAAAGTGGGCAGCAAGATCGAAGTG
AAAACACACATTGATTGCATTTCATCGGGAAACATTGTGCGATTGCCAGG
TCTCATTGATGTCCACGTACACTTGCGACAACCTGGTGCCGAGTACAAAG
AAGATTTCGATAGCGGTACTGCAGCCGCACTGGCCGGTGGCGTCACCATG
GTGCTGTGTATGCCGAACACCAAGCCAGCTGTGGTGGATCAACCCACTTT
CCAGCTTGCGCACCAAGTCCAAATCATTGATTGGCCTTTCGAGGAGAATG
GAACTGAGGGTCAGGAAGAGAGCATTCAAGACTACCTCACACAGAACAAA
TTTGATTTGGTCATCAACATTCCAATGAGGGGTAGTGGTACCAAGAAGAA
GTCTCATTTCATCACACATGGATATCGCACCCGACGAATGGCCATCGATC
ATTCCGTCTCATTGATCACCAACATTAAGTGTGCCAAACTCTTCTGTGAA
GCGAAGAAAGAAATGTTGCCAAGTGTTCGTTTACTGGAGAAGATGGGATA
CGAATTGTATGCTAGCATGGGTACCGGTGACTTCTATCAAGAACATGGTG
TACAGGTGCCACAATTTTCATTTTCACGACTTGCTGGAGCTGACGTTCAA
CTTGGAGTAGAGATGGCAAGCACAGGAGAAGTAGCATGCTTCGGTGAAAA
TAGATACGAAGCTTACTTGAAGGCCTTGATGAGCACAGGTTTCAAATTAC
CCAAGAAAAACATACTGCTGACTGTTGGTAGTTATAAGGACAATCAATTG
AAGGTGATCGAATGCAATTTACGGGTGTCTCGGTCCTTCCCTTTTGTTTC
CAAAACTCTAGATTGTGATTTGGTTGCCTTGGCAACCAAAATCATCGTTG
GTGCTCCTGCTGAACCTGCATTCAACATTATGGATAAGTGTGAGAAGATC
GGCTGTAAGGAAATTGACGTTGATGCCGTTGCCAACGACGGTGAAGTGAT
GGCCATGGTCGTCTCTGAACACGTTGAAAACGCGGGTGTCCACTCTGGTG
ACGCAACCATGATCTGTCCACCACAAGACATCAATACGGAAACCATGGGA
CGGATCAAACAGATCTGTATTGCAGTTGGAAACGCCCTCAATGTGTCTGG
TCCTTTCAATATGCAACTTATTGCTAAGGAAGCCTATCAATTCTGCACCA
AAGTTGGTTACCCAGTGCTGGTACGACCTTCATACGTGTTGAGTGGAGCT
GCCATGAATGTTGTTTATGCTGAAGATGATTTAGAATCATATCTTGGATC
TGCTGTCTCCATCTCTAAGGAGCATCCAGTTGTCATCTCCAAATTTATAT
CCAATGCTAAAATGGAAAGAGTTGACCACGATGGAGGTGAGGATCCTTGG
CACATCGCCAGAAATGATTGACAACGCTGAAAACAGATTCAAATTCTCTC
GTATGCTAGACAACATTGGAATCCTACAACCAACACAATCATGGATATCT
ACCATAAAGAAGACCCAGAAGGTATTATCTTATCAATGGGAGGACAGGTT
GCCAACAACATTGCTATGCATCTCCACAGACAGGAACTTGGTAAGAGCAC
AATTATGGTGAATTACAATCCTGAAACTGTCAGTACAGACTATGATGAAT
GTGATCGATTGTACTTCGATGAAATCACATTTGAGTTCTGAACTGGTTAT
CCGCAAGTACCGTTATGAATGCAACATTTTGCCCTGTTTCAAGCAAATTG
ACACTGTTGCTGCAGAATTCCCAGCTGAAGCTAACTATCTGTATTTAACT
TACAATGGAGATTGTGATGACGTCACATACGCAGAAAGCCAAAACAAAGT
CATGGTTATTGGGTCAGGTGTCTACAGAATCGGAAGCAGTGTTGAATTTG
ATGCATGTGCTGTTGGATGTATTCGAGAATTGAAGAGGGTTGGAGCTGGA
AAGGACACCATTCCATGCAATATCCTACTGAAGGGGAAGCAGCTTGGATT
TTCAGATAAGCAAATTGCTAACTGCGTTCAAAGGTCTTAGTTGAGCCCTC
TGACAAAAGAATCTTTCATGTTGCTGCTGCACTCCGTAGAGGATATTCTA
TTGATCAGCTGTATGAGCTCACTCGTATTGATAAGTGGTTTTTGAGCAAG
CTAGCAAAAATAATCAACTATGCAAAAATGCTGGAAGAGAAATACCCAAA
GATTGGATCTTCGATGAAGAGTGTTGGTGAAGTAATGGCTATTGGAAGAA
GTTTTGAGGAAGCCATTCAAAAGAGTTTGAGAATGGTTGACGATTCAAAC
CTTGGTTTTGATGCAAACAACCTCGAGTTGGATGAACAGTTCTACATCAT
TGAGGTCAATGCTCGTCTCTCCAGAAGTTCAGCTCTTGCTTCCAAAGCAA
CTGGATACCCATTGGCTTACGTTGCTGCTAAACTTGCACTTGGTATTCCT
CTACCAAAACTGAGAAATTCTGTCACCAATTCAACTACCGCTTGTTTTGA
GCCCTCTTTGGATTATTGTGTTGTGAAAGTTCCTCGATGGGATCTGGACA
AATTTCAGAGGGTTTCAACAAAGGTTTGTAATATGGAAAACTTTGACCCT
TTGGGAATCCATACGGGTGAATCAATTGTTGTTGCACCAAGTCAAACACT
AACAAATGAGGAATACAATATGCTTAGAAGAACAGCCATCAAAGTCATCC
GTAAACTTGGTGTTGTTGGTGAATGTAACATCCAGTATGCTTTACACCCT
GACTCAAAAGAGGCTATCACAGCAGCTAACAGGCTAGGATATCCAGTGTT
GTTACGTGCAGCATTTGCACTAGGTGGACTTGGATCTGGTTTTGCTTCCA
ATGACAATGAGCTCAAAAAGCTTGCAGCATCGGCTTTTGCACATTCCAAA
CAGTGTCTAGTTGACAAGTCACTGAAAGGATGGAAAGAAGTTGAATATGA
AGTTGTTAGAGATGCTTATGACAACTGTATCACTGTGATTGAAGTAGAAA
GACCAGATGGCATTCTGTTATCATTTGGTGGACAAACAGCATTGAACTGT
GGACTGCTATTGAAAGAGAGGGGAATTTTAGAGAAATACAATGTTGCTGT
TCTTGGTACACCTACCAAATCGATTGAATGGACAGAAGATAGGAAAATGT
TTTCAGACAAGATGGGAGAGATTGGTGAGAAAGTTGCACCAAGCTCAGTG
GCTTATACTGTGGATGAGTCAAACCAAAGAAGGTCTTGATTTTGGGATCT
GGTGGCTTATCTATTGGTCAAGCCGGAGAATTTGATTATTCTGGCTCTCA
AGCTATCAAAGCATTAAAAGAAGAGAAGATTCACACAGTTTTGATCAATC
CTAATATTGCTACAGTGCAAACTTCCAAAGGACTTGCAGATAAAACTTAC
TTCCTTCCTGTTAACTTTGAATTCACAAGCAAGATATGGTAACAGAGGAC
ATAACCAACCTGCAACCCATTTGGAAACTCAACGTTGCTTCATCACTTGC
CAAAATCATGGCTTTGCAATTGACACAGACAGCTTACCAAAAGAATGGTC
TGTTTTGTTTACAAATGAGAATGATGGCAGTAATGAAGGCATTGTTCACA
ACACAAAGCCAATCTTCTCAGTTCAGTTTCATCCTGAACATCAAGGAGGA
CCAAGAGATTTGGAGCTTTTGTTTGGCTTTTTTGTGGATATTGTAAACAA
ACTGAAAATCGATTCTAACCTCTGCTTACGAACCATGCTGAAAGAAACGT
TGACTTTCCACCCAGCAGAAGAAACAAGATCCAGAGCATAATATGATGGT
CTGTTTATGAGCAATGGTCCTGGAGATCCTAGCCTTTGTCAAGTTTCAAT
TGACACCCTCCGTAAAGTCATTACAGAATTGCCAGATGTGCCAGTCTTTG
GTATTTGCATGGGTCATCAGATCTTATCTCTTGCTGCTGGATGTGGGTCC
TACAAAATGAAGAACCTAAACTTTACAATCCTAAGGGTAAAATAAAGATG
ATTGCTGTAGACTTTGGTATCAAATACAACCAGATCCGGTGTTTGATTGA
TTGTGATTGTCAGGTTCTAGTTGTTCCATGGGATTATGACTATAGTACAT
TGTTAAAGAACAAAGATTGTTTTGGATGGAGAGGATGAAGCAAGTGTTCC
ATTTGATGATCCAAACAAAAGGAATTTGATTGCTGAAGTCTCTTGCAAGG
TATTGATACCAGAGCATTAACAAAGAAGTTGAGAGAAAATGGAACAATGT
TAGGAAAGTCTTCCAAACTGGTATGGTTGGTTACCCAGAATCATTGACAG
ATCCTTCATACAACAGTCAAATCTTGGTATTGACGTATCCACTGATTGGT
AATTATGGTATACCAAACGATTCTCGTGATGAACATGGCATGCTCAAATT
TTTTGAATCTGAAAAGATTTGGAACAATGGTATGATTGTAGGAGACTTGA
CTGAGGACTACAGCCATTGGTTGGCAACCAAATCACTTTCAGAGTGGCTG
AAGGAACACAAAATACCTGGAATTACTGATGGCGACACTTATTCTTGATG
ATGGCACCAAATATCATGGTCAAATTTTTGGTGATGAAAGAAGTATTGCA
GGAGAAGTTGTTGGCCATTAAGAACGCTCGCTGTGATTTCGCCTTGTACG
CTGGTGCCAGTTCAACCAATGCTCTAATGTTGCCAAAGATTGCACCAGGA
TGTGCTGGTCTCAAAATGTACCTCAACGATACTTACACTACCTTGAAGAT
GGACAACCTCNAAGATTGCACCAGGTTGTGCTGGTCTCAAAATGTACCTC
AACGATACTTACACTACCTTGAAGATGGACAACCTCTCTGAGCATTGTTC
AAAGTGGGCAGCAAGATCGAAGTGAAAACACACATTGATTGCATTTCATC
GGGAAACATTGTGCGATTGCCAGGTCTCATTGATGTCCACGTACACTTGC
GACAACCTGGTGCCGAGTACAAAGAAGATTTCGATAGCGGTACTGCAGCC
GCACTGGCCGGTGGCGTCACCATGGTGCTGTGTATGCCGAACACCAAGCC
AGCTGTGGTGGATCAACCCACTTTCCAGCTTGCGCACCAAGTCCAAATCA
TTGATTGGCCTTTCGAGGAGAATGGAACTGAGGGTCAGGAAGAGAGCATT
CAAGACTACCTCACACAGAACAAATTTGATTTGGTCATCAACATTCCAAT
GAGGGGTAGTGGTACCAAGAAGAAGTCTCATTTCATCACACATGGATATC
GCACCCGACGAATGGCCATCGATCATTCCGTCTCATTGATCACCAACATT
AAGTGTGCCAAACTCTTCTGTGAAGCGAAGAAAGAAATGTTGCCAAGTGT
TCGTTTACTGGAGAAGATGGGATACGAATTGTATGCTAGCATGGGTACCG
GTGACTTCTATCAAGAACATGGTGTACAGGTGCCACAATTTTCATTTTCA
CGACTTGCTGGAGCTGACGTTCAACTTGGAGTAGAGATGGCAAGCACAGG
AGAAGTAGCATGCTTCGGTGAAAATAGATACGAAGCTTACTTGAAGGCCT
TGATGAGCACAGGTTTCAAATTACCCAAGAAAAACATACTGCTGACTGTT
GGTAGTTATAAGGACAATCAATTGAAGGTGATCGAATGCAATTTACGGGT
GTCTCGGTCCTTCCCTTTTGTTTCCAAAACTCTAGATTGTGATTTGGTTG
CCTTGGCAACCAAAATCATCGTTGGTGCTCCTGCTGAACCTGCATTCAAC
ATTATGGATAAGTGTGAGAAGATCGGCTGTAAGGAAATTGACGTTGATGC
CGTTGCCAACGACGGTGAAGTGATGGCCATGGTCGTCTCTGAACACGTTG
AAAACGCGGGTGTCCACTCTGGTGACGCAACCATGATCTGTCCACCACAA
GACATCAATACGGAAACCATGGGACGGATCAAACAGATCTGTATTGCAGT
TGGAAACGCCCTCAATGTGTCTGGTCCTTTCAATATGCAACTTATTGCTA
AGGAAGCCTATCAATTCTGCACCAAAGTTGGTTACCCAGTGCTGGTACGA
CCTTCATACGTGTTGAGTGGAGCTGCCATGAATGTTGTTTATGCTGAAGA
TGATTTAGAATCATATCTTGGATCTGCTGTCTCCATCTCTAAGGAGCATC
CAGTTGTCATCTCCAAATTTATATCCAATGCTAAAATGGAAAGAGTTGAC
CACGATGGAGGTGAGGATCCTTGGCACATCGCCAGAAATGATTGACAACG
CTGAAAACAGATTCAAATTCTCTCGTATGCTAGACAACATTGGAATCCTA
CAACCAACACAATCATGGATATCTACCATAAAGAAGACCCAGAAGGTATT
ATCTTATCAATGGGAGGACAGGTTGCCAACAACATTGCTATGCATCTCCA
CAGACAGGAACTTGGTAAGAGCACAATTATGGTGAATTACAATCCTGAAA
CTGTCAGTACAGACTATGATGAATGTGATCGATTGTACTTCGATGAAATC
ACATTTGAGTTCTGAACTGGTTATCCGCAAGTACCGTTATGAATGCAACA
TTTTGCCCTGTTTCAAGCAAATTGACACTGTTGCTGCAGAATTCCCAGCT
GAAGCTAACTATCTGTATTTAACTTACAATGGAGATTGTGATGACGTCAC
ATACGCAGAAAGCCAAAACAAAGTCATGGTTATTGGGTCAGGTGTCTACA
GAATCGGAAGCAGTGTTGAATTTGATGCATGTGCTGTTGGATGTATTCGA
GAATTGAAGAGGGTTGGAGCTGGAAAGGACACCATTCCATGCAATATCCT
ACTGAAGGGGAAGCAGCTTGGATTTTCAGATAAGCAAATTGCTAACTGCG
TTCAAAGGTCTTAGTTGAGCCCTCTGACAAAAGAATCTTTCATGTTGCTG
CTGCACTCCGTAGAGGATATTCTATTGATCAGCTGTATGAGCTCACTCGT
ATTGATAAGTGGTTTTTGAGCAAGCTAGCAAAAATAATCAACTATGCAAA
AATGCTGGAAGAGAAATACCCAAAGATTGGATCTTCGATGAAGAGTGTTG
GTGAAGTAATGGCTATTGGAAGAAGTTTTGAGGAAGCCATTCAAAAGAGT
TTGAGAATGGTTGACGATTCAAACCTTGGTTTTGATGCAAACAACCTCGA
GTTGGATGAACAGTTCTACATCATTGAGGTCAATGCTCGTCTCTCCAGAA
GTTCAGCTCTTGCTTCCAAAGCAACTGGATACCCATTGGCTTACGTTGCT
GCTAAACTTGCACTTGGTATTCCTCTACCAAAACTGAGAAATTCTGTCAC
CAATTCAACTACCGCTTGTTTTGAGCCCTCTTTGGATTATTGTGTTGTGA
AAGTTCCTCGATGGGATCTGGACAAATTTCAGAGGGTTTCAACAAAGGTT
TGTAATATGGAAAACTTTGACCCTTTGGGAATCCATACGGGTGAATCAAT
TGTTGTTGCACCAAGTCAAACACTAACAAATGAGGAATACAATATGCTTA
GAAGAACAGCCATCAAAGTCATCCGTAAACTTGGTGTTGTTGGTGAATGT
AACATCCAGTATGCTTTACACCCTGACTCAAAAGAGGCTATCACAGCAGC
TAACAGGCTAGGATATCCAGTGTTGTTACGTGCAGCATTTGCACTAGGTG
GACTTGGATCTGGTTTTGCTTCCAATGACAATGAGCTCAAAAAGCTTGCA
GCATCGGCTTTTGCACATTCCAAACAGTGTCTAGTTGACAAGTCACTGAA
AGGATGGAAAGAAGTTGAATATGAAGTTGTTAGAGATGCTTATGACAACT
GTATCACTGTGATTGAAGTAGAAAGACCAGATGGCATTCTGTTATCATTT
GGTGGACAAACAGCATTGAACTGTGGACTGCTATTGAAAGAGAGGGGAAT
TTTAGAGAAATACAATGTTGCTGTTCTTGGTACACCTACCAAATCGATTG
AATGGACAGAAGATAGGAAAATGTTTTCAGACAAGATGGGAGAGATTGGT
GAGAAAGTTGCACCAAGCTCAGTGGCTTATACTGTGGATGAGTCAAACCA
AAGAAGGTCTTGATTTTGGGATCTGGTGGCTTATCTATTGGTCAAGCCGG
AGAATTTGATTATTCTGGCTCTCAAGCTATCAAAGCATTAAAAGAAGAGA
AGATTCACACAGTTTTGATCAATCCTAATATTGCTACAGTGCAAACTTCC
AAAGGACTTGCAGATAAAACTTACTTCCTTCCTGTTAACTTTGAATTCAC
AAGCAAGATATGGTAACAGAGGACATAACCAACCTGCAACCCATTTGGAA
ACTCAACGTTGCTTCATCACTTGCCAAAATCATGGCTTTGCAATTGACAC
AGACAGCTTACCAAAAGAATGGTCTGTTTTGTTTACAAATGAGAATGATG
GCAGTAATGAAGGCATTGTTCACAACACAAAGCCAATCTTCTCAGTTCAG
TTTCATCCTGAACATCAAGGAGGACCAAGAGATTTGGAGCTTTTGTTTGG
CTTTTTTGTGGATATTGTAAACAAACTGAAAATCGATTCTAACCTCTGCT
TACGAACCATGCTGAAAGAAACGTTGACTTTCCACCCAGCAGAAGAAACA
AGATCCAGAGCATAATATGATGGTCTGTTTATGAGCAATGGTCCTGGAGA
TCCTAGCCTTTGTCAAGTTTCAATTGACACCCTCCGTAAAGTCATTACAG
AATTGCCAGATGTGCCAGTCTTTGGTATTTGCATGGGTCATCAGATCTTA
TCTCTTGCTGCTGGATGTGGGTCCTACAAAATGAAGAACCTAAACTTTAC
AATCCTAAGGGTAAAATAAAGATGATTGCTGTAGACTTTGGTATCAAATA
CAACCAGATCCGGTGTTTGATTGATTGTGATTGTCAGGTTCTAGTTGTTC
CATGGGATTATGACTATAGTACATTGTTAAAGAACAAAGATTGTTTTGGA
TGGAGAGGATGAAGCAAGTGTTCCATTTGATGATCCAAACAAAAGGAATT
TGATTGCTGAAGTCTCTTGCAAGGTATTGATACCAGAGCATTAACAAAGA
AGTTGAGAGAAAATGGAACAATGTTAGGAAAGTCTTCCAAACTGGTATGG
TTGGTTACCCAGAATCATTGACAGATCCTTCATACAACAGTCAAATCTTG
GTATTGACGTATCCACTGATTGGTAATTATGGTATACCAAACGATTCTCG
TGATGAACATGGCATGCTCAAATTTTTTGAATCTGAAAAGATTTGGAACA
ATGGTATGATTGTAGGAGACTTGACTGAGGACTACAGCCATTGGTTGGCA
ACCAAATCACTTTCAGAGTGGCTGAAGGAACACAAAATACCTGGAATTAC
TGATGGCGACACTTATTCTTGATGATGGCACCAAATATCATGGTCAAATT
TTTGGTGATGAAAGAAGTATTGCAGGAGAAGTTGTTGGCCATTAAGAACG
CTCGCTGTGATTTCGCCTTGTACGCTGGTGCCAGTTCAACCAATGCTCTA
ATGTTGCCAAAGATTGCACCAGGATGTGCTGGTCTCAAAATGTACCTCAA
CGATACTTACACTACCTTGAAGATGGACAACCTCNAAGATTGCACCAGGT
TGTGCTGGTCTCAAAATGTACCTCAACGATACTTACACTACCTTGAAGAT
GGACAACCTCTCTGAGCATTGTTCAAAGTGGGCAGCAAGATCGAAGTGAA
AACACACATTGATTGCATTTCATCGGGAAACATTGTGCGATTGCCAGGTC
TCATTGATGTCCACGTACACTTGCGACAACCTGGTGCCGAGTACAAAGAA
GATTTCGATAGCGGTACTGCAGCCGCACTGGCCGGTGGCGTCACCATGGT
GCTGTGTATGCCGAACACCAAGCCAGCTGTGGTGGATCAACCCACTTTCC
AGCTTGCGCACCAAGTCCAAATCATTGATTGGCCTTTCGAGGAGAATGGA
ACTGAGGGTCAGGAAGAGAGCATTCAAGACTACCTCACACAGAACAAATT
TGATTTGGTCATCAACATTCCAATGAGGGGTAGTGGTACCAAGAAGAAGT
CTCATTTCATCACACATGGATATCGCACCCGACGAATGGCCATCGATCAT
TCCGTCTCATTGATCACCAACATTAAGTGTGCCAAACTCTTCTGTGAAGC
GAAGAAAGAAATGTTGCCAAGTGTTCGTTTACTGGAGAAGATGGGATACG
AATTGTATGCTAGCATGGGTACCGGTGACTTCTATCAAGAACATGGTGTA
CAGGTGCCACAATTTTCATTTTCACGACTTGCTGGAGCTGACGTTCAACT
TGGAGTAGAGATGGCAAGCACAGGAGAAGTAGCATGCTTCGGTGAAAATA
GATACGAAGCTTACTTGAAGGCCTTGATGAGCACAGGTTTCAAATTACCC
AAGAAAAACATACTGCTGACTGTTGGTAGTTATAAGGACAATCAATTGAA
GGTGATCGAATGCAATTTACGGGTGTCTCGGTCCTTCCCTTTTGTTTCCA
AAACTCTAGATTGTGATTTGGTTGCCTTGGCAACCAAAATCATCGTTGGT
GCTCCTGCTGAACCTGCATTCAACATTATGGATAAGTGTGAGAAGATCGG
CTGTAAGGAAATTGACGTTGATGCCGTTGCCAACGACGGTGAAGTGATGG
CCATGGTCGTCTCTGAACACGTTGAAAACGCGGGTGTCCACTCTGGTGAC
GCAACCATGATCTGTCCACCACAAGACATCAATACGGAAACCATGGGACG
GATCAAACAGATCTGTATTGCAGTTGGAAACGCCCTCAATGTGTCTGGTC
CTTTCAATATGCAACTTATTGCTAAGGAAGCCTATCAATTCTGCACCAAA
GTTGGTTACCCAGTGCTGGTACGACCTTCATACGTGTTGAGTGGAGCTGC
CATGAATGTTGTTTATGCTGAAGATGATTTAGAATCATATCTTGGATCTG
CTGTCTCCATCTCTAAGGAGCATCCAGTTGTCATCTCCAAATTTATATCC
AATGCTAAAATGGAAAGAGTTGACCACGATGGAGGTGAGGATCCTTGGCA
CATCGCCAGAAATGATTGACAACGCTGAAAACAGATTCAAATTCTCTCGT
ATGCTAGACAACATTGGAATCCTACAACCAACACAATCATGGATATCTAC
CATAAAGAAGACCCAGAAGGTATTATCTTATCAATGGGAGGACAGGTTGC
CAACAACATTGCTATGCATCTCCACAGACAGGAACTTGGTAAGAGCACAA
TTATGGTGAATTACAATCCTGAAACTGTCAGTACAGACTATGATGAATGT
GATCGATTGTACTTCGATGAAATCACATTTGAGTTCTGAACTGGTTATCC
GCAAGTACCGTTATGAATGCAACATTTTGCCCTGTTTCAAGCAAATTGAC
ACTGTTGCTGCAGAATTCCCAGCTGAAGCTAACTATCTGTATTTAACTTA
CAATGGAGATTGTGATGACGTCACATACGCAGAAAGCCAAAACAAAGTCA
TGGTTATTGGGTCAGGTGTCTACAGAATCGGAAGCAGTGTTGAATTTGAT
GCATGTGCTGTTGGATGTATTCGAGAATTGAAGAGGGTTGGAGCTGGAAA
GGACACCATTCCATGCAATATCCTACTGAAGGGGAAGCAGCTTGGATTTT
CAGATAAGCAAATTGCTAACTGCGTTCAAAGGTCTTAGTTGAGCCCTCTG
ACAAAAGAATCTTTCATGTTGCTGCTGCACTCCGTAGAGGATATTCTATT
GATCAGCTGTATGAGCTCACTCGTATTGATAAGTGGTTTTTGAGCAAGCT
AGCAAAAATAATCAACTATGCAAAAATGCTGGAAGAGAAATACCCAAAGA
TTGGATCTTCGATGAAGAGTGTTGGTGAAGTAATGGCTATTGGAAGAAGT
TTTGAGGAAGCCATTCAAAAGAGTTTGAGAATGGTTGACGATTCAAACCT
TGGTTTTGATGCAAACAACCTCGAGTTGGATGAACAGTTCTACATCATTG
AGGTCAATGCTCGTCTCTCCAGAAGTTCAGCTCTTGCTTCCAAAGCAACT
GGATACCCATTGGCTTACGTTGCTGCTAAACTTGCACTTGGTATTCCTCT
ACCAAAACTGAGAAATTCTGTCACCAATTCAACTACCGCTTGTTTTGAGC
CCTCTTTGGATTATTGTGTTGTGAAAGTTCCTCGATGGGATCTGGACAAA
TTTCAGAGGGTTTCAACAAAGGTTTGTAATATGGAAAACTTTGACCCTTT
GGGAATCCATACGGGTGAATCAATTGTTGTTGCACCAAGTCAAACACTAA
CAAATGAGGAATACAATATGCTTAGAAGAACAGCCATCAAAGTCATCCGT
AAACTTGGTGTTGTTGGTGAATGTAACATCCAGTATGCTTTACACCCTGA
CTCAAAAGAGGCTATCACAGCAGCTAACAGGCTAGGATATCCAGTGTTGT
TACGTGCAGCATTTGCACTAGGTGGACTTGGATCTGGTTTTGCTTCCAAT
GACAATGAGCTCAAAAAGCTTGCAGCATCGGCTTTTGCACATTCCAAACA
GTGTCTAGTTGACAAGTCACTGAAAGGATGGAAAGAAGTTGAATATGAAG
TTGTTAGAGATGCTTATGACAACTGTATCACTGTGATTGAAGTAGAAAGA
CCAGATGGCATTCTGTTATCATTTGGTGGACAAACAGCATTGAACTGTGG
ACTGCTATTGAAAGAGAGGGGAATTTTAGAGAAATACAATGTTGCTGTTC
TTGGTACACCTACCAAATCGATTGAATGGACAGAAGATAGGAAAATGTTT
TCAGACAAGATGGGAGAGATTGGTGAGAAAGTTGCACCAAGCTCAGTGGC
TTATACTGTGGATGAGTCAAACCAAAGAAGGTCTTGATTTTGGGATCTGG
TGGCTTATCTATTGGTCAAGCCGGAGAATTTGATTATTCTGGCTCTCAAG
CTATCAAAGCATTAAAAGAAGAGAAGATTCACACAGTTTTGATCAATCCT
AATATTGCTACAGTGCAAACTTCCAAAGGACTTGCAGATAAAACTTACTT
CCTTCCTGTTAACTTTGAATTCACAAGCAAGATATGGTAACAGAGGACAT
AACCAACCTGCAACCCATTTGGAAACTCAACGTTGCTTCATCACTTGCCA
AAATCATGGCTTTGCAATTGACACAGACAGCTTACCAAAAGAATGGTCTG
TTTTGTTTACAAATGAGAATGATGGCAGTAATGAAGGCATTGTTCACAAC
ACAAAGCCAATCTTCTCAGTTCAGTTTCATCCTGAACATCAAGGAGGACC
AAGAGATTTGGAGCTTTTGTTTGGCTTTTTTGTGGATATTGTAAACAAAC
TGAAAATCGATTCTAACCTCTGCTTACGAACCATGCTGAAAGAAACGTTG
ACTTTCCACCCAGCAGAAGAAACAAGATCCAGAGCATAATATGATGGTCT
GTTTATGAGCAATGGTCCTGGAGATCCTAGCCTTTGTCAAGTTTCAATTG
ACACCCTCCGTAAAGTCATTACAGAATTGCCAGATGTGCCAGTCTTTGGT
ATTTGCATGGGTCATCAGATCTTATCTCTTGCTGCTGGATGTGGGTCCTA
CAAAATGAAGAACCTAAACTTTACAATCCTAAGGGTAAAATAAAGATGAT
TGCTGTAGACTTTGGTATCAAATACAACCAGATCCGGTGTTTGATTGATT
GTGATTGTCAGGTTCTAGTTGTTCCATGGGATTATGACTATAGTACATTG
TTAAAGAACAAAGATTGTTTTGGATGGAGAGGATGAAGCAAGTGTTCCAT
TTGATGATCCAAACAAAAGGAATTTGATTGCTGAAGTCTCTTGCAAGGTA
TTGATACCAGAGCATTAACAAAGAAGTTGAGAGAAAATGGAACAATGTTA
GGAAAGTCTTCCAAACTGGTATGGTTGGTTACCCAGAATCATTGACAGAT
CCTTCATACAACAGTCAAATCTTGGTATTGACGTATCCACTGATTGGTAA
TTATGGTATACCAAACGATTCTCGTGATGAACATGGCATGCTCAAATTTT
TTGAATCTGAAAAGATTTGGAACAATGGTATGATTGTAGGAGACTTGACT
GAGGACTACAGCCATTGGTTGGCAACCAAATCACTTTCAGAGTGGCTGAA
GGAACACAAAATACCTGGAATTACTGATGGCGACACTTATTCTTGATGAT
GGCACCAAATATCATGGTCAAATTTTTGGTGATGAAAGAAGTATTGCAGG
AGAAGTTGTTGGCCATTAAGAACGCTCGCTGTGATTTCGCCTTGTACGCT
GGTGCCAGTTCAACCAATGCTCTAATGTTGCCAAAGATTGCACCAGGATG
TGCTGGTCTCAAAATGTACCTCAACGATACTTACACTACCTTGAAGATGG
ACAACCTCNAAGATTGCACCAGGTTGTGCTGGTCTCAAAATGTACCTCAA
CGATACTTACACTACCTTGAAGATGGACAACCTCTCTGAGCATTGTTCAA
AGTGGGCAGCAAGATCGAAGTGAAAACACACATTGATTGCATTTCATCGG
GAAACATTGTGCGATTGCCAGGTCTCATTGATGTCCACGTACACTTGCGA
CAACCTGGTGCCGAGTACAAAGAAGATTTCGATAGCGGTACTGCAGCCGC
ACTGGCCGGTGGCGTCACCATGGTGCTGTGTATGCCGAACACCAAGCCAG
CTGTGGTGGATCAACCCACTTTCCAGCTTGCGCACCAAGTCCAAATCATT
GATTGGCCTTTCGAGGAGAATGGAACTGAGGGTCAGGAAGAGAGCATTCA
AGACTACCTCACACAGAACAAATTTGATTTGGTCATCAACATTCCAATGA
GGGGTAGTGGTACCAAGAAGAAGTCTCATTTCATCACACATGGATATCGC
ACCCGACGAATGGCCATCGATCATTCCGTCTCATTGATCACCAACATTAA
GTGTGCCAAACTCTTCTGTGAAGCGAAGAAAGAAATGTTGCCAAGTGTTC
GTTTACTGGAGAAGATGGGATACGAATTGTATGCTAGCATGGGTACCGGT
GACTTCTATCAAGAACATGGTGTACAGGTGCCACAATTTTCATTTTCACG
ACTTGCTGGAGCTGACGTTCAACTTGGAGTAGAGATGGCAAGCACAGGAG
AAGTAGCATGCTTCGGTGAAAATAGATACGAAGCTTACTTGAAGGCCTTG
ATGAGCACAGGTTTCAAATTACCCAAGAAAAACATACTGCTGACTGTTGG
TAGTTATAAGGACAATCAATTGAAGGTGATCGAATGCAATTTACGGGTGT
CTCGGTCCTTCCCTTTTGTTTCCAAAACTCTAGATTGTGATTTGGTTGCC
TTGGCAACCAAAATCATCGTTGGTGCTCCTGCTGAACCTGCATTCAACAT
TATGGATAAGTGTGAGAAGATCGGCTGTAAGGAAATTGACGTTGATGCCG
TTGCCAACGACGGTGAAGTGATGGCCATGGTCGTCTCTGAACACGTTGAA
AACGCGGGTGTCCACTCTGGTGACGCAACCATGATCTGTCCACCACAAGA
CATCAATACGGAAACCATGGGACGGATCAAACAGATCTGTATTGCAGTTG
GAAACGCCCTCAATGTGTCTGGTCCTTTCAATATGCAACTTATTGCTAAG
GAAGCCTATCAATTCTGCACCAAAGTTGGTTACCCAGTGCTGGTACGACC
TTCATACGTGTTGAGTGGAGCTGCCATGAATGTTGTTTATGCTGAAGATG
ATTTAGAATCATATCTTGGATCTGCTGTCTCCATCTCTAAGGAGCATCCA
GTTGTCATCTCCAAATTTATATCCAATGCTAAAATGGAAAGAGTTGACCA
CGATGGAGGTGAGGATCCTTGGCACATCGCCAGAAATGATTGACAACGCT
GAAAACAGATTCAAATTCTCTCGTATGCTAGACAACATTGGAATCCTACA
ACCAACACAATCATGGATATCTACCATAAAGAAGACCCAGAAGGTATTAT
CTTATCAATGGGAGGACAGGTTGCCAACAACATTGCTATGCATCTCCACA
GACAGGAACTTGGTAAGAGCACAATTATGGTGAATTACAATCCTGAAACT
GTCAGTACAGACTATGATGAATGTGATCGATTGTACTTCGATGAAATCAC
ATTTGAGTTCTGAACTGGTTATCCGCAAGTACCGTTATGAATGCAACATT
TTGCCCTGTTTCAAGCAAATTGACACTGTTGCTGCAGAATTCCCAGCTGA
AGCTAACTATCTGTATTTAACTTACAATGGAGATTGTGATGACGTCACAT
ACGCAGAAAGCCAAAACAAAGTCATGGTTATTGGGTCAGGTGTCTACAGA
ATCGGAAGCAGTGTTGAATTTGATGCATGTGCTGTTGGATGTATTCGAGA
ATTGAAGAGGGTTGGAGCTGGAAAGGACACCATTCCATGCAATATCCTAC
TGAAGGGGAAGCAGCTTGGATTTTCAGATAAGCAAATTGCTAACTGCGTT
CAAAGGTCTTAGTTGAGCCCTCTGACAAAAGAATCTTTCATGTTGCTGCT
GCACTCCGTAGAGGATATTCTATTGATCAGCTGTATGAGCTCACTCGTAT
TGATAAGTGGTTTTTGAGCAAGCTAGCAAAAATAATCAACTATGCAAAAA
TGCTGGAAGAGAAATACCCAAAGATTGGATCTTCGATGAAGAGTGTTGGT
GAAGTAATGGCTATTGGAAGAAGTTTTGAGGAAGCCATTCAAAAGAGTTT
GAGAATGGTTGACGATTCAAACCTTGGTTTTGATGCAAACAACCTCGAGT
TGGATGAACAGTTCTACATCATTGAGGTCAATGCTCGTCTCTCCAGAAGT
TCAGCTCTTGCTTCCAAAGCAACTGGATACCCATTGGCTTACGTTGCTGC
TAAACTTGCACTTGGTATTCCTCTACCAAAACTGAGAAATTCTGTCACCA
ATTCAACTACCGCTTGTTTTGAGCCCTCTTTGGATTATTGTGTTGTGAAA
GTTCCTCGATGGGATCTGGACAAATTTCAGAGGGTTTCAACAAAGGTTTG
TAATATGGAAAACTTTGACCCTTTGGGAATCCATACGGGTGAATCAATTG
TTGTTGCACCAAGTCAAACACTAACAAATGAGGAATACAATATGCTTAGA
AGAACAGCCATCAAAGTCATCCGTAAACTTGGTGTTGTTGGTGAATGTAA
CATCCAGTATGCTTTACACCCTGACTCAAAAGAGGCTATCACAGCAGCTA
ACAGGCTAGGATATCCAGTGTTGTTACGTGCAGCATTTGCACTAGGTGGA
CTTGGATCTGGTTTTGCTTCCAATGACAATGAGCTCAAAAAGCTTGCAGC
ATCGGCTTTTGCACATTCCAAACAGTGTCTAGTTGACAAGTCACTGAAAG
GATGGAAAGAAGTTGAATATGAAGTTGTTAGAGATGCTTATGACAACTGT
ATCACTGTGATTGAAGTAGAAAGACCAGATGGCATTCTGTTATCATTTGG
TGGACAAACAGCATTGAACTGTGGACTGCTATTGAAAGAGAGGGGAATTT
TAGAGAAATACAATGTTGCTGTTCTTGGTACACCTACCAAATCGATTGAA
TGGACAGAAGATAGGAAAATGTTTTCAGACAAGATGGGAGAGATTGGTGA
GAAAGTTGCACCAAGCTCAGTGGCTTATACTGTGGATGAGTCAAACCAAA
GAAGGTCTTGATTTTGGGATCTGGTGGCTTATCTATTGGTCAAGCCGGAG
AATTTGATTATTCTGGCTCTCAAGCTATCAAAGCATTAAAAGAAGAGAAG
ATTCACACAGTTTTGATCAATCCTAATATTGCTACAGTGCAAACTTCCAA
AGGACTTGCAGATAAAACTTACTTCCTTCCTGTTAACTTTGAATTCACAA
GCAAGATATGGTAACAGAGGACATAACCAACCTGCAACCCATTTGGAAAC
TCAACGTTGCTTCATCACTTGCCAAAATCATGGCTTTGCAATTGACACAG
ACAGCTTACCAAAAGAATGGTCTGTTTTGTTTACAAATGAGAATGATGGC
AGTAATGAAGGCATTGTTCACAACACAAAGCCAATCTTCTCAGTTCAGTT
TCATCCTGAACATCAAGGAGGACCAAGAGATTTGGAGCTTTTGTTTGGCT
TTTTTGTGGATATTGTAAACAAACTGAAAATCGATTCTAACCTCTGCTTA
CGAACCATGCTGAAAGAAACGTTGACTTTCCACCCAGCAGAAGAAACAAG
ATCCAGAGCATAATATGATGGTCTGTTTATGAGCAATGGTCCTGGAGATC
CTAGCCTTTGTCAAGTTTCAATTGACACCCTCCGTAAAGTCATTACAGAA
TTGCCAGATGTGCCAGTCTTTGGTATTTGCATGGGTCATCAGATCTTATC
TCTTGCTGCTGGATGTGGGTCCTACAAAATGAAGAACCTAAACTTTACAA
TCCTAAGGGTAAAATAAAGATGATTGCTGTAGACTTTGGTATCAAATACA
ACCAGATCCGGTGTTTGATTGATTGTGATTGTCAGGTTCTAGTTGTTCCA
TGGGATTATGACTATAGTACATTGTTAAAGAACAAAGATTGTTTTGGATG
GAGAGGATGAAGCAAGTGTTCCATTTGATGATCCAAACAAAAGGAATTTG
ATTGCTGAAGTCTCTTGCAAGGTATTGATACCAGAGCATTAACAAAGAAG
TTGAGAGAAAATGGAACAATGTTAGGAAAGTCTTCCAAACTGGTATGGTT
GGTTACCCAGAATCATTGACAGATCCTTCATACAACAGTCAAATCTTGGT
ATTGACGTATCCACTGATTGGTAATTATGGTATACCAAACGATTCTCGTG
ATGAACATGGCATGCTCAAATTTTTTGAATCTGAAAAGATTTGGAACAAT
GGTATGATTGTAGGAGACTTGACTGAGGACTACAGCCATTGGTTGGCAAC
CAAATCACTTTCAGAGTGGCTGAAGGAACACAAAATACCTGGAATTACTG
ATGGCGACACTTATTCTTGATGATGGCACCAAATATCATGGTCAAATTTT
TGGTGATGAAAGAAGTATTGCAGGAGAAGTTGTTGGCCATTAAGAACGCT
CGCTGTGATTTCGCCTTGTACGCTGGTGCCAGTTCAACCAATGCTCTAAT
GTTGCCAAAGATTGCACCAGGATGTGCTGGTCTCAAAATGTACCTCAACG
ATACTTACACTACCTTGAAGATGGACAACCTCNAAGATTGCACCAGGTTG
TGCTGGTCTCAAAATGTACCTCAACGATACTTACACTACCTTGAAGATGG
ACAACCTCTCTGAGCATTGTTCAAAGTGGGCAGCAAGATCGAAGTGAAAA
CACACATTGATTGCATTTCATCGGGAAACATTGTGCGATTGCCAGGTCTC
ATTGATGTCCACGTACACTTGCGACAACCTGGTGCCGAGTACAAAGAAGA
TTTCGATAGCGGTACTGCAGCCGCACTGGCCGGTGGCGTCACCATGGTGC
TGTGTATGCCGAACACCAAGCCAGCTGTGGTGGATCAACCCACTTTCCAG
CTTGCGCACCAAGTCCAAATCATTGATTGGCCTTTCGAGGAGAATGGAAC
TGAGGGTCAGGAAGAGAGCATTCAAGACTACCTCACACAGAACAAATTTG
ATTTGGTCATCAACATTCCAATGAGGGGTAGTGGTACCAAGAAGAAGTCT
CATTTCATCACACATGGATATCGCACCCGACGAATGGCCATCGATCATTC
CGTCTCATTGATCACCAACATTAAGTGTGCCAAACTCTTCTGTGAAGCGA
AGAAAGAAATGTTGCCAAGTGTTCGTTTACTGGAGAAGATGGGATACGAA
TTGTATGCTAGCATGGGTACCGGTGACTTCTATCAAGAACATGGTGTACA
GGTGCCACAATTTTCATTTTCACGACTTGCTGGAGCTGACGTTCAACTTG
GAGTAGAGATGGCAAGCACAGGAGAAGTAGCATGCTTCGGTGAAAATAGA
TACGAAGCTTACTTGAAGGCCTTGATGAGCACAGGTTTCAAATTACCCAA
GAAAAACATACTGCTGACTGTTGGTAGTTATAAGGACAATCAATTGAAGG
TGATCGAATGCAATTTACGGGTGTCTCGGTCCTTCCCTTTTGTTTCCAAA
ACTCTAGATTGTGATTTGGTTGCCTTGGCAACCAAAATCATCGTTGGTGC
TCCTGCTGAACCTGCATTCAACATTATGGATAAGTGTGAGAAGATCGGCT
GTAAGGAAATTGACGTTGATGCCGTTGCCAACGACGGTGAAGTGATGGCC
ATGGTCGTCTCTGAACACGTTGAAAACGCGGGTGTCCACTCTGGTGACGC
AACCATGATCTGTCCACCACAAGACATCAATACGGAAACCATGGGACGGA
TCAAACAGATCTGTATTGCAGTTGGAAACGCCCTCAATGTGTCTGGTCCT
TTCAATATGCAACTTATTGCTAAGGAAGCCTATCAATTCTGCACCAAAGT
TGGTTACCCAGTGCTGGTACGACCTTCATACGTGTTGAGTGGAGCTGCCA
TGAATGTTGTTTATGCTGAAGATGATTTAGAATCATATCTTGGATCTGCT
GTCTCCATCTCTAAGGAGCATCCAGTTGTCATCTCCAAATTTATATCCAA
TGCTAAAATGGAAAGAGTTGACCACGATGGAGGTGAGGATCCTTGGCACA
TCGCCAGAAATGATTGACAACGCTGAAAACAGATTCAAATTCTCTCGTAT
GCTAGACAACATTGGAATCCTACAACCAACACAATCATGGATATCTACCA
TAAAGAAGACCCAGAAGGTATTATCTTATCAATGGGAGGACAGGTTGCCA
ACAACATTGCTATGCATCTCCACAGACAGGAACTTGGTAAGAGCACAATT
ATGGTGAATTACAATCCTGAAACTGTCAGTACAGACTATGATGAATGTGA
TCGATTGTACTTCGATGAAATCACATTTGAGTTCTGAACTGGTTATCCGC
AAGTACCGTTATGAATGCAACATTTTGCCCTGTTTCAAGCAAATTGACAC
TGTTGCTGCAGAATTCCCAGCTGAAGCTAACTATCTGTATTTAACTTACA
ATGGAGATTGTGATGACGTCACATACGCAGAAAGCCAAAACAAAGTCATG
GTTATTGGGTCAGGTGTCTACAGAATCGGAAGCAGTGTTGAATTTGATGC
ATGTGCTGTTGGATGTATTCGAGAATTGAAGAGGGTTGGAGCTGGAAAGG
ACACCATTCCATGCAATATCCTACTGAAGGGGAAGCAGCTTGGATTTTCA
GATAAGCAAATTGCTAACTGCGTTCAAAGGTCTTAGTTGAGCCCTCTGAC
AAAAGAATCTTTCATGTTGCTGCTGCACTCCGTAGAGGATATTCTATTGA
TCAGCTGTATGAGCTCACTCGTATTGATAAGTGGTTTTTGAGCAAGCTAG
CAAAAATAATCAACTATGCAAAAATGCTGGAAGAGAAATACCCAAAGATT
GGATCTTCGATGAAGAGTGTTGGTGAAGTAATGGCTATTGGAAGAAGTTT
TGAGGAAGCCATTCAAAAGAGTTTGAGAATGGTTGACGATTCAAACCTTG
GTTTTGATGCAAACAACCTCGAGTTGGATGAACAGTTCTACATCATTGAG
GTCAATGCTCGTCTCTCCAGAAGTTCAGCTCTTGCTTCCAAAGCAACTGG
ATACCCATTGGCTTACGTTGCTGCTAAACTTGCACTTGGTATTCCTCTAC
CAAAACTGAGAAATTCTGTCACCAATTCAACTACCGCTTGTTTTGAGCCC
TCTTTGGATTATTGTGTTGTGAAAGTTCCTCGATGGGATCTGGACAAATT
TCAGAGGGTTTCAACAAAGGTTTGTAATATGGAAAACTTTGACCCTTTGG
GAATCCATACGGGTGAATCAATTGTTGTTGCACCAAGTCAAACACTAACA
AATGAGGAATACAATATGCTTAGAAGAACAGCCATCAAAGTCATCCGTAA
ACTTGGTGTTGTTGGTGAATGTAACATCCAGTATGCTTTACACCCTGACT
CAAAAGAGGCTATCACAGCAGCTAACAGGCTAGGATATCCAGTGTTGTTA
CGTGCAGCATTTGCACTAGGTGGACTTGGATCTGGTTTTGCTTCCAATGA
CAATGAGCTCAAAAAGCTTGCAGCATCGGCTTTTGCACATTCCAAACAGT
GTCTAGTTGACAAGTCACTGAAAGGATGGAAAGAAGTTGAATATGAAGTT
GTTAGAGATGCTTATGACAACTGTATCACTGTGATTGAAGTAGAAAGACC
AGATGGCATTCTGTTATCATTTGGTGGACAAACAGCATTGAACTGTGGAC
TGCTATTGAAAGAGAGGGGAATTTTAGAGAAATACAATGTTGCTGTTCTT
GGTACACCTACCAAATCGATTGAATGGACAGAAGATAGGAAAATGTTTTC
AGACAAGATGGGAGAGATTGGTGAGAAAGTTGCACCAAGCTCAGTGGCTT
ATACTGTGGATGAGTCAAACCAAAGAAGGTCTTGATTTTGGGATCTGGTG
GCTTATCTATTGGTCAAGCCGGAGAATTTGATTATTCTGGCTCTCAAGCT
ATCAAAGCATTAAAAGAAGAGAAGATTCACACAGTTTTGATCAATCCTAA
TATTGCTACAGTGCAAACTTCCAAAGGACTTGCAGATAAAACTTACTTCC
TTCCTGTTAACTTTGAATTCACAAGCAAGATATGGTAACAGAGGACATAA
CCAACCTGCAACCCATTTGGAAACTCAACGTTGCTTCATCACTTGCCAAA
ATCATGGCTTTGCAATTGACACAGACAGCTTACCAAAAGAATGGTCTGTT
TTGTTTACAAATGAGAATGATGGCAGTAATGAAGGCATTGTTCACAACAC
AAAGCCAATCTTCTCAGTTCAGTTTCATCCTGAACATCAAGGAGGACCAA
GAGATTTGGAGCTTTTGTTTGGCTTTTTTGTGGATATTGTAAACAAACTG
AAAATCGATTCTAACCTCTGCTTACGAACCATGCTGAAAGAAACGTTGAC
TTTCCACCCAGCAGAAGAAACAAGATCCAGAGCATAATATGATGGTCTGT
TTATGAGCAATGGTCCTGGAGATCCTAGCCTTTGTCAAGTTTCAATTGAC
ACCCTCCGTAAAGTCATTACAGAATTGCCAGATGTGCCAGTCTTTGGTAT
TTGCATGGGTCATCAGATCTTATCTCTTGCTGCTGGATGTGGGTCCTACA
AAATGAAGAACCTAAACTTTACAATCCTAAGGGTAAAATAAAGATGATTG
CTGTAGACTTTGGTATCAAATACAACCAGATCCGGTGTTTGATTGATTGT
GATTGTCAGGTTCTAGTTGTTCCATGGGATTATGACTATAGTACATTGTT
AAAGAACAAAGATTGTTTTGGATGGAGAGGATGAAGCAAGTGTTCCATTT
GATGATCCAAACAAAAGGAATTTGATTGCTGAAGTCTCTTGCAAGGTATT
GATACCAGAGCATTAACAAAGAAGTTGAGAGAAAATGGAACAATGTTAGG
AAAGTCTTCCAAACTGGTATGGTTGGTTACCCAGAATCATTGACAGATCC
TTCATACAACAGTCAAATCTTGGTATTGACGTATCCACTGATTGGTAATT
ATGGTATACCAAACGATTCTCGTGATGAACATGGCATGCTCAAATTTTTT
GAATCTGAAAAGATTTGGAACAATGGTATGATTGTAGGAGACTTGACTGA
GGACTACAGCCATTGGTTGGCAACCAAATCACTTTCAGAGTGGCTGAAGG
AACACAAAATACCTGGAATTACTGATGGCGACACTTATTCTTGATGATGG
CACCAAATATCATGGTCAAATTTTTGGTGATGAAAGAAGTATTGCAGGAG
AAGTTGTTGGCCATTAAGAACGCTCGCTGTGATTTCGCCTTGTACGCTGG
TGCCAGTTCAACCAATGCTCTAATGTTGCCAAAGATTGCACCAGGATGTG
CTGGTCTCAAAATGTACCTCAACGATACTTACACTACCTTGAAGATGGAC
AACCTCNAAGATTGCACCAGGTTGTGCTGGTCTCAAAATGTACCTCAACG
ATACTTACACTACCTTGAAGATGGACAACCTCTCTGAGCATTGTTCAAAG
TGGGCAGCAAGATCGAAGTGAAAACACACATTGATTGCATTTCATCGGGA
AACATTGTGCGATTGCCAGGTCTCATTGATGTCCACGTACACTTGCGACA
ACCTGGTGCCGAGTACAAAGAAGATTTCGATAGCGGTACTGCAGCCGCAC
TGGCCGGTGGCGTCACCATGGTGCTGTGTATGCCGAACACCAAGCCAGCT
GTGGTGGATCAACCCACTTTCCAGCTTGCGCACCAAGTCCAAATCATTGA
TTGGCCTTTCGAGGAGAATGGAACTGAGGGTCAGGAAGAGAGCATTCAAG
ACTACCTCACACAGAACAAATTTGATTTGGTCATCAACATTCCAATGAGG
GGTAGTGGTACCAAGAAGAAGTCTCATTTCATCACACATGGATATCGCAC
CCGACGAATGGCCATCGATCATTCCGTCTCATTGATCACCAACATTAAGT
GTGCCAAACTCTTCTGTGAAGCGAAGAAAGAAATGTTGCCAAGTGTTCGT
TTACTGGAGAAGATGGGATACGAATTGTATGCTAGCATGGGTACCGGTGA
CTTCTATCAAGAACATGGTGTACAGGTGCCACAATTTTCATTTTCACGAC
TTGCTGGAGCTGACGTTCAACTTGGAGTAGAGATGGCAAGCACAGGAGAA
GTAGCATGCTTCGGTGAAAATAGATACGAAGCTTACTTGAAGGCCTTGAT
GAGCACAGGTTTCAAATTACCCAAGAAAAACATACTGCTGACTGTTGGTA
GTTATAAGGACAATCAATTGAAGGTGATCGAATGCAATTTACGGGTGTCT
CGGTCCTTCCCTTTTGTTTCCAAAACTCTAGATTGTGATTTGGTTGCCTT
GGCAACCAAAATCATCGTTGGTGCTCCTGCTGAACCTGCATTCAACATTA
TGGATAAGTGTGAGAAGATCGGCTGTAAGGAAATTGACGTTGATGCCGTT
GCCAACGACGGTGAAGTGATGGCCATGGTCGTCTCTGAACACGTTGAAAA
CGCGGGTGTCCACTCTGGTGACGCAACCATGATCTGTCCACCACAAGACA
TCAATACGGAAACCATGGGACGGATCAAACAGATCTGTATTGCAGTTGGA
AACGCCCTCAATGTGTCTGGTCCTTTCAATATGCAACTTATTGCTAAGGA
AGCCTATCAATTCTGCACCAAAGTTGGTTACCCAGTGCTGGTACGACCTT
CATACGTGTTGAGTGGAGCTGCCATGAATGTTGTTTATGCTGAAGATGAT
TTAGAATCATATCTTGGATCTGCTGTCTCCATCTCTAAGGAGCATCCAGT
TGTCATCTCCAAATTTATATCCAATGCTAAAATGGAAAGAGTTGACCACG
ATGGAGGTGAGGATCCTTGGCACATCGCCAGAAATGATTGACAACGCTGA
AAACAGATTCAAATTCTCTCGTATGCTAGACAACATTGGAATCCTACAAC
CAACACAATCATGGATATCTACCATAAAGAAGACCCAGAAGGTATTATCT
TATCAATGGGAGGACAGGTTGCCAACAACATTGCTATGCATCTCCACAGA
CAGGAACTTGGTAAGAGCACAATTATGGTGAATTACAATCCTGAAACTGT
CAGTACAGACTATGATGAATGTGATCGATTGTACTTCGATGAAATCACAT
TTGAGTTCTGAACTGGTTATCCGCAAGTACCGTTATGAATGCAACATTTT
GCCCTGTTTCAAGCAAATTGACACTGTTGCTGCAGAATTCCCAGCTGAAG
CTAACTATCTGTATTTAACTTACAATGGAGATTGTGATGACGTCACATAC
GCAGAAAGCCAAAACAAAGTCATGGTTATTGGGTCAGGTGTCTACAGAAT
CGGAAGCAGTGTTGAATTTGATGCATGTGCTGTTGGATGTATTCGAGAAT
TGAAGAGGGTTGGAGCTGGAAAGGACACCATTCCATGCAATATCCTACTG
AAGGGGAAGCAGCTTGGATTTTCAGATAAGCAAATTGCTAACTGCGTTCA
AAGGTCTTAGTTGAGCCCTCTGACAAAAGAATCTTTCATGTTGCTGCTGC
ACTCCGTAGAGGATATTCTATTGATCAGCTGTATGAGCTCACTCGTATTG
ATAAGTGGTTTTTGAGCAAGCTAGCAAAAATAATCAACTATGCAAAAATG
CTGGAAGAGAAATACCCAAAGATTGGATCTTCGATGAAGAGTGTTGGTGA
AGTAATGGCTATTGGAAGAAGTTTTGAGGAAGCCATTCAAAAGAGTTTGA
GAATGGTTGACGATTCAAACCTTGGTTTTGATGCAAACAACCTCGAGTTG
GATGAACAGTTCTACATCATTGAGGTCAATGCTCGTCTCTCCAGAAGTTC
AGCTCTTGCTTCCAAAGCAACTGGATACCCATTGGCTTACGTTGCTGCTA
AACTTGCACTTGGTATTCCTCTACCAAAACTGAGAAATTCTGTCACCAAT
TCAACTACCGCTTGTTTTGAGCCCTCTTTGGATTATTGTGTTGTGAAAGT
TCCTCGATGGGATCTGGACAAATTTCAGAGGGTTTCAACAAAGGTTTGTA
ATATGGAAAACTTTGACCCTTTGGGAATCCATACGGGTGAATCAATTGTT
GTTGCACCAAGTCAAACACTAACAAATGAGGAATACAATATGCTTAGAAG
AACAGCCATCAAAGTCATCCGTAAACTTGGTGTTGTTGGTGAATGTAACA
TCCAGTATGCTTTACACCCTGACTCAAAAGAGGCTATCACAGCAGCTAAC
AGGCTAGGATATCCAGTGTTGTTACGTGCAGCATTTGCACTAGGTGGACT
TGGATCTGGTTTTGCTTCCAATGACAATGAGCTCAAAAAGCTTGCAGCAT
CGGCTTTTGCACATTCCAAACAGTGTCTAGTTGACAAGTCACTGAAAGGA
TGGAAAGAAGTTGAATATGAAGTTGTTAGAGATGCTTATGACAACTGTAT
CACTGTGATTGAAGTAGAAAGACCAGATGGCATTCTGTTATCATTTGGTG
GACAAACAGCATTGAACTGTGGACTGCTATTGAAAGAGAGGGGAATTTTA
GAGAAATACAATGTTGCTGTTCTTGGTACACCTACCAAATCGATTGAATG
GACAGAAGATAGGAAAATGTTTTCAGACAAGATGGGAGAGATTGGTGAGA
AAGTTGCACCAAGCTCAGTGGCTTATACTGTGGATGAGTCAAACCAAAGA
AGGTCTTGATTTTGGGATCTGGTGGCTTATCTATTGGTCAAGCCGGAGAA
TTTGATTATTCTGGCTCTCAAGCTATCAAAGCATTAAAAGAAGAGAAGAT
TCACACAGTTTTGATCAATCCTAATATTGCTACAGTGCAAACTTCCAAAG
GACTTGCAGATAAAACTTACTTCCTTCCTGTTAACTTTGAATTCACAAGC
AAGATATGGTAACAGAGGACATAACCAACCTGCAACCCATTTGGAAACTC
AACGTTGCTTCATCACTTGCCAAAATCATGGCTTTGCAATTGACACAGAC
AGCTTACCAAAAGAATGGTCTGTTTTGTTTACAAATGAGAATGATGGCAG
TAATGAAGGCATTGTTCACAACACAAAGCCAATCTTCTCAGTTCAGTTTC
ATCCTGAACATCAAGGAGGACCAAGAGATTTGGAGCTTTTGTTTGGCTTT
TTTGTGGATATTGTAAACAAACTGAAAATCGATTCTAACCTCTGCTTACG
AACCATGCTGAAAGAAACGTTGACTTTCCACCCAGCAGAAGAAACAAGAT
CCAGAGCATAATATGATGGTCTGTTTATGAGCAATGGTCCTGGAGATCCT
AGCCTTTGTCAAGTTTCAATTGACACCCTCCGTAAAGTCATTACAGAATT
GCCAGATGTGCCAGTCTTTGGTATTTGCATGGGTCATCAGATCTTATCTC
TTGCTGCTGGATGTGGGTCCTACAAAATGAAGAACCTAAACTTTACAATC
CTAAGGGTAAAATAAAGATGATTGCTGTAGACTTTGGTATCAAATACAAC
CAGATCCGGTGTTTGATTGATTGTGATTGTCAGGTTCTAGTTGTTCCATG
GGATTATGACTATAGTACATTGTTAAAGAACAAAGATTGTTTTGGATGGA
GAGGATGAAGCAAGTGTTCCATTTGATGATCCAAACAAAAGGAATTTGAT
TGCTGAAGTCTCTTGCAAGGTATTGATACCAGAGCATTAACAAAGAAGTT
GAGAGAAAATGGAACAATGTTAGGAAAGTCTTCCAAACTGGTATGGTTGG
TTACCCAGAATCATTGACAGATCCTTCATACAACAGTCAAATCTTGGTAT
TGACGTATCCACTGATTGGTAATTATGGTATACCAAACGATTCTCGTGAT
GAACATGGCATGCTCAAATTTTTTGAATCTGAAAAGATTTGGAACAATGG
TATGATTGTAGGAGACTTGACTGAGGACTACAGCCATTGGTTGGCAACCA
AATCACTTTCAGAGTGGCTGAAGGAACACAAAATACCTGGAATTACTGAT
GGCGACACTTATTCTTGATGATGGCACCAAATATCATGGTCAAATTTTTG
GTGATGAAAGAAGTATTGCAGGAGAAGTTGTTGGCCATTAAGAACGCTCG
CTGTGATTTCGCCTTGTACGCTGGTGCCAGTTCAACCAATGCTCTAATGT
TGCCAAAGATTGCACCAGGATGTGCTGGTCTCAAAATGTACCTCAACGAT
ACTTACACTACCTTGAAGATGGACAACCTCNAAGATTGCACCAGGTTGTG
CTGGTCTCAAAATGTACCTCAACGATACTTACACTACCTTGAAGATGGAC
AACCTCTCTGAGCATTGTTCAAAGTGGGCAGCAAGATCGAAGTGAAAACA
CACATTGATTGCATTTCATCGGGAAACATTGTGCGATTGCCAGGTCTCAT
TGATGTCCACGTACACTTGCGACAACCTGGTGCCGAGTACAAAGAAGATT
TCGATAGCGGTACTGCAGCCGCACTGGCCGGTGGCGTCACCATGGTGCTG
TGTATGCCGAACACCAAGCCAGCTGTGGTGGATCAACCCACTTTCCAGCT
TGCGCACCAAGTCCAAATCATTGATTGGCCTTTCGAGGAGAATGGAACTG
AGGGTCAGGAAGAGAGCATTCAAGACTACCTCACACAGAACAAATTTGAT
TTGGTCATCAACATTCCAATGAGGGGTAGTGGTACCAAGAAGAAGTCTCA
TTTCATCACACATGGATATCGCACCCGACGAATGGCCATCGATCATTCCG
TCTCATTGATCACCAACATTAAGTGTGCCAAACTCTTCTGTGAAGCGAAG
AAAGAAATGTTGCCAAGTGTTCGTTTACTGGAGAAGATGGGATACGAATT
GTATGCTAGCATGGGTACCGGTGACTTCTATCAAGAACATGGTGTACAGG
TGCCACAATTTTCATTTTCACGACTTGCTGGAGCTGACGTTCAACTTGGA
GTAGAGATGGCAAGCACAGGAGAAGTAGCATGCTTCGGTGAAAATAGATA
CGAAGCTTACTTGAAGGCCTTGATGAGCACAGGTTTCAAATTACCCAAGA
AAAACATACTGCTGACTGTTGGTAGTTATAAGGACAATCAATTGAAGGTG
ATCGAATGCAATTTACGGGTGTCTCGGTCCTTCCCTTTTGTTTCCAAAAC
TCTAGATTGTGATTTGGTTGCCTTGGCAACCAAAATCATCGTTGGTGCTC
CTGCTGAACCTGCATTCAACATTATGGATAAGTGTGAGAAGATCGGCTGT
AAGGAAATTGACGTTGATGCCGTTGCCAACGACGGTGAAGTGATGGCCAT
GGTCGTCTCTGAACACGTTGAAAACGCGGGTGTCCACTCTGGTGACGCAA
CCATGATCTGTCCACCACAAGACATCAATACGGAAACCATGGGACGGATC
AAACAGATCTGTATTGCAGTTGGAAACGCCCTCAATGTGTCTGGTCCTTT
CAATATGCAACTTATTGCTAAGGAAGCCTATCAATTCTGCACCAAAGTTG
GTTACCCAGTGCTGGTACGACCTTCATACGTGTTGAGTGGAGCTGCCATG
AATGTTGTTTATGCTGAAGATGATTTAGAATCATATCTTGGATCTGCTGT
CTCCATCTCTAAGGAGCATCCAGTTGTCATCTCCAAATTTATATCCAATG
CTAAAATGGAAAGAGTTGACCACGATGGAGGTGAGGATCCTTGGCACATC
GCCAGAAATGATTGACAACGCTGAAAACAGATTCAAATTCTCTCGTATGC
TAGACAACATTGGAATCCTACAACCAACACAATCATGGATATCTACCATA
AAGAAGACCCAGAAGGTATTATCTTATCAATGGGAGGACAGGTTGCCAAC
AACATTGCTATGCATCTCCACAGACAGGAACTTGGTAAGAGCACAATTAT
GGTGAATTACAATCCTGAAACTGTCAGTACAGACTATGATGAATGTGATC
GATTGTACTTCGATGAAATCACATTTGAGTTCTGAACTGGTTATCCGCAA
GTACCGTTATGAATGCAACATTTTGCCCTGTTTCAAGCAAATTGACACTG
TTGCTGCAGAATTCCCAGCTGAAGCTAACTATCTGTATTTAACTTACAAT
GGAGATTGTGATGACGTCACATACGCAGAAAGCCAAAACAAAGTCATGGT
TATTGGGTCAGGTGTCTACAGAATCGGAAGCAGTGTTGAATTTGATGCAT
GTGCTGTTGGATGTATTCGAGAATTGAAGAGGGTTGGAGCTGGAAAGGAC
ACCATTCCATGCAATATCCTACTGAAGGGGAAGCAGCTTGGATTTTCAGA
TAAGCAAATTGCTAACTGCGTTCAAAGGTCTTAGTTGAGCCCTCTGACAA
AAGAATCTTTCATGTTGCTGCTGCACTCCGTAGAGGATATTCTATTGATC
AGCTGTATGAGCTCACTCGTATTGATAAGTGGTTTTTGAGCAAGCTAGCA
AAAATAATCAACTATGCAAAAATGCTGGAAGAGAAATACCCAAAGATTGG
ATCTTCGATGAAGAGTGTTGGTGAAGTAATGGCTATTGGAAGAAGTTTTG
AGGAAGCCATTCAAAAGAGTTTGAGAATGGTTGACGATTCAAACCTTGGT
TTTGATGCAAACAACCTCGAGTTGGATGAACAGTTCTACATCATTGAGGT
CAATGCTCGTCTCTCCAGAAGTTCAGCTCTTGCTTCCAAAGCAACTGGAT
ACCCATTGGCTTACGTTGCTGCTAAACTTGCACTTGGTATTCCTCTACCA
AAACTGAGAAATTCTGTCACCAATTCAACTACCGCTTGTTTTGAGCCCTC
TTTGGATTATTGTGTTGTGAAAGTTCCTCGATGGGATCTGGACAAATTTC
AGAGGGTTTCAACAAAGGTTTGTAATATGGAAAACTTTGACCCTTTGGGA
ATCCATACGGGTGAATCAATTGTTGTTGCACCAAGTCAAACACTAACAAA
TGAGGAATACAATATGCTTAGAAGAACAGCCATCAAAGTCATCCGTAAAC
TTGGTGTTGTTGGTGAATGTAACATCCAGTATGCTTTACACCCTGACTCA
AAAGAGGCTATCACAGCAGCTAACAGGCTAGGATATCCAGTGTTGTTACG
TGCAGCATTTGCACTAGGTGGACTTGGATCTGGTTTTGCTTCCAATGACA
ATGAGCTCAAAAAGCTTGCAGCATCGGCTTTTGCACATTCCAAACAGTGT
CTAGTTGACAAGTCACTGAAAGGATGGAAAGAAGTTGAATATGAAGTTGT
TAGAGATGCTTATGACAACTGTATCACTGTGATTGAAGTAGAAAGACCAG
ATGGCATTCTGTTATCATTTGGTGGACAAACAGCATTGAACTGTGGACTG
CTATTGAAAGAGAGGGGAATTTTAGAGAAATACAATGTTGCTGTTCTTGG
TACACCTACCAAATCGATTGAATGGACAGAAGATAGGAAAATGTTTTCAG
ACAAGATGGGAGAGATTGGTGAGAAAGTTGCACCAAGCTCAGTGGCTTAT
ACTGTGGATGAGTCAAACCAAAGAAGGTCTTGATTTTGGGATCTGGTGGC
TTATCTATTGGTCAAGCCGGAGAATTTGATTATTCTGGCTCTCAAGCTAT
CAAAGCATTAAAAGAAGAGAAGATTCACACAGTTTTGATCAATCCTAATA
TTGCTACAGTGCAAACTTCCAAAGGACTTGCAGATAAAACTTACTTCCTT
CCTGTTAACTTTGAATTCACAAGCAAGATATGGTAACAGAGGACATAACC
AACCTGCAACCCATTTGGAAACTCAACGTTGCTTCATCACTTGCCAAAAT
CATGGCTTTGCAATTGACACAGACAGCTTACCAAAAGAATGGTCTGTTTT
GTTTACAAATGAGAATGATGGCAGTAATGAAGGCATTGTTCACAACACAA
AGCCAATCTTCTCAGTTCAGTTTCATCCTGAACATCAAGGAGGACCAAGA
GATTTGGAGCTTTTGTTTGGCTTTTTTGTGGATATTGTAAACAAACTGAA
AATCGATTCTAACCTCTGCTTACGAACCATGCTGAAAGAAACGTTGACTT
TCCACCCAGCAGAAGAAACAAGATCCAGAGCATAATATGATGGTCTGTTT
ATGAGCAATGGTCCTGGAGATCCTAGCCTTTGTCAAGTTTCAATTGACAC
CCTCCGTAAAGTCATTACAGAATTGCCAGATGTGCCAGTCTTTGGTATTT
GCATGGGTCATCAGATCTTATCTCTTGCTGCTGGATGTGGGTCCTACAAA
ATGAAGAACCTAAACTTTACAATCCTAAGGGTAAAATAAAGATGATTGCT
GTAGACTTTGGTATCAAATACAACCAGATCCGGTGTTTGATTGATTGTGA
TTGTCAGGTTCTAGTTGTTCCATGGGATTATGACTATAGTACATTGTTAA
AGAACAAAGATTGTTTTGGATGGAGAGGATGAAGCAAGTGTTCCATTTGA
TGATCCAAACAAAAGGAATTTGATTGCTGAAGTCTCTTGCAAGGTATTGA
TACCAGAGCATTAACAAAGAAGTTGAGAGAAAATGGAACAATGTTAGGAA
AGTCTTCCAAACTGGTATGGTTGGTTACCCAGAATCATTGACAGATCCTT
CATACAACAGTCAAATCTTGGTATTGACGTATCCACTGATTGGTAATTAT
GGTATACCAAACGATTCTCGTGATGAACATGGCATGCTCAAATTTTTTGA
ATCTGAAAAGATTTGGAACAATGGTATGATTGTAGGAGACTTGACTGAGG
ACTACAGCCATTGGTTGGCAACCAAATCACTTTCAGAGTGGCTGAAGGAA
CACAAAATACCTGGAATTACTGATGGCGACACTTATTCTTGATGATGGCA
CCAAATATCATGGTCAAATTTTTGGTGATGAAAGAAGTATTGCAGGAGAA
GTTGTTGGCCATTAAGAACGCTCGCTGTGATTTCGCCTTGTACGCTGGTG
CCAGTTCAACCAATGCTCTAATGTTGCCAAAGATTGCACCAGGATGTGCT
GGTCTCAAAATGTACCTCAACGATACTTACACTACCTTGAAGATGGACAA
CCTCNAAGATTGCACCAGGTTGTGCTGGTCTCAAAATGTACCTCAACGAT
ACTTACACTACCTTGAAGATGGACAACCTCTCTGAGCATTGTTCAAAGTG
GGCAGCAAGATCGAAGTGAAAACACACATTGATTGCATTTCATCGGGAAA
CATTGTGCGATTGCCAGGTCTCATTGATGTCCACGTACACTTGCGACAAC
CTGGTGCCGAGTACAAAGAAGATTTCGATAGCGGTACTGCAGCCGCACTG
GCCGGTGGCGTCACCATGGTGCTGTGTATGCCGAACACCAAGCCAGCTGT
GGTGGATCAACCCACTTTCCAGCTTGCGCACCAAGTCCAAATCATTGATT
GGCCTTTCGAGGAGAATGGAACTGAGGGTCAGGAAGAGAGCATTCAAGAC
TACCTCACACAGAACAAATTTGATTTGGTCATCAACATTCCAATGAGGGG
TAGTGGTACCAAGAAGAAGTCTCATTTCATCACACATGGATATCGCACCC
GACGAATGGCCATCGATCATTCCGTCTCATTGATCACCAACATTAAGTGT
GCCAAACTCTTCTGTGAAGCGAAGAAAGAAATGTTGCCAAGTGTTCGTTT
ACTGGAGAAGATGGGATACGAATTGTATGCTAGCATGGGTACCGGTGACT
TCTATCAAGAACATGGTGTACAGGTGCCACAATTTTCATTTTCACGACTT
GCTGGAGCTGACGTTCAACTTGGAGTAGAGATGGCAAGCACAGGAGAAGT
AGCATGCTTCGGTGAAAATAGATACGAAGCTTACTTGAAGGCCTTGATGA
GCACAGGTTTCAAATTACCCAAGAAAAACATACTGCTGACTGTTGGTAGT
TATAAGGACAATCAATTGAAGGTGATCGAATGCAATTTACGGGTGTCTCG
GTCCTTCCCTTTTGTTTCCAAAACTCTAGATTGTGATTTGGTTGCCTTGG
CAACCAAAATCATCGTTGGTGCTCCTGCTGAACCTGCATTCAACATTATG
GATAAGTGTGAGAAGATCGGCTGTAAGGAAATTGACGTTGATGCCGTTGC
CAACGACGGTGAAGTGATGGCCATGGTCGTCTCTGAACACGTTGAAAACG
CGGGTGTCCACTCTGGTGACGCAACCATGATCTGTCCACCACAAGACATC
AATACGGAAACCATGGGACGGATCAAACAGATCTGTATTGCAGTTGGAAA
CGCCCTCAATGTGTCTGGTCCTTTCAATATGCAACTTATTGCTAAGGAAG
CCTATCAATTCTGCACCAAAGTTGGTTACCCAGTGCTGGTACGACCTTCA
TACGTGTTGAGTGGAGCTGCCATGAATGTTGTTTATGCTGAAGATGATTT
AGAATCATATCTTGGATCTGCTGTCTCCATCTCTAAGGAGCATCCAGTTG
TCATCTCCAAATTTATATCCAATGCTAAAATGGAAAGAGTTGACCACGAT
GGAGGTGAGGATCCTTGGCACATCGCCAGAAATGATTGACAACGCTGAAA
ACAGATTCAAATTCTCTCGTATGCTAGACAACATTGGAATCCTACAACCA
ACACAATCATGGATATCTACCATAAAGAAGACCCAGAAGGTATTATCTTA
TCAATGGGAGGACAGGTTGCCAACAACATTGCTATGCATCTCCACAGACA
GGAACTTGGTAAGAGCACAATTATGGTGAATTACAATCCTGAAACTGTCA
GTACAGACTATGATGAATGTGATCGATTGTACTTCGATGAAATCACATTT
GAGTTCTGAACTGGTTATCCGCAAGTACCGTTATGAATGCAACATTTTGC
CCTGTTTCAAGCAAATTGACACTGTTGCTGCAGAATTCCCAGCTGAAGCT
AACTATCTGTATTTAACTTACAATGGAGATTGTGATGACGTCACATACGC
AGAAAGCCAAAACAAAGTCATGGTTATTGGGTCAGGTGTCTACAGAATCG
GAAGCAGTGTTGAATTTGATGCATGTGCTGTTGGATGTATTCGAGAATTG
AAGAGGGTTGGAGCTGGAAAGGACACCATTCCATGCAATATCCTACTGAA
GGGGAAGCAGCTTGGATTTTCAGATAAGCAAATTGCTAACTGCGTTCAAA
GGTCTTAGTTGAGCCCTCTGACAAAAGAATCTTTCATGTTGCTGCTGCAC
TCCGTAGAGGATATTCTATTGATCAGCTGTATGAGCTCACTCGTATTGAT
AAGTGGTTTTTGAGCAAGCTAGCAAAAATAATCAACTATGCAAAAATGCT
GGAAGAGAAATACCCAAAGATTGGATCTTCGATGAAGAGTGTTGGTGAAG
TAATGGCTATTGGAAGAAGTTTTGAGGAAGCCATTCAAAAGAGTTTGAGA
ATGGTTGACGATTCAAACCTTGGTTTTGATGCAAACAACCTCGAGTTGGA
TGAACAGTTCTACATCATTGAGGTCAATGCTCGTCTCTCCAGAAGTTCAG
CTCTTGCTTCCAAAGCAACTGGATACCCATTGGCTTACGTTGCTGCTAAA
CTTGCACTTGGTATTCCTCTACCAAAACTGAGAAATTCTGTCACCAATTC
AACTACCGCTTGTTTTGAGCCCTCTTTGGATTATTGTGTTGTGAAAGTTC
CTCGATGGGATCTGGACAAATTTCAGAGGGTTTCAACAAAGGTTTGTAAT
ATGGAAAACTTTGACCCTTTGGGAATCCATACGGGTGAATCAATTGTTGT
TGCACCAAGTCAAACACTAACAAATGAGGAATACAATATGCTTAGAAGAA
CAGCCATCAAAGTCATCCGTAAACTTGGTGTTGTTGGTGAATGTAACATC
CAGTATGCTTTACACCCTGACTCAAAAGAGGCTATCACAGCAGCTAACAG
GCTAGGATATCCAGTGTTGTTACGTGCAGCATTTGCACTAGGTGGACTTG
GATCTGGTTTTGCTTCCAATGACAATGAGCTCAAAAAGCTTGCAGCATCG
GCTTTTGCACATTCCAAACAGTGTCTAGTTGACAAGTCACTGAAAGGATG
GAAAGAAGTTGAATATGAAGTTGTTAGAGATGCTTATGACAACTGTATCA
CTGTGATTGAAGTAGAAAGACCAGATGGCATTCTGTTATCATTTGGTGGA
CAAACAGCATTGAACTGTGGACTGCTATTGAAAGAGAGGGGAATTTTAGA
GAAATACAATGTTGCTGTTCTTGGTACACCTACCAAATCGATTGAATGGA
CAGAAGATAGGAAAATGTTTTCAGACAAGATGGGAGAGATTGGTGAGAAA
GTTGCACCAAGCTCAGTGGCTTATACTGTGGATGAGTCAAACCAAAGAAG
GTCTTGATTTTGGGATCTGGTGGCTTATCTATTGGTCAAGCCGGAGAATT
TGATTATTCTGGCTCTCAAGCTATCAAAGCATTAAAAGAAGAGAAGATTC
ACACAGTTTTGATCAATCCTAATATTGCTACAGTGCAAACTTCCAAAGGA
CTTGCAGATAAAACTTACTTCCTTCCTGTTAACTTTGAATTCACAAGCAA
GATATGGTAACAGAGGACATAACCAACCTGCAACCCATTTGGAAACTCAA
CGTTGCTTCATCACTTGCCAAAATCATGGCTTTGCAATTGACACAGACAG
CTTACCAAAAGAATGGTCTGTTTTGTTTACAAATGAGAATGATGGCAGTA
ATGAAGGCATTGTTCACAACACAAAGCCAATCTTCTCAGTTCAGTTTCAT
CCTGAACATCAAGGAGGACCAAGAGATTTGGAGCTTTTGTTTGGCTTTTT
TGTGGATATTGTAAACAAACTGAAAATCGATTCTAACCTCTGCTTACGAA
CCATGCTGAAAGAAACGTTGACTTTCCACCCAGCAGAAGAAACAAGATCC
AGAGCATAATATGATGGTCTGTTTATGAGCAATGGTCCTGGAGATCCTAG
CCTTTGTCAAGTTTCAATTGACACCCTCCGTAAAGTCATTACAGAATTGC
CAGATGTGCCAGTCTTTGGTATTTGCATGGGTCATCAGATCTTATCTCTT
GCTGCTGGATGTGGGTCCTACAAAATGAAGAACCTAAACTTTACAATCCT
AAGGGTAAAATAAAGATGATTGCTGTAGACTTTGGTATCAAATACAACCA
GATCCGGTGTTTGATTGATTGTGATTGTCAGGTTCTAGTTGTTCCATGGG
ATTATGACTATAGTACATTGTTAAAGAACAAAGATTGTTTTGGATGGAGA
GGATGAAGCAAGTGTTCCATTTGATGATCCAAACAAAAGGAATTTGATTG
CTGAAGTCTCTTGCAAGGTATTGATACCAGAGCATTAACAAAGAAGTTGA
GAGAAAATGGAACAATGTTAGGAAAGTCTTCCAAACTGGTATGGTTGGTT
ACCCAGAATCATTGACAGATCCTTCATACAACAGTCAAATCTTGGTATTG
ACGTATCCACTGATTGGTAATTATGGTATACCAAACGATTCTCGTGATGA
ACATGGCATGCTCAAATTTTTTGAATCTGAAAAGATTTGGAACAATGGTA
TGATTGTAGGAGACTTGACTGAGGACTACAGCCATTGGTTGGCAACCAAA
TCACTTTCAGAGTGGCTGAAGGAACACAAAATACCTGGAATTACTGATGG
CGACACTTATTCTTGATGATGGCACCAAATATCATGGTCAAATTTTTGGT
GATGAAAGAAGTATTGCAGGAGAAGTTGTTGGCCATTAAGAACGCTCGCT
GTGATTTCGCCTTGTACGCTGGTGCCAGTTCAACCAATGCTCTAATGTTG
CCAAAGATTGCACCAGGATGTGCTGGTCTCAAAATGTACCTCAACGATAC
TTACACTACCTTGAAGATGGACAACCTCNAAGATTGCACCAGGTTGTGCT
GGTCTCAAAATGTACCTCAACGATACTTACACTACCTTGAAGATGGACAA
CCTCTCTGAGCATTGTTCAAAGTGGGCAGCAAGATCGAAGTGAAAACACA
CATTGATTGCATTTCATCGGGAAACATTGTGCGATTGCCAGGTCTCATTG
ATGTCCACGTACACTTGCGACAACCTGGTGCCGAGTACAAAGAAGATTTC
GATAGCGGTACTGCAGCCGCACTGGCCGGTGGCGTCACCATGGTGCTGTG
TATGCCGAACACCAAGCCAGCTGTGGTGGATCAACCCACTTTCCAGCTTG
CGCACCAAGTCCAAATCATTGATTGGCCTTTCGAGGAGAATGGAACTGAG
GGTCAGGAAGAGAGCATTCAAGACTACCTCACACAGAACAAATTTGATTT
GGTCATCAACATTCCAATGAGGGGTAGTGGTACCAAGAAGAAGTCTCATT
TCATCACACATGGATATCGCACCCGACGAATGGCCATCGATCATTCCGTC
TCATTGATCACCAACATTAAGTGTGCCAAACTCTTCTGTGAAGCGAAGAA
AGAAATGTTGCCAAGTGTTCGTTTACTGGAGAAGATGGGATACGAATTGT
ATGCTAGCATGGGTACCGGTGACTTCTATCAAGAACATGGTGTACAGGTG
CCACAATTTTCATTTTCACGACTTGCTGGAGCTGACGTTCAACTTGGAGT
AGAGATGGCAAGCACAGGAGAAGTAGCATGCTTCGGTGAAAATAGATACG
AAGCTTACTTGAAGGCCTTGATGAGCACAGGTTTCAAATTACCCAAGAAA
AACATACTGCTGACTGTTGGTAGTTATAAGGACAATCAATTGAAGGTGAT
CGAATGCAATTTACGGGTGTCTCGGTCCTTCCCTTTTGTTTCCAAAACTC
TAGATTGTGATTTGGTTGCCTTGGCAACCAAAATCATCGTTGGTGCTCCT
GCTGAACCTGCATTCAACATTATGGATAAGTGTGAGAAGATCGGCTGTAA
GGAAATTGACGTTGATGCCGTTGCCAACGACGGTGAAGTGATGGCCATGG
TCGTCTCTGAACACGTTGAAAACGCGGGTGTCCACTCTGGTGACGCAACC
ATGATCTGTCCACCACAAGACATCAATACGGAAACCATGGGACGGATCAA
ACAGATCTGTATTGCAGTTGGAAACGCCCTCAATGTGTCTGGTCCTTTCA
ATATGCAACTTATTGCTAAGGAAGCCTATCAATTCTGCACCAAAGTTGGT
TACCCAGTGCTGGTACGACCTTCATACGTGTTGAGTGGAGCTGCCATGAA
TGTTGTTTATGCTGAAGATGATTTAGAATCATATCTTGGATCTGCTGTCT
CCATCTCTAAGGAGCATCCAGTTGTCATCTCCAAATTTATATCCAATGCT
AAAATGGAAAGAGTTGACCACGATGGAGGTGAGGATCCTTGGCACATCGC
CAGAAATGATTGACAACGCTGAAAACAGATTCAAATTCTCTCGTATGCTA
GACAACATTGGAATCCTACAACCAACACAATCATGGATATCTACCATAAA
GAAGACCCAGAAGGTATTATCTTATCAATGGGAGGACAGGTTGCCAACAA
CATTGCTATGCATCTCCACAGACAGGAACTTGGTAAGAGCACAATTATGG
TGAATTACAATCCTGAAACTGTCAGTACAGACTATGATGAATGTGATCGA
TTGTACTTCGATGAAATCACATTTGAGTTCTGAACTGGTTATCCGCAAGT
ACCGTTATGAATGCAACATTTTGCCCTGTTTCAAGCAAATTGACACTGTT
GCTGCAGAATTCCCAGCTGAAGCTAACTATCTGTATTTAACTTACAATGG
AGATTGTGATGACGTCACATACGCAGAAAGCCAAAACAAAGTCATGGTTA
TTGGGTCAGGTGTCTACAGAATCGGAAGCAGTGTTGAATTTGATGCATGT
GCTGTTGGATGTATTCGAGAATTGAAGAGGGTTGGAGCTGGAAAGGACAC
CATTCCATGCAATATCCTACTGAAGGGGAAGCAGCTTGGATTTTCAGATA
AGCAAATTGCTAACTGCGTTCAAAGGTCTTAGTTGAGCCCTCTGACAAAA
GAATCTTTCATGTTGCTGCTGCACTCCGTAGAGGATATTCTATTGATCAG
CTGTATGAGCTCACTCGTATTGATAAGTGGTTTTTGAGCAAGCTAGCAAA
AATAATCAACTATGCAAAAATGCTGGAAGAGAAATACCCAAAGATTGGAT
CTTCGATGAAGAGTGTTGGTGAAGTAATGGCTATTGGAAGAAGTTTTGAG
GAAGCCATTCAAAAGAGTTTGAGAATGGTTGACGATTCAAACCTTGGTTT
TGATGCAAACAACCTCGAGTTGGATGAACAGTTCTACATCATTGAGGTCA
ATGCTCGTCTCTCCAGAAGTTCAGCTCTTGCTTCCAAAGCAACTGGATAC
CCATTGGCTTACGTTGCTGCTAAACTTGCACTTGGTATTCCTCTACCAAA
ACTGAGAAATTCTGTCACCAATTCAACTACCGCTTGTTTTGAGCCCTCTT
TGGATTATTGTGTTGTGAAAGTTCCTCGATGGGATCTGGACAAATTTCAG
AGGGTTTCAACAAAGGTTTGTAATATGGAAAACTTTGACCCTTTGGGAAT
CCATACGGGTGAATCAATTGTTGTTGCACCAAGTCAAACACTAACAAATG
AGGAATACAATATGCTTAGAAGAACAGCCATCAAAGTCATCCGTAAACTT
GGTGTTGTTGGTGAATGTAACATCCAGTATGCTTTACACCCTGACTCAAA
AGAGGCTATCACAGCAGCTAACAGGCTAGGATATCCAGTGTTGTTACGTG
CAGCATTTGCACTAGGTGGACTTGGATCTGGTTTTGCTTCCAATGACAAT
GAGCTCAAAAAGCTTGCAGCATCGGCTTTTGCACATTCCAAACAGTGTCT
AGTTGACAAGTCACTGAAAGGATGGAAAGAAGTTGAATATGAAGTTGTTA
GAGATGCTTATGACAACTGTATCACTGTGATTGAAGTAGAAAGACCAGAT
GGCATTCTGTTATCATTTGGTGGACAAACAGCATTGAACTGTGGACTGCT
ATTGAAAGAGAGGGGAATTTTAGAGAAATACAATGTTGCTGTTCTTGGTA
CACCTACCAAATCGATTGAATGGACAGAAGATAGGAAAATGTTTTCAGAC
AAGATGGGAGAGATTGGTGAGAAAGTTGCACCAAGCTCAGTGGCTTATAC
TGTGGATGAGTCAAACCAAAGAAGGTCTTGATTTTGGGATCTGGTGGCTT
ATCTATTGGTCAAGCCGGAGAATTTGATTATTCTGGCTCTCAAGCTATCA
AAGCATTAAAAGAAGAGAAGATTCACACAGTTTTGATCAATCCTAATATT
GCTACAGTGCAAACTTCCAAAGGACTTGCAGATAAAACTTACTTCCTTCC
TGTTAACTTTGAATTCACAAGCAAGATATGGTAACAGAGGACATAACCAA
CCTGCAACCCATTTGGAAACTCAACGTTGCTTCATCACTTGCCAAAATCA
TGGCTTTGCAATTGACACAGACAGCTTACCAAAAGAATGGTCTGTTTTGT
TTACAAATGAGAATGATGGCAGTAATGAAGGCATTGTTCACAACACAAAG
CCAATCTTCTCAGTTCAGTTTCATCCTGAACATCAAGGAGGACCAAGAGA
TTTGGAGCTTTTGTTTGGCTTTTTTGTGGATATTGTAAACAAACTGAAAA
TCGATTCTAACCTCTGCTTACGAACCATGCTGAAAGAAACGTTGACTTTC
CACCCAGCAGAAGAAACAAGATCCAGAGCATAATATGATGGTCTGTTTAT
GAGCAATGGTCCTGGAGATCCTAGCCTTTGTCAAGTTTCAATTGACACCC
TCCGTAAAGTCATTACAGAATTGCCAGATGTGCCAGTCTTTGGTATTTGC
ATGGGTCATCAGATCTTATCTCTTGCTGCTGGATGTGGGTCCTACAAAAT
GAAGAACCTAAACTTTACAATCCTAAGGGTAAAATAAAGATGATTGCTGT
AGACTTTGGTATCAAATACAACCAGATCCGGTGTTTGATTGATTGTGATT
GTCAGGTTCTAGTTGTTCCATGGGATTATGACTATAGTACATTGTTAAAG
AACAAAGATTGTTTTGGATGGAGAGGATGAAGCAAGTGTTCCATTTGATG
ATCCAAACAAAAGGAATTTGATTGCTGAAGTCTCTTGCAAGGTATTGATA
CCAGAGCATTAACAAAGAAGTTGAGAGAAAATGGAACAATGTTAGGAAAG
TCTTCCAAACTGGTATGGTTGGTTACCCAGAATCATTGACAGATCCTTCA
TACAACAGTCAAATCTTGGTATTGACGTATCCACTGATTGGTAATTATGG
TATACCAAACGATTCTCGTGATGAACATGGCATGCTCAAATTTTTTGAAT
CTGAAAAGATTTGGAACAATGGTATGATTGTAGGAGACTTGACTGAGGAC
TACAGCCATTGGTTGGCAACCAAATCACTTTCAGAGTGGCTGAAGGAACA
CAAAATACCTGGAATTACTGATGGCGACACTTATTCTTGATGATGGCACC
AAATATCATGGTCAAATTTTTGGTGATGAAAGAAGTATTGCAGGAGAAGT
TGTTGGCCATTAAGAACGCTCGCTGTGATTTCGCCTTGTACGCTGGTGCC
AGTTCAACCAATGCTCTAATGTTGCCAAAGATTGCACCAGGATGTGCTGG
TCTCAAAATGTACCTCAACGATACTTACACTACCTTGAAGATGGACAACC
TCNAAGATTGCACCAGGTTGTGCTGGTCTCAAAATGTACCTCAACGATAC
TTACACTACCTTGAAGATGGACAACCTCTCTGAGCATTGTTCAAAGTGGG
CAGCAAGATCGAAGTGAAAACACACATTGATTGCATTTCATCGGGAAACA
TTGTGCGATTGCCAGGTCTCATTGATGTCCACGTACACTTGCGACAACCT
GGTGCCGAGTACAAAGAAGATTTCGATAGCGGTACTGCAGCCGCACTGGC
CGGTGGCGTCACCATGGTGCTGTGTATGCCGAACACCAAGCCAGCTGTGG
TGGATCAACCCACTTTCCAGCTTGCGCACCAAGTCCAAATCATTGATTGG
CCTTTCGAGGAGAATGGAACTGAGGGTCAGGAAGAGAGCATTCAAGACTA
CCTCACACAGAACAAATTTGATTTGGTCATCAACATTCCAATGAGGGGTA
GTGGTACCAAGAAGAAGTCTCATTTCATCACACATGGATATCGCACCCGA
CGAATGGCCATCGATCATTCCGTCTCATTGATCACCAACATTAAGTGTGC
CAAACTCTTCTGTGAAGCGAAGAAAGAAATGTTGCCAAGTGTTCGTTTAC
TGGAGAAGATGGGATACGAATTGTATGCTAGCATGGGTACCGGTGACTTC
TATCAAGAACATGGTGTACAGGTGCCACAATTTTCATTTTCACGACTTGC
TGGAGCTGACGTTCAACTTGGAGTAGAGATGGCAAGCACAGGAGAAGTAG
CATGCTTCGGTGAAAATAGATACGAAGCTTACTTGAAGGCCTTGATGAGC
ACAGGTTTCAAATTACCCAAGAAAAACATACTGCTGACTGTTGGTAGTTA
TAAGGACAATCAATTGAAGGTGATCGAATGCAATTTACGGGTGTCTCGGT
CCTTCCCTTTTGTTTCCAAAACTCTAGATTGTGATTTGGTTGCCTTGGCA
ACCAAAATCATCGTTGGTGCTCCTGCTGAACCTGCATTCAACATTATGGA
TAAGTGTGAGAAGATCGGCTGTAAGGAAATTGACGTTGATGCCGTTGCCA
ACGACGGTGAAGTGATGGCCATGGTCGTCTCTGAACACGTTGAAAACGCG
GGTGTCCACTCTGGTGACGCAACCATGATCTGTCCACCACAAGACATCAA
TACGGAAACCATGGGACGGATCAAACAGATCTGTATTGCAGTTGGAAACG
CCCTCAATGTGTCTGGTCCTTTCAATATGCAACTTATTGCTAAGGAAGCC
TATCAATTCTGCACCAAAGTTGGTTACCCAGTGCTGGTACGACCTTCATA
CGTGTTGAGTGGAGCTGCCATGAATGTTGTTTATGCTGAAGATGATTTAG
AATCATATCTTGGATCTGCTGTCTCCATCTCTAAGGAGCATCCAGTTGTC
ATCTCCAAATTTATATCCAATGCTAAAATGGAAAGAGTTGACCACGATGG
AGGTGAGGATCCTTGGCACATCGCCAGAAATGATTGACAACGCTGAAAAC
AGATTCAAATTCTCTCGTATGCTAGACAACATTGGAATCCTACAACCAAC
ACAATCATGGATATCTACCATAAAGAAGACCCAGAAGGTATTATCTTATC
AATGGGAGGACAGGTTGCCAACAACATTGCTATGCATCTCCACAGACAGG
AACTTGGTAAGAGCACAATTATGGTGAATTACAATCCTGAAACTGTCAGT
ACAGACTATGATGAATGTGATCGATTGTACTTCGATGAAATCACATTTGA
GTTCTGAACTGGTTATCCGCAAGTACCGTTATGAATGCAACATTTTGCCC
TGTTTCAAGCAAATTGACACTGTTGCTGCAGAATTCCCAGCTGAAGCTAA
CTATCTGTATTTAACTTACAATGGAGATTGTGATGACGTCACATACGCAG
AAAGCCAAAACAAAGTCATGGTTATTGGGTCAGGTGTCTACAGAATCGGA
AGCAGTGTTGAATTTGATGCATGTGCTGTTGGATGTATTCGAGAATTGAA
GAGGGTTGGAGCTGGAAAGGACACCATTCCATGCAATATCCTACTGAAGG
GGAAGCAGCTTGGATTTTCAGATAAGCAAATTGCTAACTGCGTTCAAAGG
TCTTAGTTGAGCCCTCTGACAAAAGAATCTTTCATGTTGCTGCTGCACTC
CGTAGAGGATATTCTATTGATCAGCTGTATGAGCTCACTCGTATTGATAA
GTGGTTTTTGAGCAAGCTAGCAAAAATAATCAACTATGCAAAAATGCTGG
AAGAGAAATACCCAAAGATTGGATCTTCGATGAAGAGTGTTGGTGAAGTA
ATGGCTATTGGAAGAAGTTTTGAGGAAGCCATTCAAAAGAGTTTGAGAAT
GGTTGACGATTCAAACCTTGGTTTTGATGCAAACAACCTCGAGTTGGATG
AACAGTTCTACATCATTGAGGTCAATGCTCGTCTCTCCAGAAGTTCAGCT
CTTGCTTCCAAAGCAACTGGATACCCATTGGCTTACGTTGCTGCTAAACT
TGCACTTGGTATTCCTCTACCAAAACTGAGAAATTCTGTCACCAATTCAA
CTACCGCTTGTTTTGAGCCCTCTTTGGATTATTGTGTTGTGAAAGTTCCT
CGATGGGATCTGGACAAATTTCAGAGGGTTTCAACAAAGGTTTGTAATAT
GGAAAACTTTGACCCTTTGGGAATCCATACGGGTGAATCAATTGTTGTTG
CACCAAGTCAAACACTAACAAATGAGGAATACAATATGCTTAGAAGAACA
GCCATCAAAGTCATCCGTAAACTTGGTGTTGTTGGTGAATGTAACATCCA
GTATGCTTTACACCCTGACTCAAAAGAGGCTATCACAGCAGCTAACAGGC
TAGGATATCCAGTGTTGTTACGTGCAGCATTTGCACTAGGTGGACTTGGA
TCTGGTTTTGCTTCCAATGACAATGAGCTCAAAAAGCTTGCAGCATCGGC
TTTTGCACATTCCAAACAGTGTCTAGTTGACAAGTCACTGAAAGGATGGA
AAGAAGTTGAATATGAAGTTGTTAGAGATGCTTATGACAACTGTATCACT
GTGATTGAAGTAGAAAGACCAGATGGCATTCTGTTATCATTTGGTGGACA
AACAGCATTGAACTGTGGACTGCTATTGAAAGAGAGGGGAATTTTAGAGA
AATACAATGTTGCTGTTCTTGGTACACCTACCAAATCGATTGAATGGACA
GAAGATAGGAAAATGTTTTCAGACAAGATGGGAGAGATTGGTGAGAAAGT
TGCACCAAGCTCAGTGGCTTATACTGTGGATGAGTCAAACCAAAGAAGGT
CTTGATTTTGGGATCTGGTGGCTTATCTATTGGTCAAGCCGGAGAATTTG
ATTATTCTGGCTCTCAAGCTATCAAAGCATTAAAAGAAGAGAAGATTCAC
ACAGTTTTGATCAATCCTAATATTGCTACAGTGCAAACTTCCAAAGGACT
TGCAGATAAAACTTACTTCCTTCCTGTTAACTTTGAATTCACAAGCAAGA
TATGGTAACAGAGGACATAACCAACCTGCAACCCATTTGGAAACTCAACG
TTGCTTCATCACTTGCCAAAATCATGGCTTTGCAATTGACACAGACAGCT
TACCAAAAGAATGGTCTGTTTTGTTTACAAATGAGAATGATGGCAGTAAT
GAAGGCATTGTTCACAACACAAAGCCAATCTTCTCAGTTCAGTTTCATCC
TGAACATCAAGGAGGACCAAGAGATTTGGAGCTTTTGTTTGGCTTTTTTG
TGGATATTGTAAACAAACTGAAAATCGATTCTAACCTCTGCTTACGAACC
ATGCTGAAAGAAACGTTGACTTTCCACCCAGCAGAAGAAACAAGATCCAG
AGCATAATATGATGGTCTGTTTATGAGCAATGGTCCTGGAGATCCTAGCC
TTTGTCAAGTTTCAATTGACACCCTCCGTAAAGTCATTACAGAATTGCCA
GATGTGCCAGTCTTTGGTATTTGCATGGGTCATCAGATCTTATCTCTTGC
TGCTGGATGTGGGTCCTACAAAATGAAGAACCTAAACTTTACAATCCTAA
GGGTAAAATAAAGATGATTGCTGTAGACTTTGGTATCAAATACAACCAGA
TCCGGTGTTTGATTGATTGTGATTGTCAGGTTCTAGTTGTTCCATGGGAT
TATGACTATAGTACATTGTTAAAGAACAAAGATTGTTTTGGATGGAGAGG
ATGAAGCAAGTGTTCCATTTGATGATCCAAACAAAAGGAATTTGATTGCT
GAAGTCTCTTGCAAGGTATTGATACCAGAGCATTAACAAAGAAGTTGAGA
GAAAATGGAACAATGTTAGGAAAGTCTTCCAAACTGGTATGGTTGGTTAC
CCAGAATCATTGACAGATCCTTCATACAACAGTCAAATCTTGGTATTGAC
GTATCCACTGATTGGTAATTATGGTATACCAAACGATTCTCGTGATGAAC
ATGGCATGCTCAAATTTTTTGAATCTGAAAAGATTTGGAACAATGGTATG
ATTGTAGGAGACTTGACTGAGGACTACAGCCATTGGTTGGCAACCAAATC
ACTTTCAGAGTGGCTGAAGGAACACAAAATACCTGGAATTACTGATGGCG
ACACTTATTCTTGATGATGGCACCAAATATCATGGTCAAATTTTTGGTGA
TGAAAGAAGTATTGCAGGAGAAGTTGTTGGCCATTAAGAACGCTCGCTGT
GATTTCGCCTTGTACGCTGGTGCCAGTTCAACCAATGCTCTAATGTTGCC
AAAGATTGCACCAGGATGTGCTGGTCTCAAAATGTACCTCAACGATACTT
ACACTACCTTGAAGATGGACAACCTCNAAGATTGCACCAGGTTGTGCTGG
TCTCAAAATGTACCTCAACGATACTTACACTACCTTGAAGATGGACAACC
TCTCTGAGCATTGTTCAAAGTGGGCAGCAAGATCGAAGTGAAAACACACA
TTGATTGCATTTCATCGGGAAACATTGTGCGATTGCCAGGTCTCATTGAT
GTCCACGTACACTTGCGACAACCTGGTGCCGAGTACAAAGAAGATTTCGA
TAGCGGTACTGCAGCCGCACTGGCCGGTGGCGTCACCATGGTGCTGTGTA
TGCCGAACACCAAGCCAGCTGTGGTGGATCAACCCACTTTCCAGCTTGCG
CACCAAGTCCAAATCATTGATTGGCCTTTCGAGGAGAATGGAACTGAGGG
TCAGGAAGAGAGCATTCAAGACTACCTCACACAGAACAAATTTGATTTGG
TCATCAACATTCCAATGAGGGGTAGTGGTACCAAGAAGAAGTCTCATTTC
ATCACACATGGATATCGCACCCGACGAATGGCCATCGATCATTCCGTCTC
ATTGATCACCAACATTAAGTGTGCCAAACTCTTCTGTGAAGCGAAGAAAG
AAATGTTGCCAAGTGTTCGTTTACTGGAGAAGATGGGATACGAATTGTAT
GCTAGCATGGGTACCGGTGACTTCTATCAAGAACATGGTGTACAGGTGCC
ACAATTTTCATTTTCACGACTTGCTGGAGCTGACGTTCAACTTGGAGTAG
AGATGGCAAGCACAGGAGAAGTAGCATGCTTCGGTGAAAATAGATACGAA
GCTTACTTGAAGGCCTTGATGAGCACAGGTTTCAAATTACCCAAGAAAAA
CATACTGCTGACTGTTGGTAGTTATAAGGACAATCAATTGAAGGTGATCG
AATGCAATTTACGGGTGTCTCGGTCCTTCCCTTTTGTTTCCAAAACTCTA
GATTGTGATTTGGTTGCCTTGGCAACCAAAATCATCGTTGGTGCTCCTGC
TGAACCTGCATTCAACATTATGGATAAGTGTGAGAAGATCGGCTGTAAGG
AAATTGACGTTGATGCCGTTGCCAACGACGGTGAAGTGATGGCCATGGTC
GTCTCTGAACACGTTGAAAACGCGGGTGTCCACTCTGGTGACGCAACCAT
GATCTGTCCACCACAAGACATCAATACGGAAACCATGGGACGGATCAAAC
AGATCTGTATTGCAGTTGGAAACGCCCTCAATGTGTCTGGTCCTTTCAAT
ATGCAACTTATTGCTAAGGAAGCCTATCAATTCTGCACCAAAGTTGGTTA
CCCAGTGCTGGTACGACCTTCATACGTGTTGAGTGGAGCTGCCATGAATG
TTGTTTATGCTGAAGATGATTTAGAATCATATCTTGGATCTGCTGTCTCC
ATCTCTAAGGAGCATCCAGTTGTCATCTCCAAATTTATATCCAATGCTAA
AATGGAAAGAGTTGACCACGATGGAGGTGAGGATCCTTGGCACATCGCCA
GAAATGATTGACAACGCTGAAAACAGATTCAAATTCTCTCGTATGCTAGA
CAACATTGGAATCCTACAACCAACACAATCATGGATATCTACCATAAAGA
AGACCCAGAAGGTATTATCTTATCAATGGGAGGACAGGTTGCCAACAACA
TTGCTATGCATCTCCACAGACAGGAACTTGGTAAGAGCACAATTATGGTG
AATTACAATCCTGAAACTGTCAGTACAGACTATGATGAATGTGATCGATT
GTACTTCGATGAAATCACATTTGAGTTCTGAACTGGTTATCCGCAAGTAC
CGTTATGAATGCAACATTTTGCCCTGTTTCAAGCAAATTGACACTGTTGC
TGCAGAATTCCCAGCTGAAGCTAACTATCTGTATTTAACTTACAATGGAG
ATTGTGATGACGTCACATACGCAGAAAGCCAAAACAAAGTCATGGTTATT
GGGTCAGGTGTCTACAGAATCGGAAGCAGTGTTGAATTTGATGCATGTGC
TGTTGGATGTATTCGAGAATTGAAGAGGGTTGGAGCTGGAAAGGACACCA
TTCCATGCAATATCCTACTGAAGGGGAAGCAGCTTGGATTTTCAGATAAG
CAAATTGCTAACTGCGTTCAAAGGTCTTAGTTGAGCCCTCTGACAAAAGA
ATCTTTCATGTTGCTGCTGCACTCCGTAGAGGATATTCTATTGATCAGCT
GTATGAGCTCACTCGTATTGATAAGTGGTTTTTGAGCAAGCTAGCAAAAA
TAATCAACTATGCAAAAATGCTGGAAGAGAAATACCCAAAGATTGGATCT
TCGATGAAGAGTGTTGGTGAAGTAATGGCTATTGGAAGAAGTTTTGAGGA
AGCCATTCAAAAGAGTTTGAGAATGGTTGACGATTCAAACCTTGGTTTTG
ATGCAAACAACCTCGAGTTGGATGAACAGTTCTACATCATTGAGGTCAAT
GCTCGTCTCTCCAGAAGTTCAGCTCTTGCTTCCAAAGCAACTGGATACCC
ATTGGCTTACGTTGCTGCTAAACTTGCACTTGGTATTCCTCTACCAAAAC
TGAGAAATTCTGTCACCAATTCAACTACCGCTTGTTTTGAGCCCTCTTTG
GATTATTGTGTTGTGAAAGTTCCTCGATGGGATCTGGACAAATTTCAGAG
GGTTTCAACAAAGGTTTGTAATATGGAAAACTTTGACCCTTTGGGAATCC
ATACGGGTGAATCAATTGTTGTTGCACCAAGTCAAACACTAACAAATGAG
GAATACAATATGCTTAGAAGAACAGCCATCAAAGTCATCCGTAAACTTGG
TGTTGTTGGTGAATGTAACATCCAGTATGCTTTACACCCTGACTCAAAAG
AGGCTATCACAGCAGCTAACAGGCTAGGATATCCAGTGTTGTTACGTGCA
GCATTTGCACTAGGTGGACTTGGATCTGGTTTTGCTTCCAATGACAATGA
GCTCAAAAAGCTTGCAGCATCGGCTTTTGCACATTCCAAACAGTGTCTAG
TTGACAAGTCACTGAAAGGATGGAAAGAAGTTGAATATGAAGTTGTTAGA
GATGCTTATGACAACTGTATCACTGTGATTGAAGTAGAAAGACCAGATGG
CATTCTGTTATCATTTGGTGGACAAACAGCATTGAACTGTGGACTGCTAT
TGAAAGAGAGGGGAATTTTAGAGAAATACAATGTTGCTGTTCTTGGTACA
CCTACCAAATCGATTGAATGGACAGAAGATAGGAAAATGTTTTCAGACAA
GATGGGAGAGATTGGTGAGAAAGTTGCACCAAGCTCAGTGGCTTATACTG
TGGATGAGTCAAACCAAAGAAGGTCTTGATTTTGGGATCTGGTGGCTTAT
CTATTGGTCAAGCCGGAGAATTTGATTATTCTGGCTCTCAAGCTATCAAA
GCATTAAAAGAAGAGAAGATTCACACAGTTTTGATCAATCCTAATATTGC
TACAGTGCAAACTTCCAAAGGACTTGCAGATAAAACTTACTTCCTTCCTG
TTAACTTTGAATTCACAAGCAAGATATGGTAACAGAGGACATAACCAACC
TGCAACCCATTTGGAAACTCAACGTTGCTTCATCACTTGCCAAAATCATG
GCTTTGCAATTGACACAGACAGCTTACCAAAAGAATGGTCTGTTTTGTTT
ACAAATGAGAATGATGGCAGTAATGAAGGCATTGTTCACAACACAAAGCC
AATCTTCTCAGTTCAGTTTCATCCTGAACATCAAGGAGGACCAAGAGATT
TGGAGCTTTTGTTTGGCTTTTTTGTGGATATTGTAAACAAACTGAAAATC
GATTCTAACCTCTGCTTACGAACCATGCTGAAAGAAACGTTGACTTTCCA
CCCAGCAGAAGAAACAAGATCCAGAGCATAATATGATGGTCTGTTTATGA
GCAATGGTCCTGGAGATCCTAGCCTTTGTCAAGTTTCAATTGACACCCTC
CGTAAAGTCATTACAGAATTGCCAGATGTGCCAGTCTTTGGTATTTGCAT
GGGTCATCAGATCTTATCTCTTGCTGCTGGATGTGGGTCCTACAAAATGA
AGAACCTAAACTTTACAATCCTAAGGGTAAAATAAAGATGATTGCTGTAG
ACTTTGGTATCAAATACAACCAGATCCGGTGTTTGATTGATTGTGATTGT
CAGGTTCTAGTTGTTCCATGGGATTATGACTATAGTACATTGTTAAAGAA
CAAAGATTGTTTTGGATGGAGAGGATGAAGCAAGTGTTCCATTTGATGAT
CCAAACAAAAGGAATTTGATTGCTGAAGTCTCTTGCAAGGTATTGATACC
AGAGCATTAACAAAGAAGTTGAGAGAAAATGGAACAATGTTAGGAAAGTC
TTCCAAACTGGTATGGTTGGTTACCCAGAATCATTGACAGATCCTTCATA
CAACAGTCAAATCTTGGTATTGACGTATCCACTGATTGGTAATTATGGTA
TACCAAACGATTCTCGTGATGAACATGGCATGCTCAAATTTTTTGAATCT
GAAAAGATTTGGAACAATGGTATGATTGTAGGAGACTTGACTGAGGACTA
CAGCCATTGGTTGGCAACCAAATCACTTTCAGAGTGGCTGAAGGAACACA
AAATACCTGGAATTACTGATGGCGACACTTATTCTTGATGATGGCACCAA
ATATCATGGTCAAATTTTTGGTGATGAAAGAAGTATTGCAGGAGAAGTTG
TTGGCCATTAAGAACGCTCGCTGTGATTTCGCCTTGTACGCTGGTGCCAG
TTCAACCAATGCTCTAATGTTGCCAAAGATTGCACCAGGATGTGCTGGTC
TCAAAATGTACCTCAACGATACTTACACTACCTTGAAGATGGACAACCTC
NAAGATTGCACCAGGTTGTGCTGGTCTCAAAATGTACCTCAACGATACTT
ACACTACCTTGAAGATGGACAACCTCTCTGAGCATTGTTCAAAGTGGGCA
GCAAGATCGAAGTGAAAACACACATTGATTGCATTTCATCGGGAAACATT
GTGCGATTGCCAGGTCTCATTGATGTCCACGTACACTTGCGACAACCTGG
TGCCGAGTACAAAGAAGATTTCGATAGCGGTACTGCAGCCGCACTGGCCG
GTGGCGTCACCATGGTGCTGTGTATGCCGAACACCAAGCCAGCTGTGGTG
GATCAACCCACTTTCCAGCTTGCGCACCAAGTCCAAATCATTGATTGGCC
TTTCGAGGAGAATGGAACTGAGGGTCAGGAAGAGAGCATTCAAGACTACC
TCACACAGAACAAATTTGATTTGGTCATCAACATTCCAATGAGGGGTAGT
GGTACCAAGAAGAAGTCTCATTTCATCACACATGGATATCGCACCCGACG
AATGGCCATCGATCATTCCGTCTCATTGATCACCAACATTAAGTGTGCCA
AACTCTTCTGTGAAGCGAAGAAAGAAATGTTGCCAAGTGTTCGTTTACTG
GAGAAGATGGGATACGAATTGTATGCTAGCATGGGTACCGGTGACTTCTA
TCAAGAACATGGTGTACAGGTGCCACAATTTTCATTTTCACGACTTGCTG
GAGCTGACGTTCAACTTGGAGTAGAGATGGCAAGCACAGGAGAAGTAGCA
TGCTTCGGTGAAAATAGATACGAAGCTTACTTGAAGGCCTTGATGAGCAC
AGGTTTCAAATTACCCAAGAAAAACATACTGCTGACTGTTGGTAGTTATA
AGGACAATCAATTGAAGGTGATCGAATGCAATTTACGGGTGTCTCGGTCC
TTCCCTTTTGTTTCCAAAACTCTAGATTGTGATTTGGTTGCCTTGGCAAC
CAAAATCATCGTTGGTGCTCCTGCTGAACCTGCATTCAACATTATGGATA
AGTGTGAGAAGATCGGCTGTAAGGAAATTGACGTTGATGCCGTTGCCAAC
GACGGTGAAGTGATGGCCATGGTCGTCTCTGAACACGTTGAAAACGCGGG
TGTCCACTCTGGTGACGCAACCATGATCTGTCCACCACAAGACATCAATA
CGGAAACCATGGGACGGATCAAACAGATCTGTATTGCAGTTGGAAACGCC
CTCAATGTGTCTGGTCCTTTCAATATGCAACTTATTGCTAAGGAAGCCTA
TCAATTCTGCACCAAAGTTGGTTACCCAGTGCTGGTACGACCTTCATACG
TGTTGAGTGGAGCTGCCATGAATGTTGTTTATGCTGAAGATGATTTAGAA
TCATATCTTGGATCTGCTGTCTCCATCTCTAAGGAGCATCCAGTTGTCAT
CTCCAAATTTATATCCAATGCTAAAATGGAAAGAGTTGACCACGATGGAG
GTGAGGATCCTTGGCACATCGCCAGAAATGATTGACAACGCTGAAAACAG
ATTCAAATTCTCTCGTATGCTAGACAACATTGGAATCCTACAACCAACAC
AATCATGGATATCTACCATAAAGAAGACCCAGAAGGTATTATCTTATCAA
TGGGAGGACAGGTTGCCAACAACATTGCTATGCATCTCCACAGACAGGAA
CTTGGTAAGAGCACAATTATGGTGAATTACAATCCTGAAACTGTCAGTAC
AGACTATGATGAATGTGATCGATTGTACTTCGATGAAATCACATTTGAGT
TCTGAACTGGTTATCCGCAAGTACCGTTATGAATGCAACATTTTGCCCTG
TTTCAAGCAAATTGACACTGTTGCTGCAGAATTCCCAGCTGAAGCTAACT
ATCTGTATTTAACTTACAATGGAGATTGTGATGACGTCACATACGCAGAA
AGCCAAAACAAAGTCATGGTTATTGGGTCAGGTGTCTACAGAATCGGAAG
CAGTGTTGAATTTGATGCATGTGCTGTTGGATGTATTCGAGAATTGAAGA
GGGTTGGAGCTGGAAAGGACACCATTCCATGCAATATCCTACTGAAGGGG
AAGCAGCTTGGATTTTCAGATAAGCAAATTGCTAACTGCGTTCAAAGGTC
TTAGTTGAGCCCTCTGACAAAAGAATCTTTCATGTTGCTGCTGCACTCCG
TAGAGGATATTCTATTGATCAGCTGTATGAGCTCACTCGTATTGATAAGT
GGTTTTTGAGCAAGCTAGCAAAAATAATCAACTATGCAAAAATGCTGGAA
GAGAAATACCCAAAGATTGGATCTTCGATGAAGAGTGTTGGTGAAGTAAT
GGCTATTGGAAGAAGTTTTGAGGAAGCCATTCAAAAGAGTTTGAGAATGG
TTGACGATTCAAACCTTGGTTTTGATGCAAACAACCTCGAGTTGGATGAA
CAGTTCTACATCATTGAGGTCAATGCTCGTCTCTCCAGAAGTTCAGCTCT
TGCTTCCAAAGCAACTGGATACCCATTGGCTTACGTTGCTGCTAAACTTG
CACTTGGTATTCCTCTACCAAAACTGAGAAATTCTGTCACCAATTCAACT
ACCGCTTGTTTTGAGCCCTCTTTGGATTATTGTGTTGTGAAAGTTCCTCG
ATGGGATCTGGACAAATTTCAGAGGGTTTCAACAAAGGTTTGTAATATGG
AAAACTTTGACCCTTTGGGAATCCATACGGGTGAATCAATTGTTGTTGCA
CCAAGTCAAACACTAACAAATGAGGAATACAATATGCTTAGAAGAACAGC
CATCAAAGTCATCCGTAAACTTGGTGTTGTTGGTGAATGTAACATCCAGT
ATGCTTTACACCCTGACTCAAAAGAGGCTATCACAGCAGCTAACAGGCTA
GGATATCCAGTGTTGTTACGTGCAGCATTTGCACTAGGTGGACTTGGATC
TGGTTTTGCTTCCAATGACAATGAGCTCAAAAAGCTTGCAGCATCGGCTT
TTGCACATTCCAAACAGTGTCTAGTTGACAAGTCACTGAAAGGATGGAAA
GAAGTTGAATATGAAGTTGTTAGAGATGCTTATGACAACTGTATCACTGT
GATTGAAGTAGAAAGACCAGATGGCATTCTGTTATCATTTGGTGGACAAA
CAGCATTGAACTGTGGACTGCTATTGAAAGAGAGGGGAATTTTAGAGAAA
TACAATGTTGCTGTTCTTGGTACACCTACCAAATCGATTGAATGGACAGA
AGATAGGAAAATGTTTTCAGACAAGATGGGAGAGATTGGTGAGAAAGTTG
CACCAAGCTCAGTGGCTTATACTGTGGATGAGTCAAACCAAAGAAGGTCT
TGATTTTGGGATCTGGTGGCTTATCTATTGGTCAAGCCGGAGAATTTGAT
TATTCTGGCTCTCAAGCTATCAAAGCATTAAAAGAAGAGAAGATTCACAC
AGTTTTGATCAATCCTAATATTGCTACAGTGCAAACTTCCAAAGGACTTG
CAGATAAAACTTACTTCCTTCCTGTTAACTTTGAATTCACAAGCAAGATA
TGGTAACAGAGGACATAACCAACCTGCAACCCATTTGGAAACTCAACGTT
GCTTCATCACTTGCCAAAATCATGGCTTTGCAATTGACACAGACAGCTTA
CCAAAAGAATGGTCTGTTTTGTTTACAAATGAGAATGATGGCAGTAATGA
AGGCATTGTTCACAACACAAAGCCAATCTTCTCAGTTCAGTTTCATCCTG
AACATCAAGGAGGACCAAGAGATTTGGAGCTTTTGTTTGGCTTTTTTGTG
GATATTGTAAACAAACTGAAAATCGATTCTAACCTCTGCTTACGAACCAT
GCTGAAAGAAACGTTGACTTTCCACCCAGCAGAAGAAACAAGATCCAGAG
CATAATATGATGGTCTGTTTATGAGCAATGGTCCTGGAGATCCTAGCCTT
TGTCAAGTTTCAATTGACACCCTCCGTAAAGTCATTACAGAATTGCCAGA
TGTGCCAGTCTTTGGTATTTGCATGGGTCATCAGATCTTATCTCTTGCTG
CTGGATGTGGGTCCTACAAAATGAAGAACCTAAACTTTACAATCCTAAGG
GTAAAATAAAGATGATTGCTGTAGACTTTGGTATCAAATACAACCAGATC
CGGTGTTTGATTGATTGTGATTGTCAGGTTCTAGTTGTTCCATGGGATTA
TGACTATAGTACATTGTTAAAGAACAAAGATTGTTTTGGATGGAGAGGAT
GAAGCAAGTGTTCCATTTGATGATCCAAACAAAAGGAATTTGATTGCTGA
AGTCTCTTGCAAGGTATTGATACCAGAGCATTAACAAAGAAGTTGAGAGA
AAATGGAACAATGTTAGGAAAGTCTTCCAAACTGGTATGGTTGGTTACCC
AGAATCATTGACAGATCCTTCATACAACAGTCAAATCTTGGTATTGACGT
ATCCACTGATTGGTAATTATGGTATACCAAACGATTCTCGTGATGAACAT
GGCATGCTCAAATTTTTTGAATCTGAAAAGATTTGGAACAATGGTATGAT
TGTAGGAGACTTGACTGAGGACTACAGCCATTGGTTGGCAACCAAATCAC
TTTCAGAGTGGCTGAAGGAACACAAAATACCTGGAATTACTGATGGCGAC
ACTTATTCTTGATGATGGCACCAAATATCATGGTCAAATTTTTGGTGATG
AAAGAAGTATTGCAGGAGAAGTTGTTGGCCATTAAGAACGCTCGCTGTGA
TTTCGCCTTGTACGCTGGTGCCAGTTCAACCAATGCTCTAATGTTGCCAA
AGATTGCACCAGGATGTGCTGGTCTCAAAATGTACCTCAACGATACTTAC
ACTACCTTGAAGATGGACAACCTCNAAGATTGCACCAGGTTGTGCTGGTC
TCAAAATGTACCTCAACGATACTTACACTACCTTGAAGATGGACAACCTC
TCTGAGCATTGTTCAAAGTGGGCAGCAAGATCGAAGTGAAAACACACATT
GATTGCATTTCATCGGGAAACATTGTGCGATTGCCAGGTCTCATTGATGT
CCACGTACACTTGCGACAACCTGGTGCCGAGTACAAAGAAGATTTCGATA
GCGGTACTGCAGCCGCACTGGCCGGTGGCGTCACCATGGTGCTGTGTATG
CCGAACACCAAGCCAGCTGTGGTGGATCAACCCACTTTCCAGCTTGCGCA
CCAAGTCCAAATCATTGATTGGCCTTTCGAGGAGAATGGAACTGAGGGTC
AGGAAGAGAGCATTCAAGACTACCTCACACAGAACAAATTTGATTTGGTC
ATCAACATTCCAATGAGGGGTAGTGGTACCAAGAAGAAGTCTCATTTCAT
CACACATGGATATCGCACCCGACGAATGGCCATCGATCATTCCGTCTCAT
TGATCACCAACATTAAGTGTGCCAAACTCTTCTGTGAAGCGAAGAAAGAA
ATGTTGCCAAGTGTTCGTTTACTGGAGAAGATGGGATACGAATTGTATGC
TAGCATGGGTACCGGTGACTTCTATCAAGAACATGGTGTACAGGTGCCAC
AATTTTCATTTTCACGACTTGCTGGAGCTGACGTTCAACTTGGAGTAGAG
ATGGCAAGCACAGGAGAAGTAGCATGCTTCGGTGAAAATAGATACGAAGC
TTACTTGAAGGCCTTGATGAGCACAGGTTTCAAATTACCCAAGAAAAACA
TACTGCTGACTGTTGGTAGTTATAAGGACAATCAATTGAAGGTGATCGAA
TGCAATTTACGGGTGTCTCGGTCCTTCCCTTTTGTTTCCAAAACTCTAGA
TTGTGATTTGGTTGCCTTGGCAACCAAAATCATCGTTGGTGCTCCTGCTG
AACCTGCATTCAACATTATGGATAAGTGTGAGAAGATCGGCTGTAAGGAA
ATTGACGTTGATGCCGTTGCCAACGACGGTGAAGTGATGGCCATGGTCGT
CTCTGAACACGTTGAAAACGCGGGTGTCCACTCTGGTGACGCAACCATGA
TCTGTCCACCACAAGACATCAATACGGAAACCATGGGACGGATCAAACAG
ATCTGTATTGCAGTTGGAAACGCCCTCAATGTGTCTGGTCCTTTCAATAT
GCAACTTATTGCTAAGGAAGCCTATCAATTCTGCACCAAAGTTGGTTACC
CAGTGCTGGTACGACCTTCATACGTGTTGAGTGGAGCTGCCATGAATGTT
GTTTATGCTGAAGATGATTTAGAATCATATCTTGGATCTGCTGTCTCCAT
CTCTAAGGAGCATCCAGTTGTCATCTCCAAATTTATATCCAATGCTAAAA
TGGAAAGAGTTGACCACGATGGAGGTGAGGATCCTTGGCACATCGCCAGA
AATGATTGACAACGCTGAAAACAGATTCAAATTCTCTCGTATGCTAGACA
ACATTGGAATCCTACAACCAACACAATCATGGATATCTACCATAAAGAAG
ACCCAGAAGGTATTATCTTATCAATGGGAGGACAGGTTGCCAACAACATT
GCTATGCATCTCCACAGACAGGAACTTGGTAAGAGCACAATTATGGTGAA
TTACAATCCTGAAACTGTCAGTACAGACTATGATGAATGTGATCGATTGT
ACTTCGATGAAATCACATTTGAGTTCTGAACTGGTTATCCGCAAGTACCG
TTATGAATGCAACATTTTGCCCTGTTTCAAGCAAATTGACACTGTTGCTG
CAGAATTCCCAGCTGAAGCTAACTATCTGTATTTAACTTACAATGGAGAT
TGTGATGACGTCACATACGCAGAAAGCCAAAACAAAGTCATGGTTATTGG
GTCAGGTGTCTACAGAATCGGAAGCAGTGTTGAATTTGATGCATGTGCTG
TTGGATGTATTCGAGAATTGAAGAGGGTTGGAGCTGGAAAGGACACCATT
CCATGCAATATCCTACTGAAGGGGAAGCAGCTTGGATTTTCAGATAAGCA
AATTGCTAACTGCGTTCAAAGGTCTTAGTTGAGCCCTCTGACAAAAGAAT
CTTTCATGTTGCTGCTGCACTCCGTAGAGGATATTCTATTGATCAGCTGT
ATGAGCTCACTCGTATTGATAAGTGGTTTTTGAGCAAGCTAGCAAAAATA
ATCAACTATGCAAAAATGCTGGAAGAGAAATACCCAAAGATTGGATCTTC
GATGAAGAGTGTTGGTGAAGTAATGGCTATTGGAAGAAGTTTTGAGGAAG
CCATTCAAAAGAGTTTGAGAATGGTTGACGATTCAAACCTTGGTTTTGAT
GCAAACAACCTCGAGTTGGATGAACAGTTCTACATCATTGAGGTCAATGC
TCGTCTCTCCAGAAGTTCAGCTCTTGCTTCCAAAGCAACTGGATACCCAT
TGGCTTACGTTGCTGCTAAACTTGCACTTGGTATTCCTCTACCAAAACTG
AGAAATTCTGTCACCAATTCAACTACCGCTTGTTTTGAGCCCTCTTTGGA
TTATTGTGTTGTGAAAGTTCCTCGATGGGATCTGGACAAATTTCAGAGGG
TTTCAACAAAGGTTTGTAATATGGAAAACTTTGACCCTTTGGGAATCCAT
ACGGGTGAATCAATTGTTGTTGCACCAAGTCAAACACTAACAAATGAGGA
ATACAATATGCTTAGAAGAACAGCCATCAAAGTCATCCGTAAACTTGGTG
TTGTTGGTGAATGTAACATCCAGTATGCTTTACACCCTGACTCAAAAGAG
GCTATCACAGCAGCTAACAGGCTAGGATATCCAGTGTTGTTACGTGCAGC
ATTTGCACTAGGTGGACTTGGATCTGGTTTTGCTTCCAATGACAATGAGC
TCAAAAAGCTTGCAGCATCGGCTTTTGCACATTCCAAACAGTGTCTAGTT
GACAAGTCACTGAAAGGATGGAAAGAAGTTGAATATGAAGTTGTTAGAGA
TGCTTATGACAACTGTATCACTGTGATTGAAGTAGAAAGACCAGATGGCA
TTCTGTTATCATTTGGTGGACAAACAGCATTGAACTGTGGACTGCTATTG
AAAGAGAGGGGAATTTTAGAGAAATACAATGTTGCTGTTCTTGGTACACC
TACCAAATCGATTGAATGGACAGAAGATAGGAAAATGTTTTCAGACAAGA
TGGGAGAGATTGGTGAGAAAGTTGCACCAAGCTCAGTGGCTTATACTGTG
GATGAGTCAAACCAAAGAAGGTCTTGATTTTGGGATCTGGTGGCTTATCT
ATTGGTCAAGCCGGAGAATTTGATTATTCTGGCTCTCAAGCTATCAAAGC
ATTAAAAGAAGAGAAGATTCACACAGTTTTGATCAATCCTAATATTGCTA
CAGTGCAAACTTCCAAAGGACTTGCAGATAAAACTTACTTCCTTCCTGTT
AACTTTGAATTCACAAGCAAGATATGGTAACAGAGGACATAACCAACCTG
CAACCCATTTGGAAACTCAACGTTGCTTCATCACTTGCCAAAATCATGGC
TTTGCAATTGACACAGACAGCTTACCAAAAGAATGGTCTGTTTTGTTTAC
AAATGAGAATGATGGCAGTAATGAAGGCATTGTTCACAACACAAAGCCAA
TCTTCTCAGTTCAGTTTCATCCTGAACATCAAGGAGGACCAAGAGATTTG
GAGCTTTTGTTTGGCTTTTTTGTGGATATTGTAAACAAACTGAAAATCGA
TTCTAACCTCTGCTTACGAACCATGCTGAAAGAAACGTTGACTTTCCACC
CAGCAGAAGAAACAAGATCCAGAGCATAATATGATGGTCTGTTTATGAGC
AATGGTCCTGGAGATCCTAGCCTTTGTCAAGTTTCAATTGACACCCTCCG
TAAAGTCATTACAGAATTGCCAGATGTGCCAGTCTTTGGTATTTGCATGG
GTCATCAGATCTTATCTCTTGCTGCTGGATGTGGGTCCTACAAAATGAAG
AACCTAAACTTTACAATCCTAAGGGTAAAATAAAGATGATTGCTGTAGAC
TTTGGTATCAAATACAACCAGATCCGGTGTTTGATTGATTGTGATTGTCA
GGTTCTAGTTGTTCCATGGGATTATGACTATAGTACATTGTTAAAGAACA
AAGATTGTTTTGGATGGAGAGGATGAAGCAAGTGTTCCATTTGATGATCC
AAACAAAAGGAATTTGATTGCTGAAGTCTCTTGCAAGGTATTGATACCAG
AGCATTAACAAAGAAGTTGAGAGAAAATGGAACAATGTTAGGAAAGTCTT
CCAAACTGGTATGGTTGGTTACCCAGAATCATTGACAGATCCTTCATACA
ACAGTCAAATCTTGGTATTGACGTATCCACTGATTGGTAATTATGGTATA
CCAAACGATTCTCGTGATGAACATGGCATGCTCAAATTTTTTGAATCTGA
AAAGATTTGGAACAATGGTATGATTGTAGGAGACTTGACTGAGGACTACA
GCCATTGGTTGGCAACCAAATCACTTTCAGAGTGGCTGAAGGAACACAAA
ATACCTGGAATTACTGATGGCGACACTTATTCTTGATGATGGCACCAAAT
ATCATGGTCAAATTTTTGGTGATGAAAGAAGTATTGCAGGAGAAGTTGTT
GGCCATTAAGAACGCTCGCTGTGATTTCGCCTTGTACGCTGGTGCCAGTT
CAACCAATGCTCTAATGTTGCCAAAGATTGCACCAGGATGTGCTGGTCTC
AAAATGTACCTCAACGATACTTACACTACCTTGAAGATGGACAACCTCNA
AGATTGCACCAGGTTGTGCTGGTCTCAAAATGTACCTCAACGATACTTAC
ACTACCTTGAAGATGGACAACCTCTCTGAGCATTGTTCAAAGTGGGCAGC
AAGATCGAAGTGAAAACACACATTGATTGCATTTCATCGGGAAACATTGT
GCGATTGCCAGGTCTCATTGATGTCCACGTACACTTGCGACAACCTGGTG
CCGAGTACAAAGAAGATTTCGATAGCGGTACTGCAGCCGCACTGGCCGGT
GGCGTCACCATGGTGCTGTGTATGCCGAACACCAAGCCAGCTGTGGTGGA
TCAACCCACTTTCCAGCTTGCGCACCAAGTCCAAATCATTGATTGGCCTT
TCGAGGAGAATGGAACTGAGGGTCAGGAAGAGAGCATTCAAGACTACCTC
ACACAGAACAAATTTGATTTGGTCATCAACATTCCAATGAGGGGTAGTGG
TACCAAGAAGAAGTCTCATTTCATCACACATGGATATCGCACCCGACGAA
TGGCCATCGATCATTCCGTCTCATTGATCACCAACATTAAGTGTGCCAAA
CTCTTCTGTGAAGCGAAGAAAGAAATGTTGCCAAGTGTTCGTTTACTGGA
GAAGATGGGATACGAATTGTATGCTAGCATGGGTACCGGTGACTTCTATC
AAGAACATGGTGTACAGGTGCCACAATTTTCATTTTCACGACTTGCTGGA
GCTGACGTTCAACTTGGAGTAGAGATGGCAAGCACAGGAGAAGTAGCATG
CTTCGGTGAAAATAGATACGAAGCTTACTTGAAGGCCTTGATGAGCACAG
GTTTCAAATTACCCAAGAAAAACATACTGCTGACTGTTGGTAGTTATAAG
GACAATCAATTGAAGGTGATCGAATGCAATTTACGGGTGTCTCGGTCCTT
CCCTTTTGTTTCCAAAACTCTAGATTGTGATTTGGTTGCCTTGGCAACCA
AAATCATCGTTGGTGCTCCTGCTGAACCTGCATTCAACATTATGGATAAG
TGTGAGAAGATCGGCTGTAAGGAAATTGACGTTGATGCCGTTGCCAACGA
CGGTGAAGTGATGGCCATGGTCGTCTCTGAACACGTTGAAAACGCGGGTG
TCCACTCTGGTGACGCAACCATGATCTGTCCACCACAAGACATCAATACG
GAAACCATGGGACGGATCAAACAGATCTGTATTGCAGTTGGAAACGCCCT
CAATGTGTCTGGTCCTTTCAATATGCAACTTATTGCTAAGGAAGCCTATC
AATTCTGCACCAAAGTTGGTTACCCAGTGCTGGTACGACCTTCATACGTG
TTGAGTGGAGCTGCCATGAATGTTGTTTATGCTGAAGATGATTTAGAATC
ATATCTTGGATCTGCTGTCTCCATCTCTAAGGAGCATCCAGTTGTCATCT
CCAAATTTATATCCAATGCTAAAATGGAAAGAGTTGACCACGATGGAGGT
GAGGATCCTTGGCACATCGCCAGAAATGATTGACAACGCTGAAAACAGAT
TCAAATTCTCTCGTATGCTAGACAACATTGGAATCCTACAACCAACACAA
TCATGGATATCTACCATAAAGAAGACCCAGAAGGTATTATCTTATCAATG
GGAGGACAGGTTGCCAACAACATTGCTATGCATCTCCACAGACAGGAACT
TGGTAAGAGCACAATTATGGTGAATTACAATCCTGAAACTGTCAGTACAG
ACTATGATGAATGTGATCGATTGTACTTCGATGAAATCACATTTGAGTTC
TGAACTGGTTATCCGCAAGTACCGTTATGAATGCAACATTTTGCCCTGTT
TCAAGCAAATTGACACTGTTGCTGCAGAATTCCCAGCTGAAGCTAACTAT
CTGTATTTAACTTACAATGGAGATTGTGATGACGTCACATACGCAGAAAG
CCAAAACAAAGTCATGGTTATTGGGTCAGGTGTCTACAGAATCGGAAGCA
GTGTTGAATTTGATGCATGTGCTGTTGGATGTATTCGAGAATTGAAGAGG
GTTGGAGCTGGAAAGGACACCATTCCATGCAATATCCTACTGAAGGGGAA
GCAGCTTGGATTTTCAGATAAGCAAATTGCTAACTGCGTTCAAAGGTCTT
AGTTGAGCCCTCTGACAAAAGAATCTTTCATGTTGCTGCTGCACTCCGTA
GAGGATATTCTATTGATCAGCTGTATGAGCTCACTCGTATTGATAAGTGG
TTTTTGAGCAAGCTAGCAAAAATAATCAACTATGCAAAAATGCTGGAAGA
GAAATACCCAAAGATTGGATCTTCGATGAAGAGTGTTGGTGAAGTAATGG
CTATTGGAAGAAGTTTTGAGGAAGCCATTCAAAAGAGTTTGAGAATGGTT
GACGATTCAAACCTTGGTTTTGATGCAAACAACCTCGAGTTGGATGAACA
GTTCTACATCATTGAGGTCAATGCTCGTCTCTCCAGAAGTTCAGCTCTTG
CTTCCAAAGCAACTGGATACCCATTGGCTTACGTTGCTGCTAAACTTGCA
CTTGGTATTCCTCTACCAAAACTGAGAAATTCTGTCACCAATTCAACTAC
CGCTTGTTTTGAGCCCTCTTTGGATTATTGTGTTGTGAAAGTTCCTCGAT
GGGATCTGGACAAATTTCAGAGGGTTTCAACAAAGGTTTGTAATATGGAA
AACTTTGACCCTTTGGGAATCCATACGGGTGAATCAATTGTTGTTGCACC
AAGTCAAACACTAACAAATGAGGAATACAATATGCTTAGAAGAACAGCCA
TCAAAGTCATCCGTAAACTTGGTGTTGTTGGTGAATGTAACATCCAGTAT
GCTTTACACCCTGACTCAAAAGAGGCTATCACAGCAGCTAACAGGCTAGG
ATATCCAGTGTTGTTACGTGCAGCATTTGCACTAGGTGGACTTGGATCTG
GTTTTGCTTCCAATGACAATGAGCTCAAAAAGCTTGCAGCATCGGCTTTT
GCACATTCCAAACAGTGTCTAGTTGACAAGTCACTGAAAGGATGGAAAGA
AGTTGAATATGAAGTTGTTAGAGATGCTTATGACAACTGTATCACTGTGA
TTGAAGTAGAAAGACCAGATGGCATTCTGTTATCATTTGGTGGACAAACA
GCATTGAACTGTGGACTGCTATTGAAAGAGAGGGGAATTTTAGAGAAATA
CAATGTTGCTGTTCTTGGTACACCTACCAAATCGATTGAATGGACAGAAG
ATAGGAAAATGTTTTCAGACAAGATGGGAGAGATTGGTGAGAAAGTTGCA
CCAAGCTCAGTGGCTTATACTGTGGATGAGTCAAACCAAAGAAGGTCTTG
ATTTTGGGATCTGGTGGCTTATCTATTGGTCAAGCCGGAGAATTTGATTA
TTCTGGCTCTCAAGCTATCAAAGCATTAAAAGAAGAGAAGATTCACACAG
TTTTGATCAATCCTAATATTGCTACAGTGCAAACTTCCAAAGGACTTGCA
GATAAAACTTACTTCCTTCCTGTTAACTTTGAATTCACAAGCAAGATATG
GTAACAGAGGACATAACCAACCTGCAACCCATTTGGAAACTCAACGTTGC
TTCATCACTTGCCAAAATCATGGCTTTGCAATTGACACAGACAGCTTACC
AAAAGAATGGTCTGTTTTGTTTACAAATGAGAATGATGGCAGTAATGAAG
GCATTGTTCACAACACAAAGCCAATCTTCTCAGTTCAGTTTCATCCTGAA
CATCAAGGAGGACCAAGAGATTTGGAGCTTTTGTTTGGCTTTTTTGTGGA
TATTGTAAACAAACTGAAAATCGATTCTAACCTCTGCTTACGAACCATGC
TGAAAGAAACGTTGACTTTCCACCCAGCAGAAGAAACAAGATCCAGAGCA
TAATATGATGGTCTGTTTATGAGCAATGGTCCTGGAGATCCTAGCCTTTG
TCAAGTTTCAATTGACACCCTCCGTAAAGTCATTACAGAATTGCCAGATG
TGCCAGTCTTTGGTATTTGCATGGGTCATCAGATCTTATCTCTTGCTGCT
GGATGTGGGTCCTACAAAATGAAGAACCTAAACTTTACAATCCTAAGGGT
AAAATAAAGATGATTGCTGTAGACTTTGGTATCAAATACAACCAGATCCG
GTGTTTGATTGATTGTGATTGTCAGGTTCTAGTTGTTCCATGGGATTATG
ACTATAGTACATTGTTAAAGAACAAAGATTGTTTTGGATGGAGAGGATGA
AGCAAGTGTTCCATTTGATGATCCAAACAAAAGGAATTTGATTGCTGAAG
TCTCTTGCAAGGTATTGATACCAGAGCATTAACAAAGAAGTTGAGAGAAA
ATGGAACAATGTTAGGAAAGTCTTCCAAACTGGTATGGTTGGTTACCCAG
AATCATTGACAGATCCTTCATACAACAGTCAAATCTTGGTATTGACGTAT
CCACTGATTGGTAATTATGGTATACCAAACGATTCTCGTGATGAACATGG
CATGCTCAAATTTTTTGAATCTGAAAAGATTTGGAACAATGGTATGATTG
TAGGAGACTTGACTGAGGACTACAGCCATTGGTTGGCAACCAAATCACTT
TCAGAGTGGCTGAAGGAACACAAAATACCTGGAATTACTGATGGCGACAC
TTATTCTTGATGATGGCACCAAATATCATGGTCAAATTTTTGGTGATGAA
AGAAGTATTGCAGGAGAAGTTG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000986XLOC_000986Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001872-exon-sc0000012-1575043694:121171..121470TCONS_00001872-exon-sc0000012-1575043694:121171..121470Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1575043694:115414..115504TCONS_00001872-exon-sc0000012-1575043694:115414..115504Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1575043694:114767..115036TCONS_00001872-exon-sc0000012-1575043694:114767..115036Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1575043694:114254..114312TCONS_00001872-exon-sc0000012-1575043694:114254..114312Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1575043694:113854..113937TCONS_00001872-exon-sc0000012-1575043694:113854..113937Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1575043694:113378..113531TCONS_00001872-exon-sc0000012-1575043694:113378..113531Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1575043694:112150..112321TCONS_00001872-exon-sc0000012-1575043694:112150..112321Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1575043694:111614..111969TCONS_00001872-exon-sc0000012-1575043694:111614..111969Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1575043694:111092..111306TCONS_00001872-exon-sc0000012-1575043694:111092..111306Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1575043694:110368..110601TCONS_00001872-exon-sc0000012-1575043694:110368..110601Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1575043694:109900..110121TCONS_00001872-exon-sc0000012-1575043694:109900..110121Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1575043694:106941..107129TCONS_00001872-exon-sc0000012-1575043694:106941..107129Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1575043694:106357..106590TCONS_00001872-exon-sc0000012-1575043694:106357..106590Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1575043694:105977..106114TCONS_00001872-exon-sc0000012-1575043694:105977..106114Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1575043694:105379..105546TCONS_00001872-exon-sc0000012-1575043694:105379..105546Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1575043694:105043..105137TCONS_00001872-exon-sc0000012-1575043694:105043..105137Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1575043694:103332..103584TCONS_00001872-exon-sc0000012-1575043694:103332..103584Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1575043694:103000..103098TCONS_00001872-exon-sc0000012-1575043694:103000..103098Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1575043694:102698..102799TCONS_00001872-exon-sc0000012-1575043694:102698..102799Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1575043694:102341..102438TCONS_00001872-exon-sc0000012-1575043694:102341..102438Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1575043694:101170..101194TCONS_00001872-exon-sc0000012-1575043694:101170..101194Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1575043694:100208..100390TCONS_00001872-exon-sc0000012-1575043694:100208..100390Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1575043694:99260..99478TCONS_00001872-exon-sc0000012-1575043694:99260..99478Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1575043694:98788..98958TCONS_00001872-exon-sc0000012-1575043694:98788..98958Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1575043694:98229..98411TCONS_00001872-exon-sc0000012-1575043694:98229..98411Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1575043694:97837..97941TCONS_00001872-exon-sc0000012-1575043694:97837..97941Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1575043694:97198..97431TCONS_00001872-exon-sc0000012-1575043694:97198..97431Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1575043694:96509..96757TCONS_00001872-exon-sc0000012-1575043694:96509..96757Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1575043694:95761..96133TCONS_00001872-exon-sc0000012-1575043694:95761..96133Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1575043694:95253..95454TCONS_00001872-exon-sc0000012-1575043694:95253..95454Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1575043694:93420..93596TCONS_00001872-exon-sc0000012-1575043694:93420..93596Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1575043694:91247..91401TCONS_00001872-exon-sc0000012-1575043694:91247..91401Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1575043694:89880..90099TCONS_00001872-exon-sc0000012-1575043694:89880..90099Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1575043694:89631..89743TCONS_00001872-exon-sc0000012-1575043694:89631..89743Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1575043694:89187..89261TCONS_00001872-exon-sc0000012-1575043694:89187..89261Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1575043694:88625..88766TCONS_00001872-exon-sc0000012-1575043694:88625..88766Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1575043694:78642..78712TCONS_00001872-exon-sc0000012-1575043694:78642..78712Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1575043694:77164..77289TCONS_00001872-exon-sc0000012-1575043694:77164..77289Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1575043694:76296..76357TCONS_00001872-exon-sc0000012-1575043694:76296..76357Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1575043694:74367..74460TCONS_00001872-exon-sc0000012-1575043694:74367..74460Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1575043694:65803..65904TCONS_00001872-exon-sc0000012-1575043694:65803..65904Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1575043694:63462..63556TCONS_00001872-exon-sc0000012-1575043694:63462..63556Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1575043694:62297..63149TCONS_00001872-exon-sc0000012-1575043694:62297..63149Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1510915933:121171..121470TCONS_00001872-exon-sc0000012-1510915933:121171..121470Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1510915933:115414..115504TCONS_00001872-exon-sc0000012-1510915933:115414..115504Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1510915933:114767..115036TCONS_00001872-exon-sc0000012-1510915933:114767..115036Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1510915933:114254..114312TCONS_00001872-exon-sc0000012-1510915933:114254..114312Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1510915933:113854..113937TCONS_00001872-exon-sc0000012-1510915933:113854..113937Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1510915933:113378..113531TCONS_00001872-exon-sc0000012-1510915933:113378..113531Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1510915933:112150..112321TCONS_00001872-exon-sc0000012-1510915933:112150..112321Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1510915933:111614..111969TCONS_00001872-exon-sc0000012-1510915933:111614..111969Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1510915933:111092..111306TCONS_00001872-exon-sc0000012-1510915933:111092..111306Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1510915933:110368..110601TCONS_00001872-exon-sc0000012-1510915933:110368..110601Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1510915933:109900..110121TCONS_00001872-exon-sc0000012-1510915933:109900..110121Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1510915933:106941..107129TCONS_00001872-exon-sc0000012-1510915933:106941..107129Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1510915933:106357..106590TCONS_00001872-exon-sc0000012-1510915933:106357..106590Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1510915933:105977..106114TCONS_00001872-exon-sc0000012-1510915933:105977..106114Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1510915933:105379..105546TCONS_00001872-exon-sc0000012-1510915933:105379..105546Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1510915933:105043..105137TCONS_00001872-exon-sc0000012-1510915933:105043..105137Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1510915933:103332..103584TCONS_00001872-exon-sc0000012-1510915933:103332..103584Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1510915933:103000..103098TCONS_00001872-exon-sc0000012-1510915933:103000..103098Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1510915933:102698..102799TCONS_00001872-exon-sc0000012-1510915933:102698..102799Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1510915933:102341..102438TCONS_00001872-exon-sc0000012-1510915933:102341..102438Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1510915933:101170..101194TCONS_00001872-exon-sc0000012-1510915933:101170..101194Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1510915933:100208..100390TCONS_00001872-exon-sc0000012-1510915933:100208..100390Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1510915933:99260..99478TCONS_00001872-exon-sc0000012-1510915933:99260..99478Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1510915933:98788..98958TCONS_00001872-exon-sc0000012-1510915933:98788..98958Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1510915933:98229..98411TCONS_00001872-exon-sc0000012-1510915933:98229..98411Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1510915933:97837..97941TCONS_00001872-exon-sc0000012-1510915933:97837..97941Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1510915933:97198..97431TCONS_00001872-exon-sc0000012-1510915933:97198..97431Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1510915933:96509..96757TCONS_00001872-exon-sc0000012-1510915933:96509..96757Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1510915933:95761..96133TCONS_00001872-exon-sc0000012-1510915933:95761..96133Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1510915933:95253..95454TCONS_00001872-exon-sc0000012-1510915933:95253..95454Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1510915933:93420..93596TCONS_00001872-exon-sc0000012-1510915933:93420..93596Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1510915933:91247..91401TCONS_00001872-exon-sc0000012-1510915933:91247..91401Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1510915933:89880..90099TCONS_00001872-exon-sc0000012-1510915933:89880..90099Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1510915933:89631..89743TCONS_00001872-exon-sc0000012-1510915933:89631..89743Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1510915933:89187..89261TCONS_00001872-exon-sc0000012-1510915933:89187..89261Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1510915933:88625..88766TCONS_00001872-exon-sc0000012-1510915933:88625..88766Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1510915933:78642..78712TCONS_00001872-exon-sc0000012-1510915933:78642..78712Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1510915933:77164..77289TCONS_00001872-exon-sc0000012-1510915933:77164..77289Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1510915933:76296..76357TCONS_00001872-exon-sc0000012-1510915933:76296..76357Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1510915933:74367..74460TCONS_00001872-exon-sc0000012-1510915933:74367..74460Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1510915933:65803..65904TCONS_00001872-exon-sc0000012-1510915933:65803..65904Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1510915933:63462..63556TCONS_00001872-exon-sc0000012-1510915933:63462..63556Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1510915933:62297..63149TCONS_00001872-exon-sc0000012-1510915933:62297..63149Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1491911889:121171..121470TCONS_00001872-exon-sc0000012-1491911889:121171..121470Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1491911889:115414..115504TCONS_00001872-exon-sc0000012-1491911889:115414..115504Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1491911889:114767..115036TCONS_00001872-exon-sc0000012-1491911889:114767..115036Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1491911889:114254..114312TCONS_00001872-exon-sc0000012-1491911889:114254..114312Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1491911889:113854..113937TCONS_00001872-exon-sc0000012-1491911889:113854..113937Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1491911889:113378..113531TCONS_00001872-exon-sc0000012-1491911889:113378..113531Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1491911889:112150..112321TCONS_00001872-exon-sc0000012-1491911889:112150..112321Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1491911889:111614..111969TCONS_00001872-exon-sc0000012-1491911889:111614..111969Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1491911889:111092..111306TCONS_00001872-exon-sc0000012-1491911889:111092..111306Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1491911889:110368..110601TCONS_00001872-exon-sc0000012-1491911889:110368..110601Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1491911889:109900..110121TCONS_00001872-exon-sc0000012-1491911889:109900..110121Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1491911889:106941..107129TCONS_00001872-exon-sc0000012-1491911889:106941..107129Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1491911889:106357..106590TCONS_00001872-exon-sc0000012-1491911889:106357..106590Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1491911889:105977..106114TCONS_00001872-exon-sc0000012-1491911889:105977..106114Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1491911889:105379..105546TCONS_00001872-exon-sc0000012-1491911889:105379..105546Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1491911889:105043..105137TCONS_00001872-exon-sc0000012-1491911889:105043..105137Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1491911889:103332..103584TCONS_00001872-exon-sc0000012-1491911889:103332..103584Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1491911889:103000..103098TCONS_00001872-exon-sc0000012-1491911889:103000..103098Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1491911889:102698..102799TCONS_00001872-exon-sc0000012-1491911889:102698..102799Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1491911889:102341..102438TCONS_00001872-exon-sc0000012-1491911889:102341..102438Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1491911889:101170..101194TCONS_00001872-exon-sc0000012-1491911889:101170..101194Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1491911889:100208..100390TCONS_00001872-exon-sc0000012-1491911889:100208..100390Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1491911889:99260..99478TCONS_00001872-exon-sc0000012-1491911889:99260..99478Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1491911889:98788..98958TCONS_00001872-exon-sc0000012-1491911889:98788..98958Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1491911889:98229..98411TCONS_00001872-exon-sc0000012-1491911889:98229..98411Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1491911889:97837..97941TCONS_00001872-exon-sc0000012-1491911889:97837..97941Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1491911889:97198..97431TCONS_00001872-exon-sc0000012-1491911889:97198..97431Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1491911889:96509..96757TCONS_00001872-exon-sc0000012-1491911889:96509..96757Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1491911889:95761..96133TCONS_00001872-exon-sc0000012-1491911889:95761..96133Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1491911889:95253..95454TCONS_00001872-exon-sc0000012-1491911889:95253..95454Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1491911889:93420..93596TCONS_00001872-exon-sc0000012-1491911889:93420..93596Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1491911889:91247..91401TCONS_00001872-exon-sc0000012-1491911889:91247..91401Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1491911889:89880..90099TCONS_00001872-exon-sc0000012-1491911889:89880..90099Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1491911889:89631..89743TCONS_00001872-exon-sc0000012-1491911889:89631..89743Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1491911889:89187..89261TCONS_00001872-exon-sc0000012-1491911889:89187..89261Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1491911889:88625..88766TCONS_00001872-exon-sc0000012-1491911889:88625..88766Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1491911889:78642..78712TCONS_00001872-exon-sc0000012-1491911889:78642..78712Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1491911889:77164..77289TCONS_00001872-exon-sc0000012-1491911889:77164..77289Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1491911889:76296..76357TCONS_00001872-exon-sc0000012-1491911889:76296..76357Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1491911889:74367..74460TCONS_00001872-exon-sc0000012-1491911889:74367..74460Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1491911889:65803..65904TCONS_00001872-exon-sc0000012-1491911889:65803..65904Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1491911889:63462..63556TCONS_00001872-exon-sc0000012-1491911889:63462..63556Clytia hemisphaericaexon
TCONS_00001872-exon-sc0000012-1491911889:62297..63149TCONS_00001872-exon-sc0000012-1491911889:62297..63149Clytia hemisphaericaexon
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
CAD like proteinTCONS_00001872-proteinClytia hemisphaericapolypeptide
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000012supercontigsc0000012:62297..121470 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
18.7986 18.1843 4.35916 2.34112 26.931 19.0486 5.00615 6.93193 3.87686 6.15651 7.8351 7.74111 7.04449 8.6853 9.12503 14.0943 6.64855 6.78819 2.95529 3.11443 7.10693 7.36285 18.8215 18.9886 2.70467 2.8348 3.2121 4.03986 16.3165 18.8891
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR005483CbamoylP_synth_lsu_CPSase_dom
IPR002474CarbamoylP_synth_ssu_N
IPR005480CarbamoylP_synth_lsu_oligo
IPR011607MGS-like_dom
IPR006274CarbamoylP_synth_ssu
IPR011059Metal-dep_hydrolase_composite
IPR006275CarbamoylP_synth_lsu
IPR029062Class_I_gatase-like
IPR017926GATASE
IPR005479CbamoylP_synth_lsu-like_ATP-bd
IPR006680Amidohydro-rel
IPR002195Dihydroorotase_CS
IPR011761ATP-grasp
IPR016185PreATP-grasp_dom
IPR032466Metal_Hydrolase
Vocabulary: Biological Process
TermDefinition
GO:0006807nitrogen compound metabolic process
GO:0006541glutamine metabolic process
GO:0006207'de novo' pyrimidine nucleobase biosynthetic process
Vocabulary: Molecular Function
TermDefinition
GO:0004088carbamoyl-phosphate synthase (glutamine-hydrolyzing) activity
GO:0016810hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds
GO:0005524ATP binding
GO:0016787hydrolase activity
GO:0016812hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in cyclic amides
GO:0046872metal ion binding
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006207 'de novo' pyrimidine nucleobase biosynthetic process
biological_process GO:0006541 glutamine metabolic process
biological_process GO:0006807 nitrogen compound metabolic process
molecular_function GO:0005524 ATP binding
molecular_function GO:0004088 carbamoyl-phosphate synthase (glutamine-hydrolyzing) activity
molecular_function GO:0016787 hydrolase activity
molecular_function GO:0016810 hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds
molecular_function GO:0016812 hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in cyclic amides
molecular_function GO:0046872 metal ion binding
Blast
BLAST of TCONS_00001872 vs. Swiss-Prot (Human)
Match: PYR1 (CAD protein OS=Homo sapiens GN=CAD PE=1 SV=3)

HSP 1 Score: 2035.38 bits (5272), Expect = 0.000e+0
Identity = 1027/1600 (64.19%), Postives = 1246/1600 (77.88%), Query Frame = 1
Query:  310 MATLILDDGTKYHGQIFGDERSIAGEVVFQTGMVGYPESLTDPSYNSQILVLTYPLIGNYGIPNDSRDEHGMLKFFESEKIWNNGMIVGDLTEDYSHWLATKSLSEWLKEHKIPGITGIDTRALTKKLRENGTMLGKIVLDGEDEASVPFDDPNKRNLIAEVSCKEPKLYNPKGKIKMIAVDFGIKYNQIRCLIDCDCQVLVVPWDYDYSTLLKNKEYDGLFMSNGPGDPSLCQVSIDTLRKVITELPDVPVFGICMGHQILSLAAGCGSYKMKYGNRGHNQPATHLETQRCFITCQNHGFAIDTDSLPKEWSVLFTNENDGSNEGIVHNTKPIFSVQFHPEHQGGPRDLELLFGFFVDIVNKLKIDS--NLCLRTMLKETLTFHPAEETRSRAFKPKKVXXXXXXXXXXXQAGEFDYSGSQAIKALKEEKIHTVLINPNIATVQTSKGLADKTYFLPVNFEFTSKVIEVERPDGILLSFGGQTALNCGLLLKERGILEKYNVAVLGTPTKSIEWTEDRKMFSDKMGEIGEKVAPSSVAYTVDEAITAANRLGYPVXXXXXXXXXXXXXXXXXNDNELKKLAASAFAHSKQCLVDKSLKGWKEVEYEVVRDAYDNCITVCNMENFDPLGIHTGESIVVAPSQTLTNEEYNMLRRTAIKVIRKLGVVGECNIQYALHPDSKEFYIIEVNXXXXXXXXXXXXXTGYPLAYVAAKLALGIPLPKLRNSVTNSTTACFEPSLDYCVVKVPRWDLDKFQRVSTKIGSSMKSVGEVMAIGRSFEEAIQKSLRMVDDSNLGFDANNLELDEQVLVEPSDKRIFHVAAALRRGYSIDQLYELTRIDKWFLSKLAKIINYAKMLEEKYPKVGAGKDTIPCNILLKGKQLGFSDKQIANCVQSSELVIRKYRYECNILPCFKQIDTVAAEFPAEANYLYLTYNGDCDDVTYAESQNKVMVIGSGVYRIGSSVEFDACAVGCIRELKRLGKSTIMVNYNPETVSTDYDECDRLYFDEITFETIMDIYHKEDPEGIILSMGGQVANNIAMHLHRQEVRILGTSPEMIDNAENRFKFSRMLDNIGILQPTWKELTTMEEAYQFCTKVGYPVLVRPSYVLSGAAMNVVYAEDDLESYLGSAVSISKEHPVVISKFISNAKEIDVDAVANDGEVMAMVVSEHVENAGVHSGDATMICPPQDINTETMGRIKQICIAVGNALNVSGPFNMQLIAKDNQLKVIECNLRVSRSFPFVSKTLDCDLVALATKIIVGAPAEPAFNIMDKCEKIGCKVPQFSFSRLAGADVQLGVEMASTGEVACFGENRYEAYLKALMSTGFKLPKKNILLTVGSYKAKKEMLPSVRLLEKMGYELYASMGTGDFYQEHGVQVQIIDWPFEE--NGTEGQEESIQDYLTQNKFDLVINIPMRGSGTKKKSHFITHGYRTRRMAIDHSVSLITNIKCAKLFCEALFKVGSKIEVKTHIDCISSGNIVRLPGLIDVHVHLRQPGAEYKEDFDSGTAAALAGGVTMVLCMPNTKPAVVDQPTFQLAHQLAIKNARCDFALYAGASSTNALMLPKIAPGCAGLKMYLNDTYTTLKMDNLXDCTRL--CWSQNVP 5091
            MA L+L+DG+   GQ FG   S AGEVVFQTGMVGYPE+LTDPSY +QILVLTYPLIGNYGIP D  DE G+ K+FES  I    ++VG+     SHW AT++L EWL++H IPG+ G+DTR LTKKLRE G++LGK+V +G + +S+PF DPN R L+ EVS K P+++N  G  +++A+D G+KYNQIRCL     +V VVPWD+     L ++EY+GLF+SNGPGDP+     + TL +V++E    PVFGIC+GHQ+L+LA G  +YKM+YGNRGHNQP   + + RCF+T QNHGFA++TDSLP +W+ LFTN NDGSNEGIVHN+ P FSVQFHPEHQ GP D+ELLF  F++ V +    +     +R  L E L         S    P+KVLILGSGGLSIGQAGEFDYSGSQAIKALKEE I T+LINPNIATVQTS+GLADK YFLP+   + ++VI  ERPDG+LL+FGGQTALNCG+ L + G+L +Y V VLGTP ++IE TEDR+ F+ +M EIGE VAPS  A ++++A  AA RLGYPVL+RAAFALGGLGSGFASN  EL  L A AFAH+ Q LVDKSLKGWKE+EYEVVRDAY NC+TVCNMEN DPLGIHTGESIVVAPSQTL + EY +LR+TAIKV + LG+VGECN+QYAL+P+S+++YIIEVNARLSRSSALASKATGYPLAYVAAKLALGIPLP+LRNSVT  T A FEPS+DYCVVK+PRWDL KF RVSTKIGS MKSVGEVM IGRSFEEA QK+LRMVD++ +GFD     + +  L  P+DKRIF VAAAL  GYS+D+LYELTRID+WFL ++ +II +A++LE+           +P ++L + K LGFSDKQIA  V S+EL +RK R E  I P  KQIDTVAAE+PA+ NYLYLTY G   D+T+      V+V+GSGVYRIGSSVEFD CAVGCI++L+++G  TIMVNYNPETVSTDYD CDRLYFDEI+FE +MDIY  E+PEG+ILSMGGQ+ NN+AM LHRQ+ R+LGTSPE ID+AENRFKFSR+LD IGI QP W+EL+ +E A QFC  VGYP +VRPSYVLSGAAMNV Y + DLE +L SA ++SKEHPVVISKFI  AKEIDVDAVA+DG V A+ +SEHVENAGVHSGDAT++ PPQDI  +T+ RIK I  AVG  L V+GPFN+QLIAKD+QLKVIECN+RVSRSFPFVSKTL  DLVALAT++I+G   EP   +M     +G KVPQFSFSRLAGADV LGVEM STGEVA FGE+R EAYLKA++STGFK+PKKNILLT+GSYK K E+LP+VRLLE +GY LYAS+GT DFY EHGV+V  +DW FEE  +G    + SI + L +  F+LVIN+ MRG+G ++ S F+T GYRTRR+A D SV LI +IKC KLF EAL ++G    +K H+DC++S  +VRLPGLIDVHVHLR+PG  +KEDF SGTAAALAGG+TMV  MPNT+P ++D P   LA +LA   ARCDFAL+ GASS NA  L  +A   AGLK+YLN+T++ L++D++         W  ++P
Sbjct:    1 MAALVLEDGSVLRGQPFGAAVSTAGEVVFQTGMVGYPEALTDPSYKAQILVLTYPLIGNYGIPPDEMDEFGLCKWFESSGIHVAALVVGECCPTPSHWSATRTLHEWLQQHGIPGLQGVDTRELTKKLREQGSLLGKLVQNGTEPSSLPFLDPNARPLVPEVSIKTPRVFNTGGAPRILALDCGLKYNQIRCLCQRGAEVTVVPWDHA----LDSQEYEGLFLSNGPGDPASYPSVVSTLSRVLSEPNPRPVFGICLGHQLLALAIGAKTYKMRYGNRGHNQPCLLVGSGRCFLTSQNHGFAVETDSLPADWAPLFTNANDGSNEGIVHNSLPFFSVQFHPEHQAGPSDMELLFDIFLETVKEATAGNPGGQTVRERLTERLCPPGIPTPGSGLPPPRKVLILGSGGLSIGQAGEFDYSGSQAIKALKEENIQTLLINPNIATVQTSQGLADKVYFLPITPHYVTQVIRNERPDGVLLTFGGQTALNCGVELTKAGVLARYGVRVLGTPVETIELTEDRRAFAARMAEIGEHVAPSEAANSLEQAQAAAERLGYPVLVRAAFALGGLGSGFASNREELSALVAPAFAHTSQVLVDKSLKGWKEIEYEVVRDAYGNCVTVCNMENLDPLGIHTGESIVVAPSQTLNDREYQLLRQTAIKVTQHLGIVGECNVQYALNPESEQYYIIEVNARLSRSSALASKATGYPLAYVAAKLALGIPLPELRNSVTGGT-AAFEPSVDYCVVKIPRWDLSKFLRVSTKIGSCMKSVGEVMGIGRSFEEAFQKALRMVDENCVGFDHTVKPVSDMELETPTDKRIFVVAAALWAGYSVDRLYELTRIDRWFLHRMKRIIAHAQLLEQHR------GQPLPPDLLQQAKCLGFSDKQIALAVLSTELAVRKLRQELGICPAVKQIDTVAAEWPAQTNYLYLTYWGTTHDLTFRTPH--VLVLGSGVYRIGSSVEFDWCAVGCIQQLRKMGYKTIMVNYNPETVSTDYDMCDRLYFDEISFEVVMDIYELENPEGVILSMGGQLPNNMAMALHRQQCRVLGTSPEAIDSAENRFKFSRLLDTIGISQPQWRELSDLESARQFCQTVGYPCVVRPSYVLSGAAMNVAYTDGDLERFLSSAAAVSKEHPVVISKFIQEAKEIDVDAVASDGVVAAIAISEHVENAGVHSGDATLVTPPQDITAKTLERIKAIVHAVGQELQVTGPFNLQLIAKDDQLKVIECNVRVSRSFPFVSKTLGVDLVALATRVIMGEEVEPV-GLMTGSGVVGVKVPQFSFSRLAGADVVLGVEMTSTGEVAGFGESRCEAYLKAMLSTGFKIPKKNILLTIGSYKNKSELLPTVRLLESLGYSLYASLGTADFYTEHGVKVTAVDWHFEEAVDGECPPQRSILEQLAEKNFELVINLSMRGAGGRRLSSFVTKGYRTRRLAADFSVPLIIDIKCTKLFVEALGQIGPAPPLKVHVDCMTSQKLVRLPGLIDVHVHLREPGGTHKEDFASGTAAALAGGITMVCAMPNTRPPIIDAPALALAQKLAEAGARCDFALFLGASSENAGTLGTVAGSAAGLKLYLNETFSELRLDSVVQWMEHFETWPSHLP 1586          

HSP 2 Score: 766.918 bits (1979), Expect = 0.000e+0
Identity = 383/695 (55.11%), Postives = 486/695 (69.93%), Query Frame = 2
Query: 5045 TTSKIAPGCAGLKMYLNDTYTTLKMDNLSDWMKHFENWPKHLPIVCHAESQTTAAVILMSELYNRPVHIAHVARKEEILVIKAAKKKGLQVTCEVAPHHLFLSTDDTKRIGEGRARVKPQICSAEDQKALWENMDFIDCFATDHAPHHVDEKNSENPPPGFPGLETMLPLLLTAVKDGRLTLDDVILRLHTNPRRIFGLPEQHDTYVEVDLNEEWTIPDAMAYTKSKWTPFAGMKVFGKVCRVVVRGELAVIEDQVLAKPGFGEDVRAWE-------PPNC--------------------------LPP-LSKAQKQKLDAINNEQPTPANLPDIEQPSLLSGP------PTPIRKISNIMEKLHTQDGLSAEXXXXXXXXXXXXXSQLLVGKHVLKVESINKDQLNALFNIAQQLKKEERRGRQIDTLKGKVLALMFFEPSTRTACSFQSAMQRLGGTTIAIKPGNSSLTKGESVQDTVATMACYSDVIVMRHPTKGMVQQAAEKSRRPIINAGDGVGEHPTQALLDVFTIREEIGTVNGITVTMVGDLKNGRTVHSLARLLTLYRVNLQYVSPDSLPMPENVQNYVHKCGIPQRQFKTIEEALPTTDVLYMTRIQRERFADQQEYEKVHGYFVLTPKMLTKAKNKMIVMHPFPRVNEISTEVDCDPRAAYFRQMEYGMFVRMALLSMLTGRF 7009
            T   +A   AGLK+YLN+T++ L++D++  WM+HFE WP HLPIV HAE QT AAV+++++L  R VHI HVARKEEIL+IKAAK +GL VTCEVAPHHLFLS DD +R+G G+  V+P++ S +D +ALWENM  IDCFA+DHAPH ++EK    PPPGFPGLETMLPLLLTAV +GRL+LDD++ RLH NPRRIF LP Q DTYVEVDL  EWTIP  M ++K+ WTPF G KV G V RVV+RGE+A I+ QVL  PG+G+DVR W        PP+                           LPP + +A    L A   E+P   +   + +P L+  P      P P+ + ++  + L T   L  +     H          LVG+H+L V+   KDQ++ LFN+A  L+   ++ R +D LKGKV+A MF+E STRT+ SF +AM RLGG  ++     SS+ KGES+ D+V TM+CY+DV+V+RHP  G V+ AA+  RRP+INAGDGVGEHPTQALLD+FTIREE+GTVNG+T+TMVGDLK+GRTVHSLA LLT YRV+L+YV+P SL MP  V+ +V   G  Q +F++IEEALP TDVLYMTRIQ+ERF   QEYE   G F+LTP ++T+AK KM+VMHP PRVNEIS EVD DPRAAYFRQ E GM++RMALL+ + GRF
Sbjct: 1544 TLGTVAGSAAGLKLYLNETFSELRLDSVVQWMEHFETWPSHLPIVAHAEQQTVAAVLMVAQLTQRSVHICHVARKEEILLIKAAKARGLPVTCEVAPHHLFLSHDDLERLGPGKGEVRPELGSRQDVEALWENMAVIDCFASDHAPHTLEEKCGSRPPPGFPGLETMLPLLLTAVSEGRLSLDDLLQRLHHNPRRIFHLPPQEDTYVEVDLEHEWTIPSHMPFSKAHWTPFEGQKVKGTVRRVVLRGEVAYIDGQVLVPPGYGQDVRKWPQGAVPQLPPSAPATSEMTTTPERPRRGIPGLPDGRFHLPPRIHRASDPGLPA---EEPKEKSSRKVAEPELMGTPDGTCYPPPPVPRQAS-PQNLGTPGLLHPQTSPLLHS---------LVGQHILSVQQFTKDQMSHLFNVAHTLRMMVQKERSLDILKGKVMASMFYEVSTRTSSSFAAAMARLGGAVLSFSEATSSVQKGESLADSVQTMSCYADVVVLRHPQPGAVELAAKHCRRPVINAGDGVGEHPTQALLDIFTIREELGTVNGMTITMVGDLKHGRTVHSLACLLTQYRVSLRYVAPPSLRMPPTVRAFVASRGTKQEEFESIEEALPDTDVLYMTRIQKERFGSTQEYEACFGQFILTPHIMTRAKKKMVVMHPMPRVNEISVEVDSDPRAAYFRQAENGMYIRMALLATVLGRF 2225          
The following BLAST results are available for this feature:
BLAST of TCONS_00001872 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
PYR10.000e+064.19CAD protein OS=Homo sapiens GN=CAD PE=1 SV=3[more]
back to top