Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001864 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001864
Unique NameTCONS_00001864
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length2377

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001864 ID=TCONS_00001864|Name=TCONS_00001864|organism=Clytia hemisphaerica|type=transcript|length=2377bp
gatagAGTTgttagggtcgataagatcgataaaagatcgatgatagatcg
atgatagatcgataaataatcataagcttaaaaaaatcttgagtaccgta
agttggtctaatctcgacatccgtcttctaatttcgacacccttctttaa
agataggaataGTATGAAAGTCGGAAtcggtgattgaaaaaagatttatc
ctcccttaccactaagcaaataaaataatttcgacctttttttaattttt
cagctctagaaaagggtgtcgaatttagaggagggatgtcgacattagac
caagttacggtatcgatcctctatcgatctcctatccggatcgataagta
atccatcgatcacatatcgatccgtcatcgagccgttccgatgatcgatc
ctatcgagcgcgggggtctggcaCATagcatggcatgggttgacctgggc
gaaggttcattcacttgtcaagtgaaccgctgcgagtggaaATCAAACCT
CAGTCgtctgtgcagcaaccaagctCAATGACTACACTATACCACGCTGT
CTAATAAATATAGCATGGTAGCCCCTAGGAAATCTTTAAAAACAGACCTC
CCTTCCCTTCTTGAAAAGTGTGTCAATTATCACTACTGCTTAATTTAGGT
AAGGTTTTAAAAAGAGTAGAGTCTGTGTCGCATGcaaataaaaacattct
ttTAGTTATCAGTCATAtgccagtttgcagagtatggcaagAAGGCTGCA
CTCGAAGAAAAATTCGTTCCGCACTCGAAGAACGCACCTGATATAAATCC
GGACAAGGTGCATCTATAGCTcggaaatttgcccaaaaaggcaaaaaatt
gctcaaattggCTGCACTAGAGGAAAAGATAGCTGAACACTACACCTGAA
AACCTTAGATATATTTTGCACCTGCACTCGATTTTTTACAAGTTGTGCAC
TCAATATCTCAAGCAAATGTGCCACACTTTGCAAACTGGGTCATATGTAG
GCTTCAAGAAAAGGTATTAATTCAAATCCCTGAACACAGAAAGATTTAGA
CTGATGTTGGAATTGCCAGAGTTTACAAACAANCAAGCAAATGTGCCACA
CTTTGCAAACTGGGTCATATGTAGGCTTCAAGAAAAGGTATTAATTCAAA
TCCCTGAACACAGAAAGATTTAGACTGATGTTGGAATCGCCAGAGTTTAC
AAACAAACACCGAAGTCCTTTCCTGTTCAGGCAGATGGACTTTTTTAGTG
AATAAACTCTACGAGATTTAAACTCAGAAGAAGCAGATTATGCATAGTAT
TGGGTCACTGTGGATATACATGAGCAGAGGGGCGAATCAAACAGACTTTA
TCGACAAACAAACATGAACTGTCTACAGAAAACACTCATACCATTTGACG
GTTTGGAGATGTTCACACTTTGAGTCTCTTTTCAAAATGATGGCCTTTCG
ATATTCAAGAAGTTCAGATTCGCCGCTTTTGAGACCTTTGACCAATCAAT
TTGAAGCGGCCGAAGTCTAAGCCAATCAGAAGTTAGATAACAAGCCTCGT
TTTCGAACCAAATTCGTGCAGTAGCTACAGGGACTCAATCACGTCAACAC
GTCAATCCGAAGGCAAAAGTTTGGTGGAAGGTTCACAAAAATGGAATTCT
TTTTCACATTACCTTTCCAATTTTTGGAGCCACCAAATTTGAAGATTAAG
AAGCCAACATGGATCAAAGCTCCATCTGCAATGTTTGTTTTTTCATGCGT
TTTGTTGTCGTATTTCTTAGTTACAGGAGGTATTATTTATGATGTTATTG
TGGAACCACCAAGTATTGGCTCAACTACAGATGAACATGGAAATAGTAAA
CCGGTTGCTTTCATGCCGTACAGAGTGAATGGACAATACATTATGGAGGG
ATTAGCAGCTAGCTTCCTGTTCACTGTGGGTGGATTAGGTTACATCATCA
TTGATAAAGCAAATGGTCCAGGATTACCAAAGTTGAACAGATTCCTTCTC
TTGTTCTTTGGATTCTTATGCGTTGTCGTTCCTTTCTTCATGTGTAGGCT
ATTCATGAGAATGAAATTACCTGGATACCTGAGCGCACATTAAAGTCATC
GATCAATTAGCAGttgtaattaactttttttcattGTAATTTTTAGGGAA
TACCTTTTTGTATGAAAATGTTTACACTTGATTCGAAACACACTTTTCAT
TTGATTAACTTTCCTGCGTCAATTTTAGATACTATAATCCCTGACACTTT
TCGATTTATGTCCAAAGCTCCCTGAAAACGGTGTCAATCATTTCGAGTTC
GTGAAAAAgtcacttttttgagaaaattgtttTTCATATTAAAACTTTAG
ATCgacaaaatctaattttgtATTGTG
Run BLAST on NCBI

protein sequence of TCONS_00001864-protein

>TCONS_00001864-protein ID=TCONS_00001864-protein|Name=TCONS_00001864-protein|organism=Clytia hemisphaerica|type=polypeptide|length=150bp
MEFFFTLPFQFLEPPNLKIKKPTWIKAPSAMFVFSCVLLSYFLVTGGIIY
DVIVEPPSIGSTTDEHGNSKPVAFMPYRVNGQYIMEGLAASFLFTVGGLG
YIIIDKANGPGLPKLNRFLLLFFGFLCVVVPFFMCRLFMRMKLPGYLSAH
Run BLAST on NCBI

transcript from alignment at sc0000012:1930..8470-

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001864 ID=TCONS_00001864|Name=TCONS_00001864|organism=Clytia hemisphaerica|type=transcript|length=6541bp|location=Sequence derived from alignment at sc0000012:1930..8470- (Clytia hemisphaerica)
GATAGAGTTGTTAGGGTCGATAAGATCGATAAAAGATCGATGATAGATCG ATGATAGATCGATAAATAATCATAAGCTTAAAAAAATCTTGAGTACCGTA AGTTGGTCTAATCTCGACATCCGTCTTCTAATTTCGACACCCTTCTTTAA AGATAGGAATAGTATGAAAGTCGGAATCGGTGATTGAAAAAAGATTTATC CTCCCTTACCACTAAGCAAATAAAATAATTTCGACCTTTTTTTAATTTTT CAGCTCTAGAAAAGGGTGTCGAATTTAGAGGAGGGATGTCGACATTAGAC CAAGTTACGGTATCGATCCTCTATCGATCTCCTATCCGGATCGATAAGTA ATCCATCGATCACATATCGATCCGTCATCGAGCCGTTCCGATGATCGATC CTATCGAGCGCGGGGGTCTGGCACATAGCATGGCATGGGTTGACCTGGGC GAAGGTTCATTCACTTGTCAAGTGAACCGCTGCGAGTGGAAATCAAACCT CAGTCGTCTGTGCAGCAACCAAGCTCAATGACTACACTATACCACGCTGT CTAATAAATATAGCATGGTAGCCCCTAGGAAATCTTTAAAAACAGACCTC CCTTCCCTTCTTGAAAAGTGTGTCAATTATCACTACTGCTTAATTTAGGT AAGGTTTTAAAAAGAGTAGAGTCTGTGTCGCATGCAAATAAAAACATTCT TTTAGTTATCAGTCATATGCCAGTTTGCAGAGTATGGCAAGAAGGCTGCA CTCGAAGAAAAATTCGTTCCGCACTCGAAGAACGCACCTGATATAAATCC GGACAAGGTGCATCTATAGCTCGGAAATTTGCCCAAAAAGGCAAAAAATT GCTCAAATTGGCTGCACTAGAGGAAAAGATAGCTGAACACTACACCTGAA AACCTTAGATATATTTTGCACCTGCACTCGATTTTTTACAAGTTGTGCAC TCAATATCTCAAGCAAATGTGCCACACTTTGCAAACTGGGTCATATGTAG GCTTCAAGAAAAGGTATTAATTCAAATCCCTGAACACAGAAAGATTTAGA CTGATGTTGGAATTGCCAGAGTTTACAAACAANCAAGCAAATGTGCCACA CTTTGCAAACTGGGTCATATGTAGGCTTCAAGAAAAGGTATTAATTCAAA TCCCTGAACACAGAAAGATTTAGACTGATGTTGGAATCGCCAGAGTTTAC AAACAAACACCGAAGTCCTTTCCTGTTCAGGCAGATGGACTTTTTTAGTG AATAAACTCTACGAGATTTAAACTCAGAAGAAGCAGATTATGCATAGTAT TGGGTCACTGTGGATATACATGAGCAGAGGGGCGAATCAAACAGACTTTA TCGACAAACAAACATGAACTGTCTACAGAAAACACTCATACCATTTGACG GTTTGGAGATGTTCACACTTTGAGTCTCTTTTCAAAATGATGGCCTTTCG ATATTCAAGAAGTTCAGATTCGCCGCTTTTGAGACCTTTGACCAATCAAT TTGAAGCGGCCGAAGTCTAAGCCAATCAGAAGTTAGATAACAAGCCTCGT TTTCGAACCAAATTCGTGCAGTAGCTACAGGGACTCAATCACGTCAACAC GTCAATCCGAAGGCAAAAGTTTGGTGGAAGGTTCACAAAAATGGAATTCT TTTTCACATTACCTTTCCAATTTTTGGAGCCACCAAATTTGAAGATTAAG AAGCCAACATGGATCAAAGCTCCATCTGCAATGTTTGTTTTTTCATGCGT TTTGTTGTCGTATTTCTTAGTTACAGGAGGTAAAGTTTTGTAACCTTTTT TTAATTCTTTTTTTTTGGGATAAAAACAATTTCAAAACATGCGAGTGGCC TGAAAAAGTTGGTGCTATACCTAGGGTCGTCTTTATTGGGTCGATATTAG ACCAACTTACGGTACTAATTGAACGTTCGATTGTGAAGGAAGTAATCAAT AATGATCGATAATAATCGAAGGTGGTCAGTGACACCCCCTATCCAATTTT ATCGGTGATTGAATACTCAGGCCAGGCCCAATTGATTGTTTGGTTCGTGT CCTAGAAGCTCTGAAAAATGGGTCGGTCGGTCGGTAGCTAAAATTGGAAC CTTTTTTTCATTTTCCCACCAAAAACCTCTATTTTTGAAATTCCTCAAAC AATCGTGCAATCCTGGAATCCAAACGCGAGTGTAAAAAAATAGTCAAAAG CCCGGATCCACAACGGCACTCGACGCGATCGCAAGATAGGTTCTAGTTGG AAATAAAGGCGTTTGCGGCGTGTGCTTAAAGGAATACAGCTGTGAGTTTC TGCTACACCGGGACATTTTCTGTGCGCAAATTGGATGTTGTTTATAGAAG AATCAAAGCAGTCAGTTAGAAAAGAACTGCAGAGATAGTAGTTATCATGT GAAAAGGAGGTAAATTTGTTTTGATTTTTCCAACTCAAAGTGAAACACTT TTTCTCAAAAATTTAGAGTCGGTCGGAGGACACGAACCAAACTATCAATT GGGCTTGGCCTCACTCGACTCCAGATTATGGCATTTTCTTCGACCATTTT CGATTTGTTCAATCATTTCGATTACCTTCAATCATATTGAATACCTTCGA TTGTACTCAGTAATTTCCAGCCTTCAATTTTATCAAATATGTTTCCAGTA GCACTTGAGGAAACCCAGGGCGAAGGCCACACAAAATGGCAAGGGAAAAT GGCTGGGAAATAAGGGGGTCAATCTTTATGGAGGGGCTTCTTTTTGTGCT TTGGTTTTAGATCAGTTTTTTTAGTTTTTCTTAAAGATATATCATAATAC CATCAACTGCTCTAACTTGGGATGATTGGTCGAAACATGGTGGGACTGTT TGATATCTGGCCTGTATTTTCACTTACTGTTAAATGTCTTTGACAACAAA TTCGTTTTGATAATTCTACCAAGTTTATTAACATGTCACCATACTAACTT TCACTGATAGTGTGTCCTTTGTAACTTTTTGTTTTCATTCCAAATGACGG GACGTCGTTTGGAGAATTACAGAACGCCTAACCGTCTAGTGCCTGATGGG GTTAACAAATAACGAGTGTGTAACTTGCAGCGGGAGTGACGTTAAACGCT CCATCGTTTTGCCACTAATATGGTCTTCTTCGTTCCAGACATTTGCGTGT GTTCCACTATGGATTTTTTCATATTTCGATTTAAAAGCCTACTCGGTGCA AAAGAGAAATCTTTTATTTTTTTATATATATGCCATTTATTAACTCAAAT CAAATGACTTTGGAGGTTCGGTGAAATGGTGGCCGGATTGCCGTCCCATT TTTTGTCAGATAGTCCCAAGTTAGAGCAGTTGACGGTAATTGGTTATCGT CAAAGTAATCAATTGGTTAGCAAAGTTGTCAAAGTTATCGAAAGTAATCA ATAACAATCAAAGTACTCGGACGGTTATGGAGTCTTTGAAGGGTTGTTAA GAAAGTGATCGAATACTCACAATTTTTCTGAAATTTTGGTACTTGACATT CGATTGTTAATCGATAAGTGGTTGTTTGATTACTTCCATCATTATTGATT ACTTCGACAATCAAATTTATCGTTCAGTACCGTCTGGTCTAATATCAACA TCCCTCATCTAATTCTGACACCCTTCTTTAGAGACAGACAATAATAATAC TCCTCTCTGACCACTAAGCAAAGAAAAACAGTTTAAACCTTTCTATCAAT TTCAGCTGATAAAAAGGGTGTCAAAATTAGAGGAGGGATGTTGACATTAA ACCAAGTTAGGGTAATCCCATTAATTTCTAAAATATGGCTAATGGTCATG ATTCATTTAACTTTACACATTTCTTTCATAGAAGTACCAGCAATTCAAGC TCTTTTTCTACAAATTTTGAGCAACTTTTAGGCATGAGAAGATCAAATAT CTCAGGGCTGAACCCCCACAAGGCCCCTAGACCTGTTTGGGGGGATTACA GCACCAGGACCCTCCGAGCGCTCCGGAAACGTCTGGAGCAAAAAGTGCTG TTTTTCCGGAGCACAATTTTTGGTGATTGGTCTCTGCACCAGAACTATGT CGACATCCCTCATCTAATGGAGGGGGTTTATATTGTATCCAATAAGTAAC ATACCTGCTGCCTAACCTCAGTCGAGCAAAGAGAAAACCTTCAAAGATTC GATTTAAAGGCATTTTGACCCTAATTAAATTACTTTCTCCAGCCTTTTTA GAAAATTAACTCAATCTATCTTAAAGTTCATTAATACAGCTGGGGAAGTC AAAAATCATTGCCCCCAAATATATTAAATCAAATTAAAAAACAAGATTCA TACGTATACTTTTTTGGCTCACCCGGTATAACAAAATAAGGGTGAATAAA TCTGAAAATATTCCTTTAATAAGGTAGATGGAATTCATGATGGGTAATTA AAAACTTGTGCTCACTTATAATAATTATACATTAATATGACATTGTTTTT TGTGCTGGAGTTTTTAATTATCCAACATGACACCACGTCTAGGGAAAGGT CTATTTATCACAATACATTGAAGGGTCTGTTCAAAAATCTCAGACATCAC AATAGTACCAATAGTACTAGAAAAGTTTAGGTGGTATAGTTTTAGCTCAA TAGAATGTCAATTGCTGAAGTCAGTGAAATCAGTCAAATTTAACCTTGTT TTGCTTCTTGTTTAGGTATTATTTATGATGTTATTGTGGAACCACCAAGT ATTGGCTCAACTACAGATGAACATGGAAATAGTAAACCGGTAAATAATAC ACCTATTAACCCTTTTAACAACTGGTGTCGAAATGACGTCAAAATTCTGC GTCATTAAGCATTTCAATGCAATACCTTCAGAGATTCTCTTCCTAGTAAA TTGGAACCAAGTCTTTTCTGGGCCAGGGATTTTTTTATTGTTTTTATGTC AAAGAATTTCAGAGATATGCTTAACATGACCAAAAGGATTGGTTAAAAAA AACGCAAGTTCTTAGTTCTGAGTTGAAGATTTTAACAGTTTCCCAGAGTA CATGTATTCCACTCTTGAACTGACTCATCAGTTGTTCACTTTTTGTTCTG ACTTAAAATCGAGCTGTCTACAAGAAAATATTTTCACCATAAAATATTCT TTATGTCACTAAAAAAGGATTGATTTTGATTTAATTTCATAAGAGATCAT GNAAAATATTCTTTATGTCACTAAAAAAAGATTGATTTTGATTTAATTTC ATAAGAGATCATGTATACCTAGGGTTTTCGTAAACTGTAAACTTTATCTA TGGTTTACGAGTAGANCAAATATTCTTTATGTCACTAAAAAAGATTGATT TTGATTTAATTTCATAAGAGATCATGTATACCTAGGGTTTTCGTAAACTG TAAACTTTATCTATGGTTTACGAGTAGAAATTACCCAAATGGAAAATCAC TTTTAAAATGTCGTTAGCTATAATAAATGGCTTGAATTCAATTAGAATTC CAGAGATTTCTCATAACACTTTAATAAAAAGATTTTTGAAAATTATTGAT TGGCTTTTATTTGTAACAGGTTGCTTTCATGCCGTACAGAGTGAATGGAC AATACATTATGGAGGGATTAGCAGCTAGCTTCCTGTTCACTGTGGGTGGA TTAGGTTACATCATCATTGATAAAGCAAATGGTCCAGGATTACCAAAGTT GAACAGATTCCTTCTCTTGTTCTTTGGATTCTTATGCGTTGTCGTTCCTT TCTTCATGTGTAGGCTATTCATGAGAATGAAATTACCGTAAGTTTTCGGC AATTTTCATTATTATCTGCATAACTCTCTTAGAGCTTGCATTTTTTTTAC CTTATTTGCGCAGACGAAAGTTTTTTAATTGACCTGGCTCTCGAACAGTA TATGAAAGTTAGAATTCTTTTGCGCATTTATTCTGTTTAATACCAACCAA CCATGATAACTTGAATGTTATAGGGCTCATAGTGAAGTTATCTGAGCTTT AGGATGTTCTTAAATTTCTGGGTTTTGATCTTAAGAATATTCTTAGCCTT TTCTTATTTTTATTATGTGATTCTTTTTGTGCAATTACCTGAAAAATGAA GCTTGACAAGCCCTACTATTTTTTTTTCTTAATATTGTTATTTAGTTTGT TTTCATAAAAAGTGTAGTTTTAAAGAAAATATGAATTGAATTCTCGTACC CATTATTAACAGTGCGATGGATGCTAATAGTATGCATCATTGTTAAAAAC CTATTCAATTTTTTTATTTCTCTTCCTTTTTTTAGTGGATACCTGAGCGC ACATTAAAGTCATCGATCAATTAGCAGTTGTAATTAACTTTTTTTCATTG TAATTTTTAGGGAATACCTTTTTGTATGAAAATGTTTACACTTGATTCGA AACACACTTTTCATTTGATTAACTTTCCTGCGTCAATTTTAGATACTATA ATCCCTGACACTTTTCGATTTATGTCCAAAGCTCCCTGAAAACGGTGTCA ATCATTTCGAGTTCGTGAAAAAGTCACTTTTTTGAGAAAATTGTTTTTCA TATTAAAACTTTAGATCGACAAAATCTAATTTTGTATTGTG

Coding sequence (CDS) from alignment at sc0000012:1930..8470-

>TCONS_00001864 ID=TCONS_00001864|Name=TCONS_00001864|organism=Clytia hemisphaerica|type=CDS|length=1812bp|location=Sequence derived from alignment at sc0000012:1930..8470- (Clytia hemisphaerica)
TGGATACCTGAGCGCACATTAAGTTGCTTTCATGCCGTACAGAGTGAATG
GACAATACATTATGGAGGGATTAGCAGCTAGCTTCCTGTTCACTGTGGGT
GGATTAGGTTACATCATCATTGATAAAGCAAATGGTCCAGGATTACCAAA
GTTGAACAGATTCCTTCTCTTGTTCTTTGGATTCTTATGCGTTGTCGTTC
CTTTCTTCATGTGTAGGCTATTCATGAGAATGAAATTACCGTATTATTTA
TGATGTTATTGTGGAACCACCAAGTATTGGCTCAACTACAGATGAACATG
GAAATAGTAAACCGATGGAATTCTTTTTCACATTACCTTTCCAATTTTTG
GAGCCACCAAATTTGAAGATTAAGAAGCCAACATGGATCAAAGCTCCATC
TGCAATGTTTGTTTTTTCATGCGTTTTGTTGTCGTATTTCTTAGTTACAG
GAGTGGATACCTGAGCGCACATTAAGTTGCTTTCATGCCGTACAGAGTGA
ATGGACAATACATTATGGAGGGATTAGCAGCTAGCTTCCTGTTCACTGTG
GGTGGATTAGGTTACATCATCATTGATAAAGCAAATGGTCCAGGATTACC
AAAGTTGAACAGATTCCTTCTCTTGTTCTTTGGATTCTTATGCGTTGTCG
TTCCTTTCTTCATGTGTAGGCTATTCATGAGAATGAAATTACCGTATTAT
TTATGATGTTATTGTGGAACCACCAAGTATTGGCTCAACTACAGATGAAC
ATGGAAATAGTAAACCGATGGAATTCTTTTTCACATTACCTTTCCAATTT
TTGGAGCCACCAAATTTGAAGATTAAGAAGCCAACATGGATCAAAGCTCC
ATCTGCAATGTTTGTTTTTTCATGCGTTTTGTTGTCGTATTTCTTAGTTA
CAGGAGTGGATACCTGAGCGCACATTAAGTTGCTTTCATGCCGTACAGAG
TGAATGGACAATACATTATGGAGGGATTAGCAGCTAGCTTCCTGTTCACT
GTGGGTGGATTAGGTTACATCATCATTGATAAAGCAAATGGTCCAGGATT
ACCAAAGTTGAACAGATTCCTTCTCTTGTTCTTTGGATTCTTATGCGTTG
TCGTTCCTTTCTTCATGTGTAGGCTATTCATGAGAATGAAATTACCGTAT
TATTTATGATGTTATTGTGGAACCACCAAGTATTGGCTCAACTACAGATG
AACATGGAAATAGTAAACCGATGGAATTCTTTTTCACATTACCTTTCCAA
TTTTTGGAGCCACCAAATTTGAAGATTAAGAAGCCAACATGGATCAAAGC
TCCATCTGCAATGTTTGTTTTTTCATGCGTTTTGTTGTCGTATTTCTTAG
TTACAGGAGTGGATACCTGAGCGCACATTAAGTTGCTTTCATGCCGTACA
GAGTGAATGGACAATACATTATGGAGGGATTAGCAGCTAGCTTCCTGTTC
ACTGTGGGTGGATTAGGTTACATCATCATTGATAAAGCAAATGGTCCAGG
ATTACCAAAGTTGAACAGATTCCTTCTCTTGTTCTTTGGATTCTTATGCG
TTGTCGTTCCTTTCTTCATGTGTAGGCTATTCATGAGAATGAAATTACCG
TATTATTTATGATGTTATTGTGGAACCACCAAGTATTGGCTCAACTACAG
ATGAACATGGAAATAGTAAACCGATGGAATTCTTTTTCACATTACCTTTC
CAATTTTTGGAGCCACCAAATTTGAAGATTAAGAAGCCAACATGGATCAA
AGCTCCATCTGCAATGTTTGTTTTTTCATGCGTTTTGTTGTCGTATTTCT
TAGTTACAGGAG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000984XLOC_000984Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001864-exon-sc0000012-1575043694:6692..8470TCONS_00001864-exon-sc0000012-1575043694:6692..8470Clytia hemisphaericaexon
TCONS_00001864-exon-sc0000012-1575043694:3732..3805TCONS_00001864-exon-sc0000012-1575043694:3732..3805Clytia hemisphaericaexon
TCONS_00001864-exon-sc0000012-1575043694:2734..2951TCONS_00001864-exon-sc0000012-1575043694:2734..2951Clytia hemisphaericaexon
TCONS_00001864-exon-sc0000012-1575043694:1930..2235TCONS_00001864-exon-sc0000012-1575043694:1930..2235Clytia hemisphaericaexon
TCONS_00001864-exon-sc0000012-1510915933:6692..8470TCONS_00001864-exon-sc0000012-1510915933:6692..8470Clytia hemisphaericaexon
TCONS_00001864-exon-sc0000012-1510915933:3732..3805TCONS_00001864-exon-sc0000012-1510915933:3732..3805Clytia hemisphaericaexon
TCONS_00001864-exon-sc0000012-1510915933:2734..2951TCONS_00001864-exon-sc0000012-1510915933:2734..2951Clytia hemisphaericaexon
TCONS_00001864-exon-sc0000012-1510915933:1930..2235TCONS_00001864-exon-sc0000012-1510915933:1930..2235Clytia hemisphaericaexon
TCONS_00001864-exon-sc0000012-1491911889:6692..8470TCONS_00001864-exon-sc0000012-1491911889:6692..8470Clytia hemisphaericaexon
TCONS_00001864-exon-sc0000012-1491911889:3732..3805TCONS_00001864-exon-sc0000012-1491911889:3732..3805Clytia hemisphaericaexon
TCONS_00001864-exon-sc0000012-1491911889:2734..2951TCONS_00001864-exon-sc0000012-1491911889:2734..2951Clytia hemisphaericaexon
TCONS_00001864-exon-sc0000012-1491911889:1930..2235TCONS_00001864-exon-sc0000012-1491911889:1930..2235Clytia hemisphaericaexon
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001864-proteinTCONS_00001864-proteinClytia hemisphaericapolypeptide
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000012supercontigsc0000012:1930..8470 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
139.128 144.228 124.453 130.439 42.5039 31.8914 101.09 103.4 117.33 107.396 101.469 120.805 79.3934 77.3291 78.4949 81.7769 90.5955 89.9838 40.6678 52.6008 77.6461 71.7813 91.484 82.5807 46.3744 55.0563 62.8252 57.0886 104.838 77.1774
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR021149OligosaccharylTrfase_OST3/OST6
Blast
BLAST of TCONS_00001864 vs. Swiss-Prot (Human)
Match: OSTC (Oligosaccharyltransferase complex subunit OSTC OS=Homo sapiens GN=OSTC PE=1 SV=1)

HSP 1 Score: 196.823 bits (499), Expect = 2.993e-58
Identity = 104/147 (70.75%), Postives = 128/147 (87.07%), Query Frame = 3
Query: 1641 MEFFFTLPFQFLEPPNLKIKKPTWIKAPSAMFVFSCVLLSYFLVTGGIIYDVIVEPPSIGSTTDEHGNSKPVAFMPYRVNGQYIMEGLAASFLFTVGGLGYIIIDKANGPGLPKLNRXXXXXXXXXXXXXXXXMCRLFMRMKLPGYL 2081
            ME  + +PF  LE PNLK+KKP W+  PSAM V++ V++SYFL+TGGIIYDVIVEPPS+GS TDEHG+ +PVAF+ YRVNGQYIMEGLA+SFLFT+GGLG+II+D++N P +PKLNRFLLLF GF+CV++ FFM R+FMRMKLPGYL
Sbjct:    1 METLYRVPFLVLECPNLKLKKPPWLHMPSAMTVYALVVVSYFLITGGIIYDVIVEPPSVGSMTDEHGHQRPVAFLAYRVNGQYIMEGLASSFLFTMGGLGFIILDRSNAPNIPKLNRFLLLFIGFVCVLLSFFMARVFMRMKLPGYL 147          
The following BLAST results are available for this feature:
BLAST of TCONS_00001864 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
OSTC2.993e-5870.75Oligosaccharyltransferase complex subunit OSTC OS=... [more]
back to top