Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001855 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001855
Unique NameTCONS_00001855
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length2618

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001855 ID=TCONS_00001855|Name=TCONS_00001855|organism=Clytia hemisphaerica|type=transcript|length=2618bp
GTTCTTCTTAAACGTCTTTCAAATACGAGGGTAATCTTTCTTATATGGAC
GTTTTTTGGCAATACAGATTATTTGCCAATCTCGTCATTGTTATTTTGGT
GCTTATCAAACTTTCATACATGGTAGTATACTCTAATATAAAATGGAGCC
TTCCTTATTATCAGACAATGTTTCTTGTGATTTTGACGAATGGGTAGTTa
tggttttcaaagtttttcttggATATTTCATGATTCGGTGTGTGTGGAAA
TCGAGaaaattatccGATACACAACAACAACAGTCACAAGTGGATAACGG
AGAAATAAACGCCTGTCGTGATAGCGGAAGAAAAATGATTGATCGTCAGc
cTGGAACAAAACGGTTTTACAACTTGACATCTGAATATGAGAAGACGGCG
GCTGGTGATCATGAAGATGTTTCGGACTCCGATGAAAGCCGCTTATTTGT
AGTAAACGACGGTTATTCATCCGACTTATCCGACATGTCGTCAATTCAtc
gtcatcaaaataatttgtcaACAAAACGCGTCTTAAAAACACGACAAGTG
CTCGATTCAAAACGAAACAGCGTGGTTATCGACGAATATTTATCCGATAC
AGATCTTGATTCGTTAAGGACATCAACTCGAAACGAACAACGTAAAAAGA
GATCGAAAAGTCACCGATTGATGAAAGACGAATCGAAGATTTATcgagaa
aatttgttcgagaAAGACGATAAAGATCGTAAACGAAGATCGTGGACTGA
TTCGGGTGTTTCACTTTCGTTATCGAGAACTGACCAATCGAGATGTGGAA
CTTTTGATCACGGTGTATCGATTAGAAACACtgaaatggaaaatgaaaac
CAAACACATTTAGAAGTTCCTTTACGGCGTCGAACGGCTAGTCAACTTCG
AAAGACATCGACTGAAGCAACTAAATCGTTTAATCGATTGTCTCAAATCA
CGAATCGAAGCTCTTTAACGAATGTATCGATCTTAACAACGACATCGATG
ACTTCTCTCAGTTCGATCATCTCACCATCGGAATTAGAATATATTTCAGA
ATCTGAAAGTTATAGTTCATctgatgatgatattcttaCTGATTCCCTCT
TGAGAAATTTGAAACATACTCCTGGCGGTGGCTCACAATTATCAATGACA
TCTACAGCTTCTACAATCAAAGCTGATAACGAGAATATTTCAGCCACCGA
TCCTGAGAAATATATAGATATGCAATTAAGGTTATATCAAAAGCAAAAAC
AACAAACGAATAAATGTCAAAAACAATCACATTCTCGTAAAAGAAGCAAC
AGCCTCATTCAGAAATTCAAATCGCATTTTCATAAATCAAAACAGCAGAG
TCCGAATCGTAGCTCCAAAGATGTGTCGTCAGAATTCTCCTTtgagaaag
ttgaaaaagattCTAATCAGAAATATGAAGTCATTACGACTGATTTTCTA
AAGAAACTGAGAGACGAAGAATCAGCGCCTTTAGATTTTTATGTTGATGA
CGTTCAGTATGAAGATGATCTAAGTGATGAAGATGATGAGAACCAATCAA
AAGACCCATTGGAAAATTTCTCATCCAAGCCACATAacaaagaacataaa
acttttcttggtaaattttttaaaaggacACGCTCTTATTCGGTTTCACC
AcaacttgaaaagaaaacaccGAAATCACGATTTAGTAGAAATTCGTTTC
GAGCAAGCACTCGATCGAATCCTGAAATGCCATCTAAAgaagataatttt
tcaaatgttggaCGATATACATCGATGgataatttgaatttgaaagaagG
TGGCCACCAACAAGACTCTGAAAATTATACACCGAAAATGAACAGAAGTG
AGACTTTTAGTGGAGCTATTTCATATAATCATGAAAATCGAACCATGTAC
GATTCAAACTTTAATCGAAACCAATTGCCAACACAATCACCTACTATAAT
GCAAAAACAATGTCTCGGTATTCCGGCTCACGGTTCTGTTACTCCGAAAG
CGAGCAGTCCAGATTTCTCGAAAGAATCACCAATTCCACCCCCTTCACCG
ACGCCAAGCGTttttgatttagaaaaattccaaCAAGTACACATGCCGTT
AGACCGTTGTAACTGTGAAGAATGTATGTACGCAGACTATCTAGACTATC
TTGAGTTTCAACGATTTCGAAGGTATTATTCTCAATCTTGTTGTGGACCG
TGTTGTATGGCTCCAACTGATCTCCCTGTATCTCCACATACACCACAAAT
GGCGNACCGTGTTGTATGGCTCCAACTGATCTCCCTGTATCTCCACATAC
ACCACAAATGGCGCCCATGCGTATTTCTCCACGCCATGTACACCCTGAAG
CAAATATCATAGCACCTTTACCGGTGACCaaagaaactgaaaaacaaGCC
AAAAATCTTCGCACCTCAATTTACGAATCTTTTGTATAATACtatatttt
taatgaaatcaatatttttcttaaagcAGTTTTTATTTATAATGTTGAAA
TAATTAGAATAACCATTTTTAATACAAAACTTCAGCCTCACTTCAAACGC
AGTCAGGGATATATGTTCAAATTAGCCGATTATCGGTTGTTTAGCCTATT
ATCGGTTTAGACGATATC
Run BLAST on NCBI

protein sequence of TCONS_00001855-protein

>TCONS_00001855-protein ID=TCONS_00001855-protein|Name=TCONS_00001855-protein|organism=Clytia hemisphaerica|type=polypeptide|length=739bp
MEPSLLSDNVSCDFDEWVVMVFKVFLGYFMIRCVWKSRKLSDTQQQQSQV
DNGEINACRDSGRKMIDRQPGTKRFYNLTSEYEKTAAGDHEDVSDSDESR
LFVVNDGYSSDLSDMSSIHRHQNNLSTKRVLKTRQVLDSKRNSVVIDEYL
SDTDLDSLRTSTRNEQRKKRSKSHRLMKDESKIYRENLFEKDDKDRKRRS
WTDSGVSLSLSRTDQSRCGTFDHGVSIRNTEMENENQTHLEVPLRRRTAS
QLRKTSTEATKSFNRLSQITNRSSLTNVSILTTTSMTSLSSIISPSELEY
ISESESYSSSDDDILTDSLLRNLKHTPGGGSQLSMTSTASTIKADNENIS
ATDPEKYIDMQLRLYQKQKQQTNKCQKQSHSRKRSNSLIQKFKSHFHKSK
QQSPNRSSKDVSSEFSFEKVEKDSNQKYEVITTDFLKKLRDEESAPLDFY
VDDVQYEDDLSDEDDENQSKDPLENFSSKPHNKEHKTFLGKFFKRTRSYS
VSPQLEKKTPKSRFSRNSFRASTRSNPEMPSKEDNFSNVGRYTSMDNLNL
KEGGHQQDSENYTPKMNRSETFSGAISYNHENRTMYDSNFNRNQLPTQSP
TIMQKQCLGIPAHGSVTPKASSPDFSKESPIPPPSPTPSVFDLEKFQQVH
MPLDRCNCEECMYADYLDYLEFQRFRRYYSQSCCGPCCMAPTDLPVSPHT
PQMAXRVVWLQLISLYLHIHHKWRPCVFLHAMYTLKQIS
Run BLAST on NCBI

transcript from alignment at sc0000012:1005534..1018801+

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001855 ID=TCONS_00001855|Name=TCONS_00001855|organism=Clytia hemisphaerica|type=transcript|length=13268bp|location=Sequence derived from alignment at sc0000012:1005534..1018801+ (Clytia hemisphaerica)
GTTCTTCTTAAACGTCTTTCAAATACGAGGGTAATCTTTCTTATATGGAC GTTTTTTGGCAATACAGATTATTTGCCAATCTCGTCATTGTTATTTTGGT GCTTATCAAACTTTCATACATGGTAGTATACTCTAATATAAAATGGAGCC TTCCTTATTATCAGACAATGTTTCTTGTGATTTTGACGAATGGGTAGTTa tggttttcaaagtttttcttggATATTTCATGATTCGGTGTGTGTGGAAA TCGAGGTATGCTTTCTTTGTTACTATGGTAACAAAATGGTCTTCCTTCAG GGAAAATACTCATCCATGAGCGAGGCCTACAGAccatttttattatcaaa tgCAGTGATAAGGTCTTTATCTTAATGACGTATAAGTTAGCACCTTTAAA GCAGGTTCGAGTTTCTGTTTCTCATTTGATTAAATCGTAATACTCGAATg aatgaaatgaatgaaaaaaaatgtcaaCAATGCAATATGTTTTTCAAGTC TTGGTAATGGAATAGGAATACAACGACAGCGTAGAGTATACTTTTGGGCC TTATGAGAAGCACGGAGTAACCAACCCTGTGCAAAATAGCCTCATAAAGC CTAGAGGACTATTGAAACCTTGGAAAGTTATTTTCCAGTTTACTGGCCTT TTTTAAAGTGATCTAGGTCACTTATAGACCTATTGCGATGTTAGTGACGT CAAACTTTTGGAGTTTCTCAAGATGCTTAAGATGAGTCTGCAAATTCCAT AAATCTATCTTGACTTTTCAATAAGATTGTGAAGAGATAGAGAACAAACG ATCAATCTTATCGATAAATCTGTTTTGACTTCAATACATTTAATCCTGGa attttcatgtgaaaattccaaaaatatttttctttacataAAAAGACCTC AAGAAAATCACTTAATTCACTTTTATAAGATTTCAGTTGGTCTTTTAAGC GCTCGTTTATGGTTGACCGCGCTTCGTATTCGaaagttgttttattttgt ccaaaTATCGAATCGGATATTGTATATCGTATTTGACCAAAGGCGGAGAC TCTTATTTTCCCTTATACGgaaaaagaattggaaaaactttCTTCAGTAA GATAAACCATAGAGTGGATTGCTTCAAATCTAAAAAAGCTGTGTACTAGT ACTCAGGCCTTGGAGACTAATTTGCTCGTTTTATTGGATTGGAATGTCAA TATAGTTAGCATTTATTTGATGGAATATCATCTTCTTGACTCGAGAATTT GAGTATTGTATTGATATTGACATTGAGACGTTGTTACCTTAAACGTGGAA ACGGTAAACAGTTTTTCGTTATTGGAAGGTTCGGGTACTGTGCTGTTTTA TGGTAATATGTTGAAATTGTTGTGGAACCTCATTCAGAGGAGTGATGTGT atgtaatgttgttttttcaaatctttactGGGCTTTTACATCAATTTTGA CTCGATCGGTCTTGGTTAATATTACTATCAATTCTCATTTGAGCATCGGT CCAATCGTAGGGCGAAATTCAGAAAAATGTCGGGGATCGACTCGGTGCTG CTATTCACTTTGTAAGAGAACGTACCTTCGCCTTAGTCTATCTATGTCAC GAGAAGGGTAATTTGGGTACtgttatcattattattattctgAGTATGGT ACGCGAGAGAAAGTATCCCCTCcctttgcgaaatttttaaaaaaggatGG TCTTCAGACAGTTAAGCGGAAGAGAAAACTCATAACAATCTGTCTCATTA CAAAATTGATCATAACATTAGTCATAAATTTTATTAGTAATGTCTTAAAA CATTTTACAAATACATGATGAATTTATCGAACTTGAAGAATGTTATACTA GTAGGCTTTGAATAATTTGGTTTAGCAAATTTTAATAATCATCTCTTGAA AAAGAATTGTCGACCATTTCCCTAATTAGTTCTTCTATGTTACAAATATG TTACATTTTGCATGATATCGCAAATTGATATCCTTGGGCTTTTTTCCCCT TTTTGAATTCACTTTCATTTCTGCCATATTAGAATCATCTTAGCTTTTAA TAATTTAGCCATCACAGCCTTgcgttcttatatagtttgttctttttttt aaaaacatgtaAATATCTCATAGTTCTAAATTTTTTCGCTATTAGCGAAA CTTAAAGTGACATATATTTTTAACTTCTTAAAATTTCTCATTTTAGAGCT TTGAACATTTAATCATTTTAAGGTGTGATTATATCCAAAAGTTATGatga aacattttaaaatacaaaatgtGTAAATCATTATGTGATGTGATGACCTC GTCTcatctttttgtcattttttctcgTCCATTCATTCACTCTGTCGTGA AAAACAAGTGCATGCATGGTTTTTATCTATAGTCTTGTTAATTTACTTCT TATCATTTCTTGATAAACCTTGCTGGCTTGCAATGACTGTGAGAAAATTC TACTGACTTCATCAGTCTAGTCTGGATTCGGTGGTTTGTTTGGTTCTGTT GGCTGGAATATCCGTATAACAATGGGTTATATTCTGTTTAGTAGTGTACT CTGTgatttagttttaattttttttttaattttgttgaagaaattgaaat tattccTAAAAAATGTCTTATCCCGAATTAAATCTTTcacattatttttt tgttcataaTCAACACTGCATTGTTATCAGTTGTCACCAGTTCTTTTCAA ACTTGCCAACAAAACCATCACGGTACACAACATCTTGATAAGTATATAAT GTCTATTAGTTACTAATCATGAAAAGTTGACCTTTTGAGGTTTATAGGTG TGGGAATAAAATAAAACTagattacacccctgtctcacagccccggtgga actttttgtcctcagtggggatagaaactcctattgaaatcccagggtta gaaattctattgttccaaggctaaaaaatccagtggggatagttttggag tgcaatttttaaacattaaatttccaatggagatgaaatcaaagtcaatt tcccagtgggggctgaaatttcagggtattttcctacaggggacgaaatt tttgccaaatgttccagtggggctgggcttCAGTGGGtgtgtgacacagg ggtgctAGATTGCAGCTTCTCCTTctctatacacccctgtctcccaGTGA ACCGGTGAACAGATGGAAAAATGTCAAGTACACACACTTATGTGATACAG GGCTGTACTTTGCGATTGTAGGGCATTGTATGGCCCTTCATATGAGACTT TTTTAAGAGGAAGTGTAGATAAGAGTTCTCTCTCAATACATCTTTGAGTT AGGGATCAATGATCATACAGTACCACTGTGAAATGACATAAACTTCTCTA CCATATTGTATGGGAAGGATGTGAAGGGTAAGAGGGCTTCGTGCTGGTCT CTTTTCCGTTCATGCGTCAATGCAGAAAAATAGATTATATTGAACCTCTC TGCATCCTATCCTTAGCAGTTGCCTATTATTAAGCTATTACTTAACTTTA TACTGATTATAGATAATTGTTCTTTTTCCAATGagaaaatacaaatttaa ttttttttccttatttcctattttctttctttatcattttctcttatttt atttttttctgtaatgATTAAAAAACACAAATAGCGCATCGGTATGTAGA AGGCATTTCTCAATACTTTCAATTGGTTAGGGTACACTGTTACTGCTGCT tgcttttgatgtttttttatgcCGGATTCAAATTGAGATAGCATTTTATT TGAGAGTATTCCTCTAGTGAATTTGAcggaaaacaaaataattttttcct aaTTATTATGATGCAGTAGCATTTATGAGAGAACTCGATGTGAtactttt ggtattttttatgaggatttatTTTGATGGTTATGATAAGAATTAGATGG TTTCTAATTGGAtttaaaaaaacgaaaacttaTTGATTACCAGACTTCGA GAAAatgaaaagcaaaacaaaagctACTACATTTGCGTTGATTGTTATGA GGTATGTAGTAGCAAAAGCTGCATGTATGAAAAGATATTGAACTCAAGAT CTCTGTCAAGATTAAAGTCTAGAGTTATAACAAAGTCCTGGAGTTACTAT ACAGTAgagtctttttaactcgaacctctttaaCTGGAATGTCTCCGCTC GTAGACTCGTTTTTTCGTCCTTTAAGATAACGCCTTACAACAAcattact ccataactcaaGGCGTGATTTGGCCTTTTTATCGTGATGGGCGtgatctt tgatttcaaaaagcgTGAAAAGTGATTAATAAAATTATGTTTTTGGTTTG ATGACTTGATAGCCTGATTAGCGATCAGGGCATCTGCTAGGGAGGGAGGG GGTCTCTGATGATCTATCTACCAACATGCACACCAGACAAAGATAGAAAT TCAACTGGAACTCGAGTTCAATCCTCGTCTTATGTGACAGCTGATTGGTG ACTGTATTAATTCCTATCAATTGATTTCGAGTTAACTACACTTCCTTGTT CCAATTGACTGACATAAATAATTAAGGTTTTCTAGCCTTCAGAGCTTGCA ATTTCTTCCTTGCaaacaataatcactttttcTTAGACGCCAAGAATACC ATCCTTTTCACTTCTAAATATATTTTGCTACAAGTTGTttacctttttga gtttttcattttatcagTGGAATTAACTTTCTATCTATTAAGTATGTATT TCATCGAAGCTTGAGAGTGGTGCTCAAGAATATTCGAAAGTTGTTCAGCA AAAACACAAGCAGNATTTTTCTCAGACGCCAAGAATACCATCCTTATCAC TTCTAAATATATTTTGCTACAAGTTGTttacctttttgagtttttcattt tatcagTGGAATTAACTTTCTATCTATTAAGTATGTATATCATCGAAGCT TGAGAGTGGTGCTCAAGAATATTCGAAAGTTGTTCAGCAAAAACACAAGC AGTTATATCATTTATAGGTGTTACTTTAAATAActgttcctgtttcatat caggcacgTGTTTTATATCAGGACGGTGTCTCCTATTGATATATTGTGCT GaataagcaaaaaattgtttttcttttccaccTTCTGACCTATCTTGTTC CACGCCTGTGTTAATTCAATATGAAAAAGCTTTTAGTTTAATCAAAATTG CtgaataagcaaacgatatcactcttattcaaaaacaataCTTGTAACCA GAACCAAAACAGTGTCAAGATAAGGTGCAAAATGACACGTGGCTACTCTC ATCTCAATTTGATTTACAAGTGCATTGAGGGTAGCGGCACATTTATGTTT ATCAAGTGTTTGTTTTGGGCAAAACAAGGTTGAATGTAATTACAACTTGG CAATAAGTCTTTCTATTTTTGGTTTTCTCTGTCGAATACACCCCTATCAC AGTTACCCAAGCGGttaaaagtatttttctttcactCTATCTTTGAGAGT ATTTTTCTAAGTCGGCATTTTTTCGGCTAATGGTTTTAATAAAAGTCTTA AGTTGGTAGTTATACCAGTGCTAAGATTTGAACCTCACCTTTTTAATTGA GTGTAACGCTTCTGAGTGTCTCTTAATCTAAGATTTTACAGAAGATGCCT CCAGGATAGTCTAGAAAGCTCATCTTtcaatgggataaacttttatTAAA AGGTGTTGTTGTATTTATAGGACATAACGTTATTTTAGTCCGGAAAAACA ACTTTATAAATGAATACATTAAGAATCTAGGTATCAAATTTAAGATTACC ATGTTAagactttcacaacaaacttgTAATTTATTTTTGGCATCCCTTTG AAAGCGGTATTCAAAACATATAAGGTCAATTACATAAATTTCCGTTTGTA AAAATCTGAACATGAGGACACCAAAGGTTTTGCTGTGAATTCGGTTATCT ATTTAGTTGGTTCGTCTTGGTTTGATTTTGTTGGTTCTAACTTCTGTAAA TGGTGTAAATCATTGTAAATTAACAACTCCTTGCTAAATTGAGTTGTAAA CAGACTTACAGGATATCAATATGGCGTCGAAtgaattttatggatttttg tgAAGATTGTTGGTTACATAAGTTATAAAGTCCTAGTGAAACCCTAGAAA AGTTGGCCAAAAATCGtccagagaaaaaaaaagacaaaaaacatTTAATC GCAACAGGGAGTTTTTTTGGatcattttgtgaattttattcGCCAACCAG TAGTTCACTCTCTGTCTCGGACCCTTTAAGAGAAAGCAAAATACTTCTAA GCAAATTCTTGTAATATTAGTTCGAGCTCTGGAGTCCAGTCTAGCGTACT GTAAAAATGCGCTAATCACGTAGAATTTATAGTTTCAAAAAGAGTTTTGA AACTGTTccaaaagttttgttttgattttccctCCTTTGACCACCCACTT GAGGCAACGTAAACAGGCTTAAACGGAATAAAGTCCTTTTAAAAATCact gtttcccttccctttaaaaacgataaaaatttcaaacaaagttACAAAGC AAAGACTTTCTTTtagttttgaaaaacatttttgagcgATCGTTTATCTT GAAAGTCTCGTCAGCATGGTGGTTGGTCTGTGTTTTGACGCACTGTGATT TCGAAAGCTACTTAGGAATCCGACAGAGTTTTGTTCTTGATTTTAAGATC TTGATCTCTCAGTAGCAACATCATCATTCAGATATTATTAGCACGtttaa gattttcttttcttactGATGTATACTACAtttctaaagattttttgtCT TCCTATATCCTTGTTAGACTACTACTGATACAGAGGAGCCGAATCTGCTC AAATCCCTTGTTTTCAATCAGATTATAGAGCTTTCAGCGGTTAAATGATC TTTGGAGTTAGTCCTTATACTTTTATCATACTTTCTAGTCAGTAATTGGG AAAGTTTTAGGGTTTATTTAATTAGTACGTGCTGTGGTTAACTGGTTAAA ATCTCATCTTACGTTTACTTATCAAGTGTTTGTTGAGCCCACATACTTAA GAAACAAAACTCGCTCCCAGTTTCCGTTTCACTAAGAGGCGTCGGTGGAG TTCTGAAGGGTTCTAAAGAGGATTCTTTGACTCCCTGACCCCCTTATTTT CGATATTTAGGTCTAAcggttttttattgtttttgataaAGTCTAGCTTT CATGTTTATGTTTTCATTTGCTATCTTTTCCCTCCATGTGCGAATGACGT TTTTCATAGTAAATTAGTGTGGTGACAATGTGTCTCTTTTGTCGACTTAA GGATTTTGTTGGGATttgtacttttgaatttgttCAAGGGCTTTTAATGA CTCAAAAGGGTTGGTTTAAAGAGGTCCTCTTGTCATTTGGAGCCTGGATG AGGTACCAGCTCTTGACGTTGTTTGCAAAGTCTTGAATATTGTGTCTTTT TACATTTGATGAACTTTATGGAATAAGCGGTTTTTATTCGTTGATGGGAG CCATGAAGAGCTTTTTTGCGAGCTTCGGTTGGATGTACTtattttgagtt tgaaatttgttACATTCAGATCATAATTAGAATCTCTAAGAAAATTTCAG ACGTCCTGGTGCCACTTTAAGAATGACATGGATTTTTTAGTGATCATAAA AAAGCCCTGACGGCAAGAAAGTTCGGAAAACTAGCTCTTCCATGTTACTT TGAAACCACAGTACCGGGTGGGGCAACAAATTGATAGTCGAAGAAATACT AGatagcagaaatgcactgtaagggtggacttttgatgaATGCACTGCAA TGGAGGCAATTTCAGCAAATccaggaaaaattgcaaatttttgcccgAAA ATTCCGATTTTTCGGCTTtaaaagagttgaaaatttgagaaaaatgtact gtaagggtatgaatttcagcgattttttgctgcactgtaagggtacgatt ctAAAAGCCAGATTTTTCGCCGCACTTACCCTCAGTTGGTAAACTCACTG CACCGACCCCCGCCGGTCACGATATCAGTGTAGAAAGTTAAGTTTAGTTC CCATGCTTTCTAGAGGCGGTAGAAAAACCCTACGTATGCGAGGATAGTAC AAATCAATTTCTCATTCATGACGAGAGTAATCTAATTGGAAGTTTCTTTA TCTAATGAAGTTTAATGAGATACTTAATGAAGAAGGCAATGTAATTATTT GGATCAGTTAGATCATTAAGAGAAAGATACATGAGCCGGATTTCTTATAA CTCATTATCTTGTCAATCGCTTAACGGCTGCGGATTCAGAGGTTTCTCAA ACTTTCTATTGACATACAAAGTTTACAAGGGAAATGAGGCGTCTTGCTTG GGACGTCTCTTTTTTTGTCActtaatttatttttacatcgaagtctccgt aattcgaaatttccacaATTCAAATGAATTTTCAGCTCAAGTTATGGAAA CTCCACTGTATTTTGAATGTACTCTCAATGAAGGAACCCTTTCAGAAATT TCCGGACCCAGTCAATAAACAGCCCCTtactttcttaatttttttatcaa acgaCGTAATATGTcagcaaaaagttttttcaactttttcgtttttctat tttcagaaaattatccGATACACAACAACAACAGTCACAAGTGGATAACG GAGAAATAAACGCCTGTCGTGATAGCGGAAGAAAAATGATTGATCGTCAG GTAAGGTGTTCTAAGGATTTGTAAGGATTAACTTGTTCACTTTGTTACCC CTTCTCAAAGTGTGGCTTGGGATTTGATTTTGGGGTGTTGAGAATAAAGA AAATCGTGTTGTTCCAAGTTATAtctatacacccctgtgtcacagaccca ctgagaccccagccccactggaaaatttggcaaaactttcgtccccggtg aaaaaaatacccttaaatttcagccccactgggaaattgactttgatttc atccccatttgaaattcaatgtttaaaaattatactccaaaCCCATCCCT Atgcactggattttttaaccttggaacaatagaatttctatccacattgg aatttcaataggagtttttatcccaactgaggaaaaaattccaccggggc tgtgagacaggtgtGTATCCATATATCTTGAGTTAACACAAATGTTACCA ACTCCGGCTATTATTCTGCTAAAATGGCACACGTATGAATTTAAAACGAC GTTAAAATGAGTTTAGTAGGCTCACTGAAGAAACATGTATATAAACAGTT TGAGTTACGTAAAACCCTATCATGTGGAGTAGCTCTCTGGGTTAACTGTG AGCTTAGCGTCCATTTTTGTTTgtccttttgttttgtttatttcgtGACG TCATCATAATGGCGGCTCTATTGAGTGACTCGCAGTCAGTGTACTGCTGT GCTTCAAACAGGTTTTTTTGTATTGCAATTGATTTGTAGACTAGAACTTA ACCTCGTTAAAGCTTGGCGGTGAGCTAGCCGGGTGATCATAGATTAATGA AAGCTTgttgttttataagaatacctAACTGAGCCTCCAAAATCAATAAT TATTTCAAGATGGGTGATTTATGTCTTAACCCTTTTGAACCCTTGGAATC AAAACTGACTTGGCGCCTACTCATAAAATTTTCACAATGTGTCTTGATTT TCGAATGACCCTGATTTCACAATCTAAAGGTCAATGTCAACTAATTTGTT TTGGCTAAAACACCACGTCAAATTTGCAGTGCGTGCTTATCATCACAAAT TCTGTCAAGGACAAAAAAGAACATCAAACATCTGTtccagtaaaattttc aaggGTTTAATggcttattttgaatttgtcttTTTACAAAGCCTGTTTAA GATTGAGAAGAATCTCCTGGATTTTCCCATATGTTTGTTtactttaaatg ttcttataagataTATTATCCTTACAATAAATTCATTTTATCTTATGACA TTAAAAGCAATTAAGTCGTCTTACCGGTTTGTACTATTTTGTAATTGGGT TAATTTGTGGGTAACCCatctcttcatttttttattatgtACAATCTTTT GGCAGCCATCTTGTCTTTTCCTTTTCCTCTGTCATCATATCAACACAAag agatatttcatttttgatgaattcttgaaagttttagtttttatttattt ctctgGTGAGGAAAGGCAGTTGGTTTTTGTTGATGTTGAAGAGTATTGTA AAATTTGTAAAGACTTTTTACCAAGATGGTGTATTTATAAAGATTGGAAA AGGATTGCTCTATACTGTAAAGAGACAAATTTAAGCTCGGTGCAGacatt ttggagaaaatatttgTTGTTGATTGTGTAGCAACAAAGTTTTTAAGACT TTTGTTGCTTAATTTATATTGCGTAGAACAATGAGTACTTTCGATTTCGA GAAGGTTTACAGCTCGTTTTGTGAGAAAGCTTTACATCGCTATTCAATTG ATTTGGGAAAGGTGGGTGCTTTTTAGAAGTATGATTCGAAGCATTTATTG GGTTCAATGCTAGGGCTGTACACCATAAACAAAACTTGTTTTTCTGCTAT TTTATATTGCGTGAGCATTTTCGTTGGAAATATAATGCTAAATGGCATAT CAAATTATTTAGAGAGGCTGATGATTAAACACCAAGCAATTTTACTGCAG CAGGATGAAAAGGTTTTTGGTGTTCTTAGAAAATATCCACTCTCTTATTT TATCTTTGTCCGATGAAATTGGCCTTTTTCAACTGTTTCACGGACCAAGT TTATGTCccagttttttcttttgttcgtCGAGACGAGCTATTAACTGTGA ATCATCATTATCAAAAtttgttcttagaaaaaaacgGCTCGATTTCATGA GATCTGATAAAGACGAGGTTATCTTAGTCTTTAACATGTGACGTCACTTT ACAATTAAGTAACAAGTTAAGGCTTAACGCGCTTAGTCATCAAAACACAG TTCTTAAAATCCCCTAATTAATTTTGAATGAAGATTAATTGATATACATT AGCCAGAATGATATTTTAATggttttgttatgtttttgattttttttagc cTGGAACAAAACGGTTTTACAACTTGACATCTGAATATGAGAAGACGGCG GCTGGTGATCATGAAGATGTTTCGGACTCCGATGAAAGCCGCTTATTTGT AGTAAACGACGGTTATTCATCCGACTTATCCGACATGTCGTCAATTCAtc gtcatcaaaataatttgtcaACAAAACGCGTCTTAAAAACACGACAAGTG CTCGATTCAAAACGAAACAGCGTGGTTATCGACGAATATTTATCCGATAC AGATCTTGATTCGTTAAGGACATCAACTCGAAACGAACAACGTAAAAAGA GATCGAAAAGTCACCGATTGATGAAAGACGAATCGAAGATTTATcgagaa aatttgttcgagaAAGACGATAAAGATCGTAAACGAAGATCGTGGACTGA TTCGGGTGTTTCACTTTCGTTATCGAGAACTGACCAATCGAGATGTGGAA CTTTTGATCACGGTGTATCGATTAGAAACACtgaaatggaaaatgaaaac CAAACACATTTAGAAGTTCCTTTACGGCGTCGAACGGCTAGTCAACTTCG AAAGACATCGACTGAAGCAACTAAATCGTTTAATCGATTGTCTCAAATCA CGAATCGAAGCTCTTTAACGAATGTATCGATCTTAACAACGACATCGATG ACTTCTCTCAGTTCGATCATCTCACCATCGGAATTAGAATATATTTCAGA ATCTGAAAGTTATAGTTCATctgatgatgatattcttaCTGATTCCCTCT TGAGAAATTTGAAACATACTCCTGGCGGTGGCTCACAATTATCAATGACA TCTACAGCTTCTACAATCAAAGCTGATAACGAGAATATTTCAGCCACCGA TCCTGAGAAATATATAGATATGCAATTAAGGTTATATCAAAAGCAAAAAC AACAAACGAATAAATGTCAAAAACAATCACATTCTCGTAAAAGAAGCAAC AGCCTCATTCAGAAATTCAAATCGCATTTTCATAAATCAAAACAGCAGAG TCCGAATCGTAGCTCCAAAGATGTGTCGTCAGAATTCTCCTTtgagaaag ttgaaaaagattCTAATCAGAAATATGAAGTCATTACGACTGATTTTCTA AAGAAACTGAGAGACGAAGAATCAGCGCCTTTAGATTTTTATGTTGATGA CGTTCAGTATGAAGATGATCTAAGTGATGAAGATGATGAGAACCAATCAA AAGACCCATTGGAAAATTTCTCATCCAAGCCACATAacaaagaacataaa acttttcttggtaaattttttaaaaggacACGCTCTTATTCGGTTTCACC AcaacttgaaaagaaaacaccGAAATCACGATTTAGTAGAAATTCGTTTC GAGCAAGCACTCGATCGAATCCTGAAATGCCATCTAAAgaagataatttt tcaaatgttggaCGATATACATCGATGgataatttgaatttgaaagaagG TGGCCACCAACAAGACTCTGAAAATTATACACCGAAAATGAACAGAAGTG AGACTTTTAGTGGAGCTATTTCATATAATCATGAAAATCGAACCATGTAC GATTCAAACTTTAATCGAAACCAATTGCCAACACAATCACCTACTATAAT GCAAAAACAATGTCTCGGTATTCCGGCTCACGGTTCTGTTACTCCGAAAG CGAGCAGTCCAGATTTCTCGAAAGAATCACCAATTCCACCCCCTTCACCG ACGCCAAGCGTttttgatttagaaaaattccaaCAAGTACACATGCCGTT AGACCGTTGTAACTGTGAAGAATGTATGTACGCAGACTATCTAGACTATC TTGAGTTTCAACGATTTCGAAGGTATTATTCTCAATCTTGTTGTGGACCG TGTTGTATGGCTCCAACTGATCTCCCTGTATCTCCACATACACCACAAAT GGCGNACCGTGTTGTATGGCTCCAACTGATCTCCCTGTATCTCCACATAC ACCACAAATGGCGCCCATGCGTATTTCTCCACGCCATGTACACCCTGAAG CAAATATCATAGCACCTTTACCGGTGACCaaagaaactgaaaaacaaGCC AAAAATCTTCGCACCTCAATTTACGAATCTTTTGTATAATACtatatttt taatgaaatcaatatttttcttaaagcAGTTTTTATTTATAATGTTGAAA TAATTAGAATAACCATTTTTAATACAAAACTTCAGCCTCACTTCAAACGC AGTCAGGGATATATGTTCAAATTAGCCGATTATCGGTTGTTTAGCCTATT ATCGGTTTAGACGATATC

Coding sequence (CDS) from alignment at sc0000012:1005534..1018801+

>TCONS_00001855 ID=TCONS_00001855|Name=TCONS_00001855|organism=Clytia hemisphaerica|type=CDS|length=6660bp|location=Sequence derived from alignment at sc0000012:1005534..1018801+ (Clytia hemisphaerica)
ATGGAGCCTTCCTTATTATCAGACAATGTTTCTTGTGATTTTGACGAATG
GGTAGTTatggttttcaaagtttttcttggATATTTCATGATTCGGTGTG
TGTGGAAATCGAGaaaattatccGATACACAACAACAACAGTCACAAGTG
GATAACGGAGAAATAAACGCCTGTCGTGATAGCGGAAGAAAAATGATTGA
TCGTCAGccTGGAACAAAACGGTTTTACAACTTGACATCTGAATATGAGA
AGACGGCGGCTGGTGATCATGAAGATGTTTCGGACTCCGATGAAAGCCGC
TTATTTGTAGTAAACGACGGTTATTCATCCGACTTATCCGACATGTCGTC
AATTCAtcgtcatcaaaataatttgtcaACAAAACGCGTCTTAAAAACAC
GACAAGTGCTCGATTCAAAACGAAACAGCGTGGTTATCGACGAATATTTA
TCCGATACAGATCTTGATTCGTTAAGGACATCAACTCGAAACGAACAACG
TAAAAAGAGATCGAAAAGTCACCGATTGATGAAAGACGAATCGAAGATTT
ATcgagaaaatttgttcgagaAAGACGATAAAGATCGTAAACGAAGATCG
TGGACTGATTCGGGTGTTTCACTTTCGTTATCGAGAACTGACCAATCGAG
ATGTGGAACTTTTGATCACGGTGTATCGATTAGAAACACtgaaatggaaa
atgaaaacCAAACACATTTAGAAGTTCCTTTACGGCGTCGAACGGCTAGT
CAACTTCGAAAGACATCGACTGAAGCAACTAAATCGTTTAATCGATTGTC
TCAAATCACGAATCGAAGCTCTTTAACGAATGTATCGATCTTAACAACGA
CATCGATGACTTCTCTCAGTTCGATCATCTCACCATCGGAATTAGAATAT
ATTTCAGAATCTGAAAGTTATAGTTCATctgatgatgatattcttaCTGA
TTCCCTCTTGAGAAATTTGAAACATACTCCTGGCGGTGGCTCACAATTAT
CAATGACATCTACAGCTTCTACAATCAAAGCTGATAACGAGAATATTTCA
GCCACCGATCCTGAGAAATATATAGATATGCAATTAAGGTTATATCAAAA
GCAAAAACAACAAACGAATAAATGTCAAAAACAATCACATTCTCGTAAAA
GAAGCAACAGCCTCATTCAGAAATTCAAATCGCATTTTCATAAATCAAAA
CAGCAGAGTCCGAATCGTAGCTCCAAAGATGTGTCGTCAGAATTCTCCTT
tgagaaagttgaaaaagattCTAATCAGAAATATGAAGTCATTACGACTG
ATTTTCTAAAGAAACTGAGAGACGAAGAATCAGCGCCTTTAGATTTTTAT
GTTGATGACGTTCAGTATGAAGATGATCTAAGTGATGAAGATGATGAGAA
CCAATCAAAAGACCCATTGGAAAATTTCTCATCCAAGCCACATAacaaag
aacataaaacttttcttggtaaattttttaaaaggacACGCTCTTATTCG
GTTTCACCAcaacttgaaaagaaaacaccGAAATCACGATTTAGTAGAAA
TTCGTTTCGAGCAAGCACTCGATCGAATCCTGAAATGCCATCTAAAgaag
ataatttttcaaatgttggaCGATATACATCGATGgataatttgaatttg
aaagaagGTGGCCACCAACAAGACTCTGAAAATTATACACCGAAAATGAA
CAGAAGTGAGACTTTTAGTGGAGCTATTTCATATAATCATGAAAATCGAA
CCATGTACGATTCAAACTTTAATCGAAACCAATTGCCAACACAATCACCT
ACTATAATGCAAAAACAATGTCTCGGTATTCCGGCTCACGGTTCTGTTAC
TCCGAAAGCGAGCAGTCCAGATTTCTCGAAAGAATCACCAATTCCACCCC
CTTCACCGACGCCAAGCGTttttgatttagaaaaattccaaCAAGTACAC
ATGCCGTTAGACCGTTGTAACTGTGAAGAATGTATGTACGCAGACTATCT
AGACTATCTTGAGTTTCAACGATTTCGAAGGTATTATTCTCAATCTTGTT
GTGGACCGTGTTGTATGGCTCCAACTGATCTCCCTGTATCTCCACATACA
CCACAAATGGCGNACCGTGTTGTATGGCTCCAACTGATCTCCCTGTATCT
CCACATACACCACAAATGGCGCCCATGCGTATTTCTCCACGCCATGTACA
CCCTGAAGCAAATATCATAGATGGAGCCTTCCTTATTATCAGACAATGTT
TCTTGTGATTTTGACGAATGGGTAGTTatggttttcaaagtttttcttgg
ATATTTCATGATTCGGTGTGTGTGGAAATCGAGaaaattatccGATACAC
AACAACAACAGTCACAAGTGGATAACGGAGAAATAAACGCCTGTCGTGAT
AGCGGAAGAAAAATGATTGATCGTCAGccTGGAACAAAACGGTTTTACAA
CTTGACATCTGAATATGAGAAGACGGCGGCTGGTGATCATGAAGATGTTT
CGGACTCCGATGAAAGCCGCTTATTTGTAGTAAACGACGGTTATTCATCC
GACTTATCCGACATGTCGTCAATTCAtcgtcatcaaaataatttgtcaAC
AAAACGCGTCTTAAAAACACGACAAGTGCTCGATTCAAAACGAAACAGCG
TGGTTATCGACGAATATTTATCCGATACAGATCTTGATTCGTTAAGGACA
TCAACTCGAAACGAACAACGTAAAAAGAGATCGAAAAGTCACCGATTGAT
GAAAGACGAATCGAAGATTTATcgagaaaatttgttcgagaAAGACGATA
AAGATCGTAAACGAAGATCGTGGACTGATTCGGGTGTTTCACTTTCGTTA
TCGAGAACTGACCAATCGAGATGTGGAACTTTTGATCACGGTGTATCGAT
TAGAAACACtgaaatggaaaatgaaaacCAAACACATTTAGAAGTTCCTT
TACGGCGTCGAACGGCTAGTCAACTTCGAAAGACATCGACTGAAGCAACT
AAATCGTTTAATCGATTGTCTCAAATCACGAATCGAAGCTCTTTAACGAA
TGTATCGATCTTAACAACGACATCGATGACTTCTCTCAGTTCGATCATCT
CACCATCGGAATTAGAATATATTTCAGAATCTGAAAGTTATAGTTCATct
gatgatgatattcttaCTGATTCCCTCTTGAGAAATTTGAAACATACTCC
TGGCGGTGGCTCACAATTATCAATGACATCTACAGCTTCTACAATCAAAG
CTGATAACGAGAATATTTCAGCCACCGATCCTGAGAAATATATAGATATG
CAATTAAGGTTATATCAAAAGCAAAAACAACAAACGAATAAATGTCAAAA
ACAATCACATTCTCGTAAAAGAAGCAACAGCCTCATTCAGAAATTCAAAT
CGCATTTTCATAAATCAAAACAGCAGAGTCCGAATCGTAGCTCCAAAGAT
GTGTCGTCAGAATTCTCCTTtgagaaagttgaaaaagattCTAATCAGAA
ATATGAAGTCATTACGACTGATTTTCTAAAGAAACTGAGAGACGAAGAAT
CAGCGCCTTTAGATTTTTATGTTGATGACGTTCAGTATGAAGATGATCTA
AGTGATGAAGATGATGAGAACCAATCAAAAGACCCATTGGAAAATTTCTC
ATCCAAGCCACATAacaaagaacataaaacttttcttggtaaatttttta
aaaggacACGCTCTTATTCGGTTTCACCAcaacttgaaaagaaaacaccG
AAATCACGATTTAGTAGAAATTCGTTTCGAGCAAGCACTCGATCGAATCC
TGAAATGCCATCTAAAgaagataatttttcaaatgttggaCGATATACAT
CGATGgataatttgaatttgaaagaagGTGGCCACCAACAAGACTCTGAA
AATTATACACCGAAAATGAACAGAAGTGAGACTTTTAGTGGAGCTATTTC
ATATAATCATGAAAATCGAACCATGTACGATTCAAACTTTAATCGAAACC
AATTGCCAACACAATCACCTACTATAATGCAAAAACAATGTCTCGGTATT
CCGGCTCACGGTTCTGTTACTCCGAAAGCGAGCAGTCCAGATTTCTCGAA
AGAATCACCAATTCCACCCCCTTCACCGACGCCAAGCGTttttgatttag
aaaaattccaaCAAGTACACATGCCGTTAGACCGTTGTAACTGTGAAGAA
TGTATGTACGCAGACTATCTAGACTATCTTGAGTTTCAACGATTTCGAAG
GTATTATTCTCAATCTTGTTGTGGACCGTGTTGTATGGCTCCAACTGATC
TCCCTGTATCTCCACATACACCACAAATGGCGNACCGTGTTGTATGGCTC
CAACTGATCTCCCTGTATCTCCACATACACCACAAATGGCGCCCATGCGT
ATTTCTCCACGCCATGTACACCCTGAAGCAAATATCATAGATGGAGCCTT
CCTTATTATCAGACAATGTTTCTTGTGATTTTGACGAATGGGTAGTTatg
gttttcaaagtttttcttggATATTTCATGATTCGGTGTGTGTGGAAATC
GAGaaaattatccGATACACAACAACAACAGTCACAAGTGGATAACGGAG
AAATAAACGCCTGTCGTGATAGCGGAAGAAAAATGATTGATCGTCAGccT
GGAACAAAACGGTTTTACAACTTGACATCTGAATATGAGAAGACGGCGGC
TGGTGATCATGAAGATGTTTCGGACTCCGATGAAAGCCGCTTATTTGTAG
TAAACGACGGTTATTCATCCGACTTATCCGACATGTCGTCAATTCAtcgt
catcaaaataatttgtcaACAAAACGCGTCTTAAAAACACGACAAGTGCT
CGATTCAAAACGAAACAGCGTGGTTATCGACGAATATTTATCCGATACAG
ATCTTGATTCGTTAAGGACATCAACTCGAAACGAACAACGTAAAAAGAGA
TCGAAAAGTCACCGATTGATGAAAGACGAATCGAAGATTTATcgagaaaa
tttgttcgagaAAGACGATAAAGATCGTAAACGAAGATCGTGGACTGATT
CGGGTGTTTCACTTTCGTTATCGAGAACTGACCAATCGAGATGTGGAACT
TTTGATCACGGTGTATCGATTAGAAACACtgaaatggaaaatgaaaacCA
AACACATTTAGAAGTTCCTTTACGGCGTCGAACGGCTAGTCAACTTCGAA
AGACATCGACTGAAGCAACTAAATCGTTTAATCGATTGTCTCAAATCACG
AATCGAAGCTCTTTAACGAATGTATCGATCTTAACAACGACATCGATGAC
TTCTCTCAGTTCGATCATCTCACCATCGGAATTAGAATATATTTCAGAAT
CTGAAAGTTATAGTTCATctgatgatgatattcttaCTGATTCCCTCTTG
AGAAATTTGAAACATACTCCTGGCGGTGGCTCACAATTATCAATGACATC
TACAGCTTCTACAATCAAAGCTGATAACGAGAATATTTCAGCCACCGATC
CTGAGAAATATATAGATATGCAATTAAGGTTATATCAAAAGCAAAAACAA
CAAACGAATAAATGTCAAAAACAATCACATTCTCGTAAAAGAAGCAACAG
CCTCATTCAGAAATTCAAATCGCATTTTCATAAATCAAAACAGCAGAGTC
CGAATCGTAGCTCCAAAGATGTGTCGTCAGAATTCTCCTTtgagaaagtt
gaaaaagattCTAATCAGAAATATGAAGTCATTACGACTGATTTTCTAAA
GAAACTGAGAGACGAAGAATCAGCGCCTTTAGATTTTTATGTTGATGACG
TTCAGTATGAAGATGATCTAAGTGATGAAGATGATGAGAACCAATCAAAA
GACCCATTGGAAAATTTCTCATCCAAGCCACATAacaaagaacataaaac
ttttcttggtaaattttttaaaaggacACGCTCTTATTCGGTTTCACCAc
aacttgaaaagaaaacaccGAAATCACGATTTAGTAGAAATTCGTTTCGA
GCAAGCACTCGATCGAATCCTGAAATGCCATCTAAAgaagataatttttc
aaatgttggaCGATATACATCGATGgataatttgaatttgaaagaagGTG
GCCACCAACAAGACTCTGAAAATTATACACCGAAAATGAACAGAAGTGAG
ACTTTTAGTGGAGCTATTTCATATAATCATGAAAATCGAACCATGTACGA
TTCAAACTTTAATCGAAACCAATTGCCAACACAATCACCTACTATAATGC
AAAAACAATGTCTCGGTATTCCGGCTCACGGTTCTGTTACTCCGAAAGCG
AGCAGTCCAGATTTCTCGAAAGAATCACCAATTCCACCCCCTTCACCGAC
GCCAAGCGTttttgatttagaaaaattccaaCAAGTACACATGCCGTTAG
ACCGTTGTAACTGTGAAGAATGTATGTACGCAGACTATCTAGACTATCTT
GAGTTTCAACGATTTCGAAGGTATTATTCTCAATCTTGTTGTGGACCGTG
TTGTATGGCTCCAACTGATCTCCCTGTATCTCCACATACACCACAAATGG
CGNACCGTGTTGTATGGCTCCAACTGATCTCCCTGTATCTCCACATACAC
CACAAATGGCGCCCATGCGTATTTCTCCACGCCATGTACACCCTGAAGCA
AATATCATAG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000980XLOC_000980Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001855-proteinTCONS_00001855-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001855-exon-sc0000012-1491911889:1005534..1005788TCONS_00001855-exon-sc0000012-1491911889:1005534..1005788Clytia hemisphaericaexon
TCONS_00001855-exon-sc0000012-1510915933:1005534..1005788TCONS_00001855-exon-sc0000012-1510915933:1005534..1005788Clytia hemisphaericaexon
TCONS_00001855-exon-sc0000012-1575043694:1005534..1005788TCONS_00001855-exon-sc0000012-1575043694:1005534..1005788Clytia hemisphaericaexon
TCONS_00001855-exon-sc0000012-1491911889:1014090..1014183TCONS_00001855-exon-sc0000012-1491911889:1014090..1014183Clytia hemisphaericaexon
TCONS_00001855-exon-sc0000012-1510915933:1014090..1014183TCONS_00001855-exon-sc0000012-1510915933:1014090..1014183Clytia hemisphaericaexon
TCONS_00001855-exon-sc0000012-1575043694:1014090..1014183TCONS_00001855-exon-sc0000012-1575043694:1014090..1014183Clytia hemisphaericaexon
TCONS_00001855-exon-sc0000012-1491911889:1016533..1018801TCONS_00001855-exon-sc0000012-1491911889:1016533..1018801Clytia hemisphaericaexon
TCONS_00001855-exon-sc0000012-1510915933:1016533..1018801TCONS_00001855-exon-sc0000012-1510915933:1016533..1018801Clytia hemisphaericaexon
TCONS_00001855-exon-sc0000012-1575043694:1016533..1018801TCONS_00001855-exon-sc0000012-1575043694:1016533..1018801Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000012supercontigsc0000012:1005534..1018801 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0.153612 0 0.229004 0 9.13685e-10 0.52303 2.05522 3.04273e-05 0 0 7.39864e-08 4.73151e-10 0 0.356229 0 0 0 0 0 0 0 0 0 0 4.30948 0.000915576 1.37087 0 0 0
Blast
The following BLAST results are available for this feature:
BLAST of TCONS_00001855 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 0
Match NameE-valueIdentityDescription
back to top