Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001852 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001852
Unique NameTCONS_00001852
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length3793

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001852 ID=TCONS_00001852|Name=TCONS_00001852|organism=Clytia hemisphaerica|type=transcript|length=3793bp
AGAGACCAAActgtggagagcatcaaaataatgcgcgcgcatctgtttta
cgaattacgggaaaggtgtatcaAAGTTAGTTTTTGGTGGCAGGTTTGGA
TGGCTCccctaaatatttcaaaattttggttggCCTAACGCCGATAACCC
TGGTCTAATTCTGATAgagtggtataatatcatgaatagattgaacatac
taaaatttgaggggattttgttagacagaacttaagaaaagctcaaaaac
caaCTGCAACTTTCCCTAAGAACGCAGCAGGCACAGGCAAagacgggttt
gtttacctccagagaccaaaggatagagagcatcaaaataattcgCATGC
ATTAGTTTTACAAATtacaggaaaggtgtattgttGTTTTGGTTGATTGC
GAGAGAAAATATAGAATCTGATTGTAAGTAATAAAATGAGCCGCAAAGAA
GAATCCTTTACAATCAGGTATGTTGAATGTATAAGTGTAGTGAAAACTTG
TTGAACAGAGGTTAGAAATCATGTCTGGCAGCACTCTGCTATCGCTGTCG
TCATCAGACAGTACAGTAGAAAGAAAGGAAGGAACCAAGGGAAAAgtata
aaaatcaaattgaactgCTTACCCTGACATGGAGTGTTTTAGAAACCTTA
CAAATGTACTGGCTCGTATTGcctttaatatttttcttatatgCTGAATA
TATATTATGTTGTTATGTATATGTCATGTACATATGTCTTTGTGGGATGG
GAGTGTAACTGGTAACCTGCTTTAACCAATGAACCACCACGTGTGATCGA
ATCACTGACCTTTTATAACCTtattatataaaggtcagtggatcgAATGA
TATGCACAAAATGGTTGCAAGTTATGACCGCCCGGCGCGTGGGGCGTGCG
GCCGCCTATCATATTTACGGCGTTTAACAAACATTAGGTAATCCAAAATG
GTAGATTTGAAAcataaataaatcaatttttggcAGCGAAAACCATCAAA
AAAAGTCTTTTCTCTGACAAATTTAGGGTTAATCAAGCTCTTCAAGATGT
ATGGACACTTCCAACAGCAACCAGctcAACAAATGCGTCCTGAACTTCTT
CAGgaaGTCAAATTATATTCCAATGCAAGAGAACGAGAAAAGTTTGATAA
TATGGCAGAATTGTTTGCTGTAATAAATACATTACAACATTTAGAAAAAG
CATACATTAAAGATGCTATTCATCCCAAAGAGTACACAGCAGCTTGTAGC
AAACTTCTTGTGCAGTACAAGGCTGCTTTCAAACAAGTACAAAGTGCAGA
CTTTCCTACTGtggaagcatttacaaaaatttacagGCTTGACTGTCCAG
CAGCATTGGAGAGGATACGAGAAGATCGACCAATCACTATCAAAGATGAT
GCCGGAAATACAAGCAAATCTATCGCTAACATTGTTGAGAGATTCATCAC
GATCATGGATAGATTACGACTTCAGATACGAGCAAAAGATGAAATCCATC
CTGATTTAGAAGATTTGAAATTGACAATGGATCGTTTAAGTATGTTATCT
GATGACTTTGAAGGAAAAGTTGCTGTACAAAAATGGTTGGATACATTAAG
TGAAATGAGAGCTCACGATGAGCTAGACGAGGAACAAGTCAGACAAATGA
TTTTTGACATCGAACAATCATATTACGCTTTTAACAGGTTGTTACAGCAC
ACTTAGAAAAAGTGAAAGAATTTATGAAAATTGTAAATTCTGCTACCGTG
CCCAGTCAACTACTATTTAAAAATAGCAAATTTCTATTAAGAACAATGGA
ACACTTTAAGAATAGTGGAGGTGGTGAGAATATTGATGCCAAAGAAGATC
GATAATATCCCTTCAACATTTCATCGATGTCAGAAATGTATTTGAGGTTT
TTAGTATCATTTAAGTATTCAAATATTATTAATTGGAATTACTTGACAAA
GTTGGGATGATATCTTGATGGAGTAAGGTTCAAAATTAACTAAACTGAAC
CTTTATTCACAATTATATGACCCGGCCTTTAGGGAATGTTTTTCTGGTAT
TCCTGGTTGATGTAATGGAAATAATTTCACCGTACAAAGAATATGATTTC
AAACGTTGActagatagaccttttcataaatcacgtcacgaacatcactt
gcctcgtattcaaacgattaccatggtgattatgtctcttgagacattaa
atgacttttttatgaataggaaatAGTTATAATAATATCCGCCGGGAGTT
AATCactatggcaataatttcaaaacgaggcaagtgatgttcgtaacgta
attttatgaaaaggtctatagagAGAGAGGAAATCCGTCTTTCCTTAGTT
TTTGTAGAATTGTATTTATGCATTaattttatgttgattttttaGTTAAT
TTGTATTTCAAACAACCAAATCTTACTACTCTGAACCTTCGAAAGGAATC
GGAATTGATTATTTTGTTACAGATAACCTTTGGTATTCAATTGAAGGTCT
GAATGGTGCgactttgcttgcttgttttcaATTTCTATTATTTAAAGATT
ACGTAATGTAATGACCGACCCTCTTTAATGTAGCCAATTTTTGACGAGGC
AAACCAAGAAAAGCAGTCAGGACAAAACTCAGTTGTTATGCCCACTCCAT
GTTGACTCGAAGTTTCTTATTTTACGAAAGTATTTACATCAAACTTAACA
AAAAAGTGAATCTTTACTTTTTCAGTACCTCCTATGGGATGTAACCTTTT
GTTTAAAACGGCTCATCGTTTATACCGTTACCAATAGTAACTAGCCGTTG
GATTAAGTGCCGTTTATTCATTATTGCGAGcacggattttagatttttaa
aatttagttgTGATGCttaaataaaattattctttagcataaacttttta
aacttttattagTTTGATTATGATTTTCTTAGATATGCCTTAGCTTTCTG
TACTCGGAGGAAAATGCTTGGTCNcaataatttcaaaacgaggcaagtga
tgttcgtaacgtaattttatgaaaaggtctatagagAGAGAGGAAATCCG
TCTTTCCTTAGTTTTTGTAGAATTGTATTTATGCATTaattttatgttga
ttttttaGTTAATTTGTATTTCAAACAACCAAATCTTACTACTCTGAACC
TTCGAAAGGAATCGGAATTGATTATTTTGTTACAGATAACCTTTGGTATT
CAATTGAAGGTCTGAATGGTGCgactttgcttgcttgttttcaATTTCTA
TTATTTAAAGATTACGTAATGTAATGACCGACCCTCTTTAATGTAGCCAA
TTTTTGACGAGGCAAACCAAGAAAAGCAGTCAGGACAAAACTCAGTTGTT
ATGCCCACTCCATGTTGACTCGAAGTTTCTTATTTTACGAAAGTATTTAC
ATCAAACTTAACAAAAAAGTGAATCTTTACTTTTTCAGTACCTCCTATGG
GATGTAACCTTTTGTTTAAAACGGCTCATCGTTTATACCGTTACCAATAG
TAACTAGCCGTTGGATTAAGTGCCGTTTATTCATTATTGCGAGcacggat
tttagatttttaaaatttagttgTGATGCttaaataaaattattctttag
cataaactttttaaacttttattagTTTGATTATGATTTTCTTAGATATG
CCTTAGCTTTCTGTACTCGGAGGAAAATGCTTGGTCATCGTTTTTAATCT
CGGAAGTGAAGCTCATGGtagactttcaaaacttttttatggaaacTAGC
GGATTAACGAAAATAAATTTCTCGTGTTGAATAAGCACTATAC
Run BLAST on NCBI

protein sequence of TCONS_00001852-protein

>TCONS_00001852-protein ID=TCONS_00001852-protein|Name=TCONS_00001852-protein|organism=Clytia hemisphaerica|type=polypeptide|length=219bp
MYGHFQQQPAQQMRPELLQEVKLYSNAREREKFDNMAELFAVINTLQHLE
KAYIKDAIHPKEYTAACSKLLVQYKAAFKQVQSADFPTVEAFTKIYRLDC
PAALERIREDRPITIKDDAGNTSKSIANIVERFITIMDRLRLQIRAKDEI
HPDLEDLKLTMDRLSMLSDDFEGKVAVQKWLDTLSEMRAHDELDEEQVRQ
MIFDIEQSYYAFNRLLQHT
Run BLAST on NCBI

transcript from alignment at sc0000012:986574..1002167+

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001852 ID=TCONS_00001852|Name=TCONS_00001852|organism=Clytia hemisphaerica|type=transcript|length=15594bp|location=Sequence derived from alignment at sc0000012:986574..1002167+ (Clytia hemisphaerica)
AGAGACCAAActgtggagagcatcaaaataatgcgcgcgcatctgtttta cgaattacgggaaaggtgtatcaAAGTTAGTTTTTGGTGGCAGGTTTGGA TGGCTCccctaaatatttcaaaattttggttggCCTAACGCCGATAACCC TGGTCTAATTCTGATAgagtggtataatatcatgaatagattgaacatac taaaatttgaggggattttgttagacagaacttaagaaaagctcaaaaac caaCTGCAACTTTCCCTAAGAACGCAGCAGGCACAGGCAAagacgggttt gtttacctccagagaccaaaggatagagagcatcaaaataattcgCATGC ATTAGTTTTACAAATtacaggaaaggtgtattgttGTTTTGGTTGATTGC GAGAGAAAATATAGAATCTGATTGTAAGTAATAAAATGAGCCGCAAAGAA GAATCCTTTACAATCAGGTATGTTGAATGTATAAGTGTAGTGAAAACTTG TTGAACAGAGGTTAGAAATCATGTCTGGCAGCACTCTGCTATCGCTGTCG TCATCAGACAGTACAGTAGAAAGAAAGGAAGGAACCAAGGGAAAAgtata aaaatcaaattgaactgCTTACCCTGACATGGAGTGTTTTAGAAACCTTA CAAATGTACTGGCTCGTATTGcctttaatatttttcttatatgCTGAATA TATATTATGTTGTTATGTATATGTCATGTACATATGTCTTTGTGGGATGG GAGTGTAACTGGTAACCTGCTTTAACCAATGAACCACCACGTGTGATCGA ATCACTGACCTTTTATAACCTtattatataaaggtcagtggatcgAATGA TATGCACAAAATGGTTGCAAGTTATGACCGCCCGGCGCGTGGGGCGTGCG GCCGCCTATCATATTTACGGCGTTTAACAAACATTAGGTAATCCAAAATG GTAGATTTGAAAcataaataaatcaatttttggcAGCGAAAACCATCAAA AAAAGTCTTTTCTCTGACAAATTTAGGGTTAATCAAGCTCTTCAAGATGT ATGGACACTTCCAACAGCAACCAGGTATTAGTCatcaatgttttttattt tcgtccttgttaaaatttttcttgatatttcttttcttttttacataaaa tttgattgattgtttaaaaaaaaaggtgtagttaattccagacgatgtca atcgaaagaAGCGAACGGCGAATCAAACGACCACGTCGTCCGatgggggg taacaaaaattttctggaatagcccaaagagaatgttttagatatttgaa catgatattaatgacaattttatgtatctatctctcctgaaaatttcaca aaaatttatattgaggaaaagaagttatgattaaaaggagttcttNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNaaaaaaattttttcccccctat acgtccttttgacctcaaaacccattcccCCCCTGAATTCAGGGGGGCCG ACACTATTCAATagttgcaattcgattgtcgaacgcaatcgaatcgcaat cgaatattacccaggatttgctgttcgatattgcttcgattacgttcgat tatgtattcgattacgttcgattaaTTCAATTATATTAGATTTTATGCGC TTTGGTACGGTACTTAAGCAATCGGCCGCCCGCTAAAAAGCCCTAACAAA GTGATCCAAACTCATttaatcaaactcatcaaacataatcctaatcgaac aaaatcgaagATTATTCGAATGCAAATGACAATTGAACATAgttcaacta tcaatcgaaccaatctaaccttactcaaacGCAATCAAACCGGGGGCGGC GAAACGGGAGGGGCCGGggggccatgcccccccccacttttttgctaaga aaaaaaaaattcgtggccatggtggcgcctcctcagatacttactatttg gcccctccactttcaaaattgattcgccggccctgcaaacacaatcgaat attacccaggaatcagcCCTTCGATTGAGATTGGATTATttaattattcg attgcgttcgatgattacgtttgattggtttgattgcgatttttgttcga agttgttgcATTGCAGGACTTAAGTCCGGTAGTCCGGTGCATCCACTGtg cattatttttgaaacacaCATGTCTGGTGTCCAGAAGTTTGAGAAATTAA TACTGGACTAACACCGGACAAAAGGTTATTCGATGTGGCTGAGAGATACT TTTTGGTACCCGACAAAACACTGGACTACCCGGTGTGTCGACAGGATCGT TTTGTTATTCAAAAGAGTCGCATTCTCCTAGCCAAACCGTAAATTATTTC ACCATTTAGTTTTTCTAAGATGTTGTCTGAGTATACCACAGATTTTGACT TATTTACCGCCGTCGCCGCCGGTATTGTGCTATTTCCGCTATAGATTTCT AGTCATAGATAACTTACCGCCGCCGGGTGATATACGATCACCGGCGGAAA CCTGGAGACTACCGCAATAGGATTCTATTCTCAAAGAAAGTTCTAAATtc aaaacccgccgccgccggtaatatACGATCACCGGCGGAAACCTGCAGAC TACCGCAATATGATTCTATTCTCAAAGAAAGGTCTAAATTAAAAACCCGC CGCCACCGCCGGTAATAAACGATCTACGGCGGAAAACCGCAGACTACCGC AATAGGATTCTATTctcaaagaaatttctaaattcaaaacccGCTGCCAC CACCGGTAATATACGATCACCGGCGGAAACCCGCAGACTACCGAAATAGG ATTCTATTCTCNTTCTCAAAGAAAGTTCTAGATtcaaaacccgccgccgc cgccggtaatagACGATCACCGGCGGAAACCCGGAGACTACCGCAATAGT AATAGACAAACACATACAACAATATGATCATAGGCTCAAGCAAAGAGTTT AGATACAACCACAATAGGATTCTAATAGcctcaatgaaagaaatttatga aatcaAAAATCAAAATCCATCTTATTATTAATCGAAAATAGATATTGTTT GGCAGCGCATAGACTTAAActtgagtttgaaaaatgaaataattgcTTAT ATCATCCCTATCTCGATAAATTCCAAAAGGTCATTGACATGAACACCGAA GTGCCAGAACAATCGTTTTCTAAATTGAATCGATTCAAATATTCTACTCG AAAAATGAGTTACTGCAAGAgactattattttttaaatctattgaTCATA GTCATAACAAAAGGCTGACAAAGTAGTGGAATTACACCCCTGNAaacccg gcggcggcggcggtaaaTTATTCTAATGAAAATTGCTATCAATTTTAGAC AAGTTCTGACGAATGAGAAATACCGCCGGGTTTCTGCCGGGCTACGCGGT AAATAGATTGATATCTGTGCCTAAATGTGNAGAAGGATCGCTTTTATTAT ATAGAAGGGTTTTTTGAGATTAAGTACGATGGGATGAGGGTAATAAGTGA AggtttaattttgttttattaaaGTCACTGcagtaagtttttttatttag ttgCGTCTTCTAAATGGTTTAACGTTTTTTTTTNNNNNNNNNNNNNNNNt cttgtctctggtttacgtgTGCAGGGATGTTGTCCCTGTATATGTGAGTG CATCTGGTTGGTTGATTCGAGCCCAGTTACTTTGCAGAATTTTTGTGggg ttttcaatatttttctatgCGCACCTGTGCGCACGCATAATTTATAGAAA AAGCTGCCATTgcaaaaaagataaacaaatgaaaatgaaaacacagattc ctttctaaacaaaatggctaaTGTCTGGGAGtttttataaatgtggctga tATTTTGCTGTTGCTTTtggtagttttgaaagttttaaaagtttgtttat atGAGCTTGTTTATAAAGAGACCTgggtttcaaaagttttcaaacacAGT CAATACACAGTCCACCAACAGTCTGTGTCATTCAAACTGTACCAGACTTT TTTatttgcaccagactctaaaattttagaaattttgtatgTTGAGGATT TAAGAGTtttattttctgagattttGAGTCTGAGTCTAAATTTGACGTCA GAACAGATCAGTCGCgctcttcgtttttttttttaaatggagaattttta ataaaatacaaaaacatgaaaaaaacgaccaaatttcaacaaaaaacggt ATTGCCTAGCAGAATTTCAACAAGAGATGaaatcgaaaatgttgcaaatc GATGTACAGAACAAAATTGCATAAATGATGACGACAAAATGAGATTAGGA TGTCATAAATGTCAACGAACACTGCATTATACATGCACAGGACTACCATC TTACCAAATACAAATGTTCCTGAATAAAGGCTATCGAAAATACCAATGCa taaattgctgttccatcgaTCAAGAGCTANNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAAcctttgtaat aaaccaaaccaatgtatgagcgatttatagaggcccatgtgcatgcacgg tggcctggaaatctgtaaaacattattattattattataatatcgAGGCT AGCATTCTCCCAAACAGctttttaaaacatttctgCTGGAGTAATTAAAG TTATTCAAAAGTCTGCTGGCTCTCCCAAACGACCAGCTATATCACAAGTT GTACAAACTGgaagtttctttttaaaacggtttttaataaaaaattgact taaaggctatagcgctatacttatagtagggcTTCGATTTGGTGGCACCt ccatggtatactctgaaatacatgctgatgtcagcccgaaagctgattgg cttTAACCGACAGTTATACGCGGTTTAAGAGtatagctaaaactttgtta tgttttcaacagtaaaggaaagtgaatgaagacaaaatgtaaaaaaaaaa attgcagaagttttcgaataaattcacaacagaatgtcttcatttaaaaa tggaaacactcgatttcattcaaaagaaaaaggcattctttttttctttc agttttatgtaagtatttgtgttttgttgttgaacattatagtaaattat attcactttttttggaataaagtcacttttggtttttgttatgatccagc actcctaaatactcNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNGAACGAGAAAAgtgaggattttttttt tttacttctgaaGAAACTTTCCACATTCGAAAAGAATATAAGCTTAGTAT GAAAGGAGATCGAAGCCATTTCAAACAATGCATAAGAAAGATTgtaaaaa tttttgcaatttagatttagaacgccatgaatTTAACGTAACAACATAAC ATtacaattatatttttttaacaataatgacaaaaagaatagtCATAGAT TAACACCACTGATCTCTGCTGATgtcaacaaaaataacaaaaatacaaCA ATCGGAAGAGAGTGGGTCTGACAGAATCATATTGaatcaacaaaatgttt ttttataagctcGTGAAAAAAGAATCGCTtttattaaatgttttttttct tctatttttcgtAGGTTTGATAATATGGCAGAATTGTTTGCNaaatttga gtaattgaagccaaccatTAAGATTAAGTATTCAGCCCCCACGTTAAGTA ATAAGATTTCAGCTTCCCCCAAGTAAAGGAGACCTTTAATATTTGAACTT AATATAGAcccaaatatttgaaacatcttTAACCCCCAcccttttttggc tttttttgagggtgtaacccccccccccaactagCAGGGGGGCTGACGAT GACTTTTTCCCACCCAGGTTATTTGCTCAATTTTTCCTATAGATAAAATA ACtgcaatttttaaaagattcaaACTAGGCTCACATAATGAGGCCTTTGG AATACCTGTCAGATACAAGACATTATCTTGCGTGAATTGCTCCTTGtcaa atcataattttcaagctaaagcaaccctgaatCCTGATTGGACATTTTTT TGATCGATTGATAAAATTTCCTTTTCATAATCCTAAAGTAAAAAAGATTC AATTGCTGTTAAAcgctttcttctttttttcagctcAACAAATGCGTCCT GAACTTCTTCAGGTTAGTTTGGAATTCTATCTCATTTTGAGTTTATTGTT TTCAGTATATTTTAGGAGGCTAACAATTTGACTCAATGAAACATAAAATA ATCTTGATCAGCCTGGTCCTTGTCCTACACATAAGTCTAAGAAAACATAG TCAAAACATGCATTAGACAGTTCCTGGTCATTTGActtttataataaatt ttgcTTTGCAACAATAGAATCTAAGTATTAAAATTCTTTACtcagatttt acttttttattttaggaaGTCAAATTATATTCCAATGCAAGAGAACGAGA AAAgtgaggattttttttttttacttctgaaGAAACTTTCCACATTCGAA AAGAATATAAGCTTAGTATGAAAGGAGATCGAACCCATTTCAAACAATGC ATAAGAAAGATTgtaaaaatttttgcaatttagatttagaacgccatgaa tTTAGCGTAACAACATAACATtacaattatatttttttaacaataatgac aaaaagaatagtCATAGATTAACACCACTGATCTCTGCTGTACTGATatc aacaaaaataacaaaaatacaaCAATCGGAAGAGAGTGAGTCTGACAGAA TCAGATTGAATCAACAAAATGTATTTTTATAAGCTCGTGAAAAAAGAATC GCTtttattaaatgttttttttcttctatttttcgtAGGTTTGATAATAT GGCAGAATTGTTTGCTGTAATAAATACATTACAACATTTAGAAAAAGCAT ACATTAAAGATGCTATTCATCCCAAAGAGTAAGTTGACATACCATGGTGT ATTATATAACCACACACAAATTCCagtattttgtacttttttgggCTGGT GAGCTCAGTCAGTGGAGAGTTAGTGGAGGCTAGAGTATctgcctttgaaa aaaagggTTGTAGATTCGTCTCCACGACAAAGACACTTCCAGTTGAGATA ATTCATTGTTAAAATTCCTTCTCATATTGAAATCTTAAGCAAGTatgttt tataaaaatatatttgtctTTGGTGATATTATTACCAGGATTACCGAAAT CAATAATTTgcaatttgttttaaattttacttGGTAAATTTTCGGTCAGA CCAAGGCCAGCTGTCCCCATTCGCTGTCGTAGTCCTTGGGCATTTTGAct tatttatgttttttcttcATGTAGGTACACAGCAGCTTGTAGCAAACTTC TTGTGCAGTACAAGGTAATTTGACTTATTTTAAATACAGTCATGGGATTG TGTTGTGCCAACTTCAACCAATGTcaacttcaaaattaaaatttgtaaTG AGCAGTTGACTCCTTGAATTTTTCTGTCTGTTGACAGAAAACCGTCCTGG TATATACCGGGTGGGTACAACATTGGAGTccaaaaattgacgtttaaccT TGAGACCGCAGAAAAAGATTTACACTGCTGTACCTTTTTGGTTATTATGT TTAGCTAAAAAAGGTATGAAAGTTTCAACATAATTTTGATATTCCTTTCA GATTCACCAAAGTCAGTGTAAACAATATTAATATTTAAGAGccacacccc ttctcacaacAGCCTAAAAGAATGTCGCTCAATTACGAATGAAATCAGCT TATTACATTGGAAAAACTAATAATGAATGATAATTTGTTTTGTTCTTCTA GGCTGCTTTCAAACAAGTACAAAGTGCAGACTTTCCTACTGtggaagcat ttacaaaaatttacagGGTACGActttttgataattattttcTCTAATTC TTTTTTTGGTAAGCAATTCCTTATCTCCACTCCGGTAGGAACCCTTTCCA TTGAAGAAAAATCTTATTACATGGATATTGATGGACATCTCATTAACACC AGATCCTATTGAAAGGGTAACACCACAGTTATCAGGTAGTCTCTCTCCAG TACTGagttagaaaataattttttttcaatattgttTGTAAAGCTTGACT GTCCAGCAGCATTGGAGAGGATACGAGAAGATCGACCAATCACTATCAAA GATGATGCCGGAAATACAAGCAAATCTATCGCTAACATTGTTGAGGTATG TGTGCTAACGATATTTCCTTTTTATATCAACCCTTAGTGGCGCGGTCAGC TTTTGAAGAGACTGGTTGAATGTACAAAGTGAAAATCGTAAGATACTCTT GCATTGAAGTGATAGAGCAtggcgtcctccagctttttggtcccccctaa taagagctaaaatcccccatctggcctcccccccacctgtctttaaaatt cgtgCTCCCCCCANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCCc ccccccccatcttcctggggggatgatcccatgtAGAGTAAAGTCAATTT AGTAGAACTATTCGAATGCTACAAATAGTTTGCACTCCACTTCAGAGACT TTAGGAAAATGTCTGTCATATGGCATGGAGTTTTAGCGGGAATTTACTCG GTTTGTCTATAAATGCCGTGCGCGTAGAAAGAGTTTTCCTTATAAATTCA CTACCAGTCGCCTCAAACGCTGACCGCGCTTTTACGGTTCGATAGGTGTA TACTCAGAGTCAATTCAGATGCGAGGGCTATTAAGGTTGTCGAATAGTAC GGTTACGTTTCTGTCTCAGACTTTTATCATTTCGGACAAGTTCCAAAAAT TgcatgattgattgattgactgaTTGATTTTTGGTGATATTGACCCTTTC AGTAAGTAATCTAAATCACAATGTTACAAGTGTGCAATAATTAACTAATA GTATATATCTGTTCCTTTTTGTTCTTGCCAGAGATTCATCACGATCATGG ATAGATTACGACTTCAGATACGAGCAAAAGATGAAATCCATCCTGATTTA GAAGATTTGAAATTGACAATGGATCGTTTAAGTATGTTATCTGATGACTT TGAAGGAAAAGTTGCTGTACAAAAATGGTAAGTTACTCTCTTAATGTTTG CTTCATTATTATACTTTTCAGAAATTGTTGTTTAAGAGGAGGAGATGAGT AAGTTTTAAAGGACGTCTACACCATTAAGTTTAAAGTCCGAAgcgctaga gtagaatctctaacctttccctggcaagaaaagtgaagccatatatttcc catccagaacgcgccgcaatcatgcAGCAGAAGAAAGGAGAATGTTTCTG AAAAGAttattcaattttgattttagcatttgaaagagcATGCAAAACTG ATCAAAGAAAGTATGCAAATTGAAAGATTTCACTGTGACTACGATTTAaa gttttttcgtttttcttgtAAATACTCGAGTAAATCACTATCACGTTGTA AAAGCTGAAATTCattgcaaaaatttgcaaacatAATAAGCATTAGAAAA CTTGCTCTAAATAAAATAGCTCGGTATTTATCGTCGCTTggtgttaaaac tctactcaCAAAATTGGATAATCTAAAATATATCCAATTTTCAGTCTCCA TTTTCTGAAGGTCCCGCTGCCTGTGGGATGCTATAATATAACTGTTGTCG CCAATTACTCAAAGAATTAAAACAGATAATTCAAATCTTATTAGAGACGT CTTACAAAGTGGGTAATCATCTCGTTAGTCTTAATTCTTGTTAATCCTAA AGTCAACTTAAGGATTTTCGAACTTGCTTGGGTTAGTTTTTAGATCATTA GTAAAGACATCAAGCATTAAAAGTATTAAACATATTTAGATAAGCTTTAA GTTTGTGAACTTCGACTTTTGATGAGCAGATTTGGAAGTCCACGAGCGTA ATACTCTTTAAAACTTTGTTGATCCAATTTAGAGGttaaatgatttcaaa attcatactTGACCTGAAAAGGGTATGAAAATCAGCTAAATTATGCTAGC TCACCTGGTTTTAATTAGAGAGATGTTATAGTCATAACTCTCTGTTCCAA TAAATTGAGATTTAGTATAAGACCCGATAACCCAAACACCCCGCACTATG CTGATTCCCGCCTGATTaaatcaataatattttttttgggATGTTTTGGT AATTATCTTAATAAAGGGGCGACTAAGTGATCCTTTAAAGCCCACCCAAT AGACTCTCAATATCTATCTCTATTATTCTAATTCACATTAACCTACGCTC TACGCTAACTTCTTCGTATCCTACTTCTGCACCATGCCGTATTAAGCACT CATAGACTGAAAACCTGATCCTTTTTCTTCTCTTAGGTTGGATACATTAA GTGAAATGAGAGCTCACGATGAGCTAGACGAGGAACAAGTCAGACAAATG ATTTTTGACATCGAACAATCATATTACGCTTTTAACAGGTTGTTACAGCA CACTTAGAAAAAGTGAAAGAATTTATGAAAATTGTAAATTCTGCTACCGT GCCCAGTCAACTACTATTTAAAAATAGCAAATTTCTATTAAGAACAATGG AACACTTTAAGAATAGTGGAGGTGGTGAGAATATTGATGCCAAAGAAGAT CGATAATATCCCTTCAACATTTCATCGATGTCAGAAATGTATTTGAGGTT TTTAGTATCATTTAAGTATTCAAATATTATTAATTGGAATTACTTGACAA AGTTGGGATGATATCTTGATGGAGTAAGGTTCAAAATTAACTAAACTGAA CCTTTATTCACAATTATATGACCCGGCCTTTAGGGAATGTTTTTCTGGTA TTCCTGGTTGATGTAATGGAAATAATTTCACCGTACAAAGAATATGATTT CAAACGTTGActagatagaccttttcataaatcacgtcacgaacatcact tgcctcgtattcaaacgattaccatggtgattatgtctcttgagacatta aatgacttttttatgaataggaaatAGTTATAATAATATCCGCCGGGAGT TAATCactatggcaataatttcaaaacgaggcaagtgatgttcgtaacgt aattttatgaaaaggtctatagagAGAGAGGAAATCCGTCTTTCCTTAGT TTTTGTAGAATTGTATTTATGCATTaattttatgttgattttttaGTTAA TTTGTATTTCAAACAACCAAATCTTACTACTCTGAACCTTCGAAAGGAAT CGGAATTGATTATTTTGTTACAGATAACCTTTGGTATTCAATTGAAGGTC TGAATGGTGCgactttgcttgcttgttttcaATTTCTATTATTTAAAGAT TACGTAATGTAATGACCGACCCTCTTTAATGTAGCCAATTTTTGACGAGG CAAACCAAGAAAAGCAGTCAGGACAAAACTCAGTTGTTATGCCCACTCCA TGTTGACTCGAAGTTTCTTATTTTACGAAAGTATTTACATCAAACTTAAC AAAAAAGTGAATCTTTACTTTTTCAGTACCTCCTATGGGATGTAACCTTT TGTTTAAAACGGCTCATCGTTTATACCGTTACCAATAGTAACTAGCCGTT GGATTAAGTGCCGTTTATTCATTATTGCGAGcacggattttagattttta aaatttagttgTGATGCttaaataaaattattctttagcataaacttttt aaacttttattagTTTGATTATGATTTTCTTAGATATGCCTTAGCTTTCT GTACTCGGAGGAAAATGCTTGGTCNcaataatttcaaaacgaggcaagtg atgttcgtaacgtaattttatgaaaaggtctatagagAGAGAGGAAATCC GTCTTTCCTTAGTTTTTGTAGAATTGTATTTATGCATTaattttatgttg attttttaGTTAATTTGTATTTCAAACAACCAAATCTTACTACTCTGAAC CTTCGAAAGGAATCGGAATTGATTATTTTGTTACAGATAACCTTTGGTAT TCAATTGAAGGTCTGAATGGTGCgactttgcttgcttgttttcaATTTCT ATTATTTAAAGATTACGTAATGTAATGACCGACCCTCTTTAATGTAGCCA ATTTTTGACGAGGCAAACCAAGAAAAGCAGTCAGGACAAAACTCAGTTGT TATGCCCACTCCATGTTGACTCGAAGTTTCTTATTTTACGAAAGTATTTA CATCAAACTTAACAAAAAAGTGAATCTTTACTTTTTCAGTACCTCCTATG GGATGTAACCTTTTGTTTAAAACGGCTCATCGTTTATACCGTTACCAATA GTAACTAGCCGTTGGATTAAGTGCCGTTTATTCATTATTGCGAGcacgga ttttagatttttaaaatttagttgTGATGCttaaataaaattattcttta gcataaactttttaaacttttattagTTTGATTATGATTTTCTTAGATAT GCCTTAGCTTTCTGTACTCGGAGGAAAATGCTTGGTCATCGTTTTTAATC TCGGAAGTGAAGCTCATGGtagactttcaaaacttttttatggaaacTAG CGGATTAACGAAAATAAATTTCTCGTGTTGAATAAGCACTATAC

Coding sequence (CDS) from alignment at sc0000012:986574..1002167+

>TCONS_00001852 ID=TCONS_00001852|Name=TCONS_00001852|organism=Clytia hemisphaerica|type=CDS|length=5940bp|location=Sequence derived from alignment at sc0000012:986574..1002167+ (Clytia hemisphaerica)
ATGTATGGACACTTCCAACAGCAACCAGctcAACAAATGCGTCCTGAACT
TCTTCAGgaaGTCAAATTATATTCCAATGCAAGAGAACGAGAAAAGTTTG
ATAATATGGCAGAATTGTTTGCTGTAATAAATACATTACAACATTTAGAA
AAAGCATACATTAAAGATGCTATTCATCCCAAAGAGTACACAGCAGCTTG
TAGCAAACTTCTTGTGCAGTACAAGGCTGCTTTCAAACAAGTACAAAGTG
CAGACTTTCCTACTGtggaagcatttacaaaaatttacagGCTTGACTGT
CCAGCAGCATTGGAGAGGATACGAGAAGATCGACCAATCACTATCAAAGA
TGATGCCGGAAATACAAGCAAATCTATCGCTAACATTGTTGAGAGATTCA
TCACGATCATGGATAGATTACGACTTCAGATACGAGCAAAAGATGAAATC
CATCCTGATTTAGAAGATTTGAAATTGACAATGGATCGTTTAAGTATGTT
ATCTGATGACTTTGAAGGAAAAGTTGCTGTACAAAAATGGTTGGATACAT
TAAGTGAAATGAGAGCTCACGATGAGCTAGACGAGGAACAAGTCAGACAA
ATGATTTTTGACATCGAACAATCATATTACGCTTTTAACAGGTTGTTACA
GCACACTTAGATGTATGGACACTTCCAACAGCAACCAGctcAACAAATGC
GTCCTGAACTTCTTCAGgaaGTCAAATTATATTCCAATGCAAGAGAACGA
GAAAAGTTTGATAATATGGCAGAATTGTTTGCTGTAATAAATACATTACA
ACATTTAGAAAAAGCATACATTAAAGATGCTATTCATCCCAAAGAGTACA
CAGCAGCTTGTAGCAAACTTCTTGTGCAGTACAAGGCTGCTTTCAAACAA
GTACAAAGTGCAGACTTTCCTACTGtggaagcatttacaaaaatttacag
GCTTGACTGTCCAGCAGCATTGGAGAGGATACGAGAAGATCGACCAATCA
CTATCAAAGATGATGCCGGAAATACAAGCAAATCTATCGCTAACATTGTT
GAGAGATTCATCACGATCATGGATAGATTACGACTTCAGATACGAGCAAA
AGATGAAATCCATCCTGATTTAGAAGATTTGAAATTGACAATGGATCGTT
TAAGTATGTTATCTGATGACTTTGAAGGAAAAGTTGCTGTACAAAAATGG
TTGGATACATTAAGTGAAATGAGAGCTCACGATGAGCTAGACGAGGAACA
AGTCAGACAAATGATTTTTGACATCGAACAATCATATTACGCTTTTAACA
GGTTGTTACAGCACACTTAGATGTATGGACACTTCCAACAGCAACCAGct
cAACAAATGCGTCCTGAACTTCTTCAGgaaGTCAAATTATATTCCAATGC
AAGAGAACGAGAAAAGTTTGATAATATGGCAGAATTGTTTGCTGTAATAA
ATACATTACAACATTTAGAAAAAGCATACATTAAAGATGCTATTCATCCC
AAAGAGTACACAGCAGCTTGTAGCAAACTTCTTGTGCAGTACAAGGCTGC
TTTCAAACAAGTACAAAGTGCAGACTTTCCTACTGtggaagcatttacaa
aaatttacagGCTTGACTGTCCAGCAGCATTGGAGAGGATACGAGAAGAT
CGACCAATCACTATCAAAGATGATGCCGGAAATACAAGCAAATCTATCGC
TAACATTGTTGAGAGATTCATCACGATCATGGATAGATTACGACTTCAGA
TACGAGCAAAAGATGAAATCCATCCTGATTTAGAAGATTTGAAATTGACA
ATGGATCGTTTAAGTATGTTATCTGATGACTTTGAAGGAAAAGTTGCTGT
ACAAAAATGGTTGGATACATTAAGTGAAATGAGAGCTCACGATGAGCTAG
ACGAGGAACAAGTCAGACAAATGATTTTTGACATCGAACAATCATATTAC
GCTTTTAACAGGTTGTTACAGCACACTTAGATGTATGGACACTTCCAACA
GCAACCAGctcAACAAATGCGTCCTGAACTTCTTCAGgaaGTCAAATTAT
ATTCCAATGCAAGAGAACGAGAAAAGTTTGATAATATGGCAGAATTGTTT
GCTGTAATAAATACATTACAACATTTAGAAAAAGCATACATTAAAGATGC
TATTCATCCCAAAGAGTACACAGCAGCTTGTAGCAAACTTCTTGTGCAGT
ACAAGGCTGCTTTCAAACAAGTACAAAGTGCAGACTTTCCTACTGtggaa
gcatttacaaaaatttacagGCTTGACTGTCCAGCAGCATTGGAGAGGAT
ACGAGAAGATCGACCAATCACTATCAAAGATGATGCCGGAAATACAAGCA
AATCTATCGCTAACATTGTTGAGAGATTCATCACGATCATGGATAGATTA
CGACTTCAGATACGAGCAAAAGATGAAATCCATCCTGATTTAGAAGATTT
GAAATTGACAATGGATCGTTTAAGTATGTTATCTGATGACTTTGAAGGAA
AAGTTGCTGTACAAAAATGGTTGGATACATTAAGTGAAATGAGAGCTCAC
GATGAGCTAGACGAGGAACAAGTCAGACAAATGATTTTTGACATCGAACA
ATCATATTACGCTTTTAACAGGTTGTTACAGCACACTTAGATGTATGGAC
ACTTCCAACAGCAACCAGctcAACAAATGCGTCCTGAACTTCTTCAGgaa
GTCAAATTATATTCCAATGCAAGAGAACGAGAAAAGTTTGATAATATGGC
AGAATTGTTTGCTGTAATAAATACATTACAACATTTAGAAAAAGCATACA
TTAAAGATGCTATTCATCCCAAAGAGTACACAGCAGCTTGTAGCAAACTT
CTTGTGCAGTACAAGGCTGCTTTCAAACAAGTACAAAGTGCAGACTTTCC
TACTGtggaagcatttacaaaaatttacagGCTTGACTGTCCAGCAGCAT
TGGAGAGGATACGAGAAGATCGACCAATCACTATCAAAGATGATGCCGGA
AATACAAGCAAATCTATCGCTAACATTGTTGAGAGATTCATCACGATCAT
GGATAGATTACGACTTCAGATACGAGCAAAAGATGAAATCCATCCTGATT
TAGAAGATTTGAAATTGACAATGGATCGTTTAAGTATGTTATCTGATGAC
TTTGAAGGAAAAGTTGCTGTACAAAAATGGTTGGATACATTAAGTGAAAT
GAGAGCTCACGATGAGCTAGACGAGGAACAAGTCAGACAAATGATTTTTG
ACATCGAACAATCATATTACGCTTTTAACAGGTTGTTACAGCACACTTAG
ATGTATGGACACTTCCAACAGCAACCAGctcAACAAATGCGTCCTGAACT
TCTTCAGgaaGTCAAATTATATTCCAATGCAAGAGAACGAGAAAAGTTTG
ATAATATGGCAGAATTGTTTGCTGTAATAAATACATTACAACATTTAGAA
AAAGCATACATTAAAGATGCTATTCATCCCAAAGAGTACACAGCAGCTTG
TAGCAAACTTCTTGTGCAGTACAAGGCTGCTTTCAAACAAGTACAAAGTG
CAGACTTTCCTACTGtggaagcatttacaaaaatttacagGCTTGACTGT
CCAGCAGCATTGGAGAGGATACGAGAAGATCGACCAATCACTATCAAAGA
TGATGCCGGAAATACAAGCAAATCTATCGCTAACATTGTTGAGAGATTCA
TCACGATCATGGATAGATTACGACTTCAGATACGAGCAAAAGATGAAATC
CATCCTGATTTAGAAGATTTGAAATTGACAATGGATCGTTTAAGTATGTT
ATCTGATGACTTTGAAGGAAAAGTTGCTGTACAAAAATGGTTGGATACAT
TAAGTGAAATGAGAGCTCACGATGAGCTAGACGAGGAACAAGTCAGACAA
ATGATTTTTGACATCGAACAATCATATTACGCTTTTAACAGGTTGTTACA
GCACACTTAGATGTATGGACACTTCCAACAGCAACCAGctcAACAAATGC
GTCCTGAACTTCTTCAGgaaGTCAAATTATATTCCAATGCAAGAGAACGA
GAAAAGTTTGATAATATGGCAGAATTGTTTGCTGTAATAAATACATTACA
ACATTTAGAAAAAGCATACATTAAAGATGCTATTCATCCCAAAGAGTACA
CAGCAGCTTGTAGCAAACTTCTTGTGCAGTACAAGGCTGCTTTCAAACAA
GTACAAAGTGCAGACTTTCCTACTGtggaagcatttacaaaaatttacag
GCTTGACTGTCCAGCAGCATTGGAGAGGATACGAGAAGATCGACCAATCA
CTATCAAAGATGATGCCGGAAATACAAGCAAATCTATCGCTAACATTGTT
GAGAGATTCATCACGATCATGGATAGATTACGACTTCAGATACGAGCAAA
AGATGAAATCCATCCTGATTTAGAAGATTTGAAATTGACAATGGATCGTT
TAAGTATGTTATCTGATGACTTTGAAGGAAAAGTTGCTGTACAAAAATGG
TTGGATACATTAAGTGAAATGAGAGCTCACGATGAGCTAGACGAGGAACA
AGTCAGACAAATGATTTTTGACATCGAACAATCATATTACGCTTTTAACA
GGTTGTTACAGCACACTTAGATGTATGGACACTTCCAACAGCAACCAGct
cAACAAATGCGTCCTGAACTTCTTCAGgaaGTCAAATTATATTCCAATGC
AAGAGAACGAGAAAAGTTTGATAATATGGCAGAATTGTTTGCTGTAATAA
ATACATTACAACATTTAGAAAAAGCATACATTAAAGATGCTATTCATCCC
AAAGAGTACACAGCAGCTTGTAGCAAACTTCTTGTGCAGTACAAGGCTGC
TTTCAAACAAGTACAAAGTGCAGACTTTCCTACTGtggaagcatttacaa
aaatttacagGCTTGACTGTCCAGCAGCATTGGAGAGGATACGAGAAGAT
CGACCAATCACTATCAAAGATGATGCCGGAAATACAAGCAAATCTATCGC
TAACATTGTTGAGAGATTCATCACGATCATGGATAGATTACGACTTCAGA
TACGAGCAAAAGATGAAATCCATCCTGATTTAGAAGATTTGAAATTGACA
ATGGATCGTTTAAGTATGTTATCTGATGACTTTGAAGGAAAAGTTGCTGT
ACAAAAATGGTTGGATACATTAAGTGAAATGAGAGCTCACGATGAGCTAG
ACGAGGAACAAGTCAGACAAATGATTTTTGACATCGAACAATCATATTAC
GCTTTTAACAGGTTGTTACAGCACACTTAGATGTATGGACACTTCCAACA
GCAACCAGctcAACAAATGCGTCCTGAACTTCTTCAGgaaGTCAAATTAT
ATTCCAATGCAAGAGAACGAGAAAAGTTTGATAATATGGCAGAATTGTTT
GCTGTAATAAATACATTACAACATTTAGAAAAAGCATACATTAAAGATGC
TATTCATCCCAAAGAGTACACAGCAGCTTGTAGCAAACTTCTTGTGCAGT
ACAAGGCTGCTTTCAAACAAGTACAAAGTGCAGACTTTCCTACTGtggaa
gcatttacaaaaatttacagGCTTGACTGTCCAGCAGCATTGGAGAGGAT
ACGAGAAGATCGACCAATCACTATCAAAGATGATGCCGGAAATACAAGCA
AATCTATCGCTAACATTGTTGAGAGATTCATCACGATCATGGATAGATTA
CGACTTCAGATACGAGCAAAAGATGAAATCCATCCTGATTTAGAAGATTT
GAAATTGACAATGGATCGTTTAAGTATGTTATCTGATGACTTTGAAGGAA
AAGTTGCTGTACAAAAATGGTTGGATACATTAAGTGAAATGAGAGCTCAC
GATGAGCTAGACGAGGAACAAGTCAGACAAATGATTTTTGACATCGAACA
ATCATATTACGCTTTTAACAGGTTGTTACAGCACACTTAG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000979XLOC_000979Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001852-exon-sc0000012-1491911889:986574..987647TCONS_00001852-exon-sc0000012-1491911889:986574..987647Clytia hemisphaericaexon
TCONS_00001852-exon-sc0000012-1510915933:986574..987647TCONS_00001852-exon-sc0000012-1510915933:986574..987647Clytia hemisphaericaexon
TCONS_00001852-exon-sc0000012-1575043694:986574..987647TCONS_00001852-exon-sc0000012-1575043694:986574..987647Clytia hemisphaericaexon
TCONS_00001852-exon-sc0000012-1491911889:995107..995135TCONS_00001852-exon-sc0000012-1491911889:995107..995135Clytia hemisphaericaexon
TCONS_00001852-exon-sc0000012-1510915933:995107..995135TCONS_00001852-exon-sc0000012-1510915933:995107..995135Clytia hemisphaericaexon
TCONS_00001852-exon-sc0000012-1575043694:995107..995135TCONS_00001852-exon-sc0000012-1575043694:995107..995135Clytia hemisphaericaexon
TCONS_00001852-exon-sc0000012-1491911889:995389..995426TCONS_00001852-exon-sc0000012-1491911889:995389..995426Clytia hemisphaericaexon
TCONS_00001852-exon-sc0000012-1510915933:995389..995426TCONS_00001852-exon-sc0000012-1510915933:995389..995426Clytia hemisphaericaexon
TCONS_00001852-exon-sc0000012-1575043694:995389..995426TCONS_00001852-exon-sc0000012-1575043694:995389..995426Clytia hemisphaericaexon
TCONS_00001852-exon-sc0000012-1491911889:995812..995901TCONS_00001852-exon-sc0000012-1491911889:995812..995901Clytia hemisphaericaexon
TCONS_00001852-exon-sc0000012-1510915933:995812..995901TCONS_00001852-exon-sc0000012-1510915933:995812..995901Clytia hemisphaericaexon
TCONS_00001852-exon-sc0000012-1575043694:995812..995901TCONS_00001852-exon-sc0000012-1575043694:995812..995901Clytia hemisphaericaexon
TCONS_00001852-exon-sc0000012-1491911889:996298..996337TCONS_00001852-exon-sc0000012-1491911889:996298..996337Clytia hemisphaericaexon
TCONS_00001852-exon-sc0000012-1510915933:996298..996337TCONS_00001852-exon-sc0000012-1510915933:996298..996337Clytia hemisphaericaexon
TCONS_00001852-exon-sc0000012-1575043694:996298..996337TCONS_00001852-exon-sc0000012-1575043694:996298..996337Clytia hemisphaericaexon
TCONS_00001852-exon-sc0000012-1491911889:996775..996840TCONS_00001852-exon-sc0000012-1491911889:996775..996840Clytia hemisphaericaexon
TCONS_00001852-exon-sc0000012-1510915933:996775..996840TCONS_00001852-exon-sc0000012-1510915933:996775..996840Clytia hemisphaericaexon
TCONS_00001852-exon-sc0000012-1575043694:996775..996840TCONS_00001852-exon-sc0000012-1575043694:996775..996840Clytia hemisphaericaexon
TCONS_00001852-exon-sc0000012-1491911889:997067..997168TCONS_00001852-exon-sc0000012-1491911889:997067..997168Clytia hemisphaericaexon
TCONS_00001852-exon-sc0000012-1510915933:997067..997168TCONS_00001852-exon-sc0000012-1510915933:997067..997168Clytia hemisphaericaexon
TCONS_00001852-exon-sc0000012-1575043694:997067..997168TCONS_00001852-exon-sc0000012-1575043694:997067..997168Clytia hemisphaericaexon
TCONS_00001852-exon-sc0000012-1491911889:998555..998700TCONS_00001852-exon-sc0000012-1491911889:998555..998700Clytia hemisphaericaexon
TCONS_00001852-exon-sc0000012-1510915933:998555..998700TCONS_00001852-exon-sc0000012-1510915933:998555..998700Clytia hemisphaericaexon
TCONS_00001852-exon-sc0000012-1575043694:998555..998700TCONS_00001852-exon-sc0000012-1575043694:998555..998700Clytia hemisphaericaexon
TCONS_00001852-exon-sc0000012-1491911889:999960..1002167TCONS_00001852-exon-sc0000012-1491911889:999960..1002167Clytia hemisphaericaexon
TCONS_00001852-exon-sc0000012-1510915933:999960..1002167TCONS_00001852-exon-sc0000012-1510915933:999960..1002167Clytia hemisphaericaexon
TCONS_00001852-exon-sc0000012-1575043694:999960..1002167TCONS_00001852-exon-sc0000012-1575043694:999960..1002167Clytia hemisphaericaexon
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001852-proteinTCONS_00001852-proteinClytia hemisphaericapolypeptide
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000012supercontigsc0000012:986574..1002167 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
24.9764 27.3217 26.4526 27.1103 14.3698 10.2878 16.315 16.1258 14.3931 12.8272 15.6877 10.9253 13.4301 11.4005 11.5345 12.614 15.6081 15.3154 13.4613 17.3758 20.0359 20.4841 19.6809 20.9362 10.3521 14.9576 25.0692 20.3581 19.5827 17.6186
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR007143VPS28
IPR017899VPS28_C
IPR017898VPS28_N
Blast
BLAST of TCONS_00001852 vs. Swiss-Prot (Human)
Match: VPS28 (Vacuolar protein sorting-associated protein 28 homolog OS=Homo sapiens GN=VPS28 PE=1 SV=1)

HSP 1 Score: 285.034 bits (728), Expect = 1.299e-87
Identity = 133/208 (63.94%), Postives = 165/208 (79.33%), Query Frame = 3
Query: 1074 AQQMRPELLQEVKLYSNAREREKFDNMAELFAVINTLQHLEKAYIKDAIHPKEYTAACSKLLVQYKAAFKQVQSADFPTVEAFTKIYRLDCPAALERIREDRPITIKDDAGNTSKSIANIVERFITIMDRLRLQIRAKDEIHPDLEDLKLTMDRLSMLSDDFEGKVAVQKWLDTLSEMRAHDELDEEQVRQMIFDIEQSYYAFNRLLQ 1697
            A   +PEL +EVKLY NAREREK+DNMAELFAV+ T+Q LEKAYIKD + P EYTAACS+LLVQYKAAF+QVQ ++  +++ F + +RLDCP A+ERI+EDRPITIKDD GN ++ IA++V  FIT+MD+LRL+IRA DEI PDL +L  TM R+S L  DFEG+  V +WL TLS M A DELD+ QVRQM+FD+E +Y AFNR L 
Sbjct:   13 APGNKPELYEEVKLYKNAREREKYDNMAELFAVVKTMQALEKAYIKDCVSPSEYTAACSRLLVQYKAAFRQVQGSEISSIDEFCRKFRLDCPLAMERIKEDRPITIKDDKGNLNRCIADVVSLFITVMDKLRLEIRAMDEIQPDLRELMETMHRMSHLPPDFEGRQTVSQWLQTLSGMSASDELDDSQVRQMLFDLESAYNAFNRFLH 220          
The following BLAST results are available for this feature:
BLAST of TCONS_00001852 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
VPS281.299e-8763.94Vacuolar protein sorting-associated protein 28 hom... [more]
back to top