Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00001851 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001851
Unique NameTCONS_00001851
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length2139

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001851 ID=TCONS_00001851|Name=TCONS_00001851|organism=Clytia hemisphaerica|type=transcript|length=2139bp
GATGGAGATAACAGTACGCAAACGAAAAGAGgatgagaagtaacaaagtc
aTGCCACAAAACGATATTATCACAGTAAAACACGGCCAAGCTAACGACCT
CAACAGTGACATAAGTTTCAAGCCGTCTTTCTTCCAGCAACCAGCGGCAT
ACCAGAAAAACACACTTCCCAAGCATAACGATGACAATGAGAAAAATGTA
GATGAAAAAAAGGACAAAAGCATCAAAGAGCTACTGATAGAGTTTGCAGA
GAGTACATCAGCACATGGATATTCACCTCTGGCCTCGACAAAGACAATAT
TAGGAAGTGTAGTATGGATTATATCAATGCTGGCAGCTTACATTGTTCTC
ATTTTGGTGATACAACCTTTAATCACCAAGTATCTGGATCGCCCATTgct
caataaacagactgtggTTTATGAGCATCGTCCGAAATTCCCAGTGGTTG
TCTTTTGCAACGAAAACCCAGTGGTCAGAGAGAAGTATGTTGAGTTGTTG
ACTCAACTAAACGAAACATTCGAATCTATCGACCCAGATAAAGCGATGAG
TCATGTAGCAGACCCTTCAATATACGGCCACAGAATCAACGACTCCATTT
TAAGGTGTGATTTTCGACATGTTAAGGGAAGTTGCACACCGACCTCTGAC
AATGATGCGAATACAAATCTTGGTTGGGGAGAATATTGGCAAGGAAGGTA
CGGTAAATGCTGGTTCTTCAATGCAGACGTTGAGAATCCGAGACGAGTCA
CCAGAGCTGGTCATAGAGGTGGATTGCATCTCCATTTTAATATTGAGCAA
GAAAAGTACATTGACAATACTTATAGTGCAGGACTAAGAATGTTTGTTGG
ACTACAAGGTGAAAAATTCGATGTTGAAGAAAAAGCAATACCAATTGCCC
CAGGCAAAAAATACGACATCGCATTAACGAAAAAATACATCTATCGAGCT
GATCCATTCAATAATGGGTCTTGTATGAGAAACCAAGACAAGCATATGGT
GGAACCTGACAGAAAAAGTGATTTTCACATCGACCGAATGACCCATGGAT
TCTGCTCTAAATTGTGTGCCAATGCAGCTATCAGGGATGAATGCTCATGT
GTGGCTCCCAGCCTACCCTTGGAGTATAGGTTTAAAGATGTCCCTTTTTG
CCCACAAGGTGATCAGTGCTTGGACGAATTGCTTGAAAAATGGTTTGACG
GAAATATGAAATGCGACTGTAACCCACCGTGCGAAGAAACCTTATTTTCA
ACATCTGTTTATTCGCAAAACTATCCACAGGATATCAGAAGACAACGAGA
AATTGCTGAAGGAAAGCCAGATccttcaaaaaaccttttaactgtttcaa
tattttatgaAGACAAGTCGTTCATTAAAATGGaagaagaacaattttat
accATTGTGAATTTAATTGCTGATATGGGTGGACAGTTGGGATTGTTTGG
TGGTTTTTCTTTCTTGACGGTAGTTGAGTTCACCATCTTGCTTGTAATGA
TCGTCATTCATCTGGTGATGGTCATCTGTAAAGGGAAACCTAAAGAATAA
CAAAAAACCACAGTTTAGATCAAATTTGAGATTGGGAAAAGTTTTCTGCG
CAAAATATTTCGGAGAGATCGATTCTCGAATGTTTCTTTTTGCGAAATCT
TCATCCCCTGAAGTAATGCAATAGAAGAATTACTATCGATTATTTGTAAT
TTATTTTAATGTACATAATCATGATAAGACTATTAACTTTAACAAATAAC
CTACTTATTATAACTTTTTAATCTTATACAACTGTAAATATGTGGATTTT
TTAACTGATAATTGTCGTCTATACGGGCTCGGaatgaaacttaaagttct
aaataataaatcaaagtcTCTATTCTTTTAATTggaataaaccagccgag
gctggaaggtcagccaatagagcttagctagatagctttaataagtgggt
taacagatgtaagagatgcactgaaacagagtagactaaatatgttgaat
aatgactttgtttaaacaatagatgtacgcttttgctaaaccccctctcc
ccccttcactgtgtacgtactatatggatggcccctccagtctgggtaaa
taaattttgtagtttagtaccgtcaagttacacaacatg
Run BLAST on NCBI

protein sequence of TCONS_00001851-protein

>TCONS_00001851-protein ID=TCONS_00001851-protein|Name=TCONS_00001851-protein|organism=Clytia hemisphaerica|type=polypeptide|length=505bp
MRSNKVMPQNDIITVKHGQANDLNSDISFKPSFFQQPAAYQKNTLPKHND
DNEKNVDEKKDKSIKELLIEFAESTSAHGYSPLASTKTILGSVVWIISML
AAYIVLILVIQPLITKYLDRPLLNKQTVVYEHRPKFPVVVFCNENPVVRE
KYVELLTQLNETFESIDPDKAMSHVADPSIYGHRINDSILRCDFRHVKGS
CTPTSDNDANTNLGWGEYWQGRYGKCWFFNADVENPRRVTRAGHRGGLHL
HFNIEQEKYIDNTYSAGLRMFVGLQGEKFDVEEKAIPIAPGKKYDIALTK
KYIYRADPFNNGSCMRNQDKHMVEPDRKSDFHIDRMTHGFCSKLCANAAI
RDECSCVAPSLPLEYRFKDVPFCPQGDQCLDELLEKWFDGNMKCDCNPPC
EETLFSTSVYSQNYPQDIRRQREIAEGKPDPSKNLLTVSIFYEDKSFIKM
EEEQFYTIVNLIADMGGQLGLFGGFSFLTVVEFTILLVMIVIHLVMVICK
GKPKE
Run BLAST on NCBI

transcript from alignment at sc0000012:949702..952952+

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001851 ID=TCONS_00001851|Name=TCONS_00001851|organism=Clytia hemisphaerica|type=transcript|length=3251bp|location=Sequence derived from alignment at sc0000012:949702..952952+ (Clytia hemisphaerica)
GATGGAGATAACAGTACGCAAACGAAAAGGTGAgagaatatatatttttc atggCACATCAGACATATAATATATTGAGAAGATAAACATTAGAAGTTGA GTACACCGCTGATGAAATTCtgtgcatttttttataaaaatgtggGGCAG GGGGTTAATAATAAGGCTTTTTTTTGATACGCCTGGaacaaaaatagaag aaaaccTTTGTGAACCAAGATTTCGTGAACTAAATCTATTTATGTCACTT TTTGACACATCTTCAGTCAACTtcacaaaatttgaagaatataatcttga aaattcaacataaatatTGATGATGTATTATTTCATAACTTCTTCGCTTG TAGTAGAATTCAGGATAACCTCGAGTCTCAGTTTCAAATCTCACAAGTAG AATCATAGGGCGGACTATTCCATCAACGACGTATCCTTAGCAGATATGCC CTTCTACAGAAAAACATTAACCAAAATATGTCTAGACTTTCTCAAATGTT ACCCATCTTGTGGGCTACCTCTTGAACGatataacttttgaaagaacGTG TGGCAGAGTCATGAAATTACATCTTTTGGCAAAGATAGGACCCCCAATTG GACCCTCTCTTACCATTTAGGtcttaatttttgtaaaataccAATCAGAA AAGGGGAGGGTGCACATTTGCAGACTGGTCATTAAATTACTCCAAAGAAA ATCTGTTCGtggagggtggaggatatattattatTTCAATGATCTATCCC TGGATATCTGAATACGAGTTTTACCCCGGAGACAAGCATCAAATTGACCG CTTGGACACTAAATACTACCGCTGGACATGACTATGTTTCACAATTTATC ATAACCTAGACAATATATCTcgcattttgacatttttgtccaTATACGAA AAAAACAGGTGACCGacaaaaaattttgtgaatccTCTTCATTTGGCATT ATATATTCAGACTAGAGGGAAGGGGGTTGCCTTTTCAGCATAATCGAGAT GTACTGGTCATATAGAAATTGGAAGAAAAAGGTCTGATGGACATATCTCA AagttataaaataaaaagtcacgGCACATAGGCTAGCAgacttctaaaaa aaaaaattcaagaatcatttttcttacttttttattaACAGAGgatgaga agtaacaaagtcaTGCCACAAAACGATATTATCACAGTAAAACACGGCCA AGCTAACGACCTCAACAGTGACATAAGTTTCAAGCCGTCTTTCTTCCAGC AACCAGCGGCATACCAGAAAAACACACTTCCCAAGCATAACGATGACAAT GAGAAAAATGTAGATGAAAAAAAGGACAAAAGCATCAAAGAGCTACTGAT AGAGTTTGCAGAGAGTACATCAGCACATGGATATTCACCTCTGGCCTCGA CAAAGACAATATTAGGAAGTGTAGTATGGATTATATCAATGCTGGCAGCT TACATTGTTCTCATTTTGGTGATACAACCTTTAATCACCAAGTATCTGGA TCGCCCATTgctcaataaacagactgtggTTTATGAGCATCGTCCGAAAT TCCCAGTGGTTGTCTTTTGCAACGAAAACCCAGTGGTCAGAGAGAAGTAT GTTGAGTTGTTGACTCAACTAAACGAAACATTCGAATCTATCGACCCAGA TAAAGCGATGAGTCATGTAGCAGACCCTTCAATATACGGCCACAGAATCA ACGACTCCATTTTAAGGTGTGATTTTCGACATGTTAAGGGAAGTTGCACA CCGACCTCTGACAATGATGCGAATACAAATCTTGGTTGGGGAGAATATTG GCAAGGAAGGTACGGTAAATGCTGGTTCTTCAATGCAGACGTTGAGAATC CGAGACGAGTCACCAGAGCTGGTCATAGAGGTGGATTGCATCTCCATTTT AATATTGAGCAAGAAAAGTACATTGACAATACTTATAGTGCAGGACTAAG AATGTTTGTTGGACTACAAGGTGAAAAATTCGATGTTGAAGAAAAAGCAA TACCAATTGCCCCAGGCAAAAAATACGACATCGCATTAACGAAAAAATAC ATCTATCGAGCTGATCCATTCAATAATGGGTCTTGTATGAGAAACCAAGA CAAGCATATGGTGGAACCTGACAGAAAAAGTGATTTTCACATCGACCGAA TGACCCATGGATTCTGCTCTAAATTGTGTGCCAATGCAGCTATCAGGGAT GAATGCTCATGTGTGGCTCCCAGCCTACCCTTGGAGTATAGGTTTAAAGA TGTCCCTTTTTGCCCACAAGGTGATCAGTGCTTGGACGAATTGCTTGAAA AATGGTTTGACGGAAATATGAAATGCGACTGTAACCCACCGTGCGAAGAA ACCTTATTTTCAACATCTGTTTATTCGCAAAACTATCCACAGGATATCAG AAGACAACGAGAAATTGCTGAAGGAAAGCCAGATccttcaaaaaaccttt taactgtttcaatattttatgaAGACAAGTCGTTCATTAAAATGGaagaa gaacaattttataccATTGTGAATTTAATTGCTGATATGGGTGGACAGTT GGGATTGTTTGGTGGTTTTTCTTTCTTGACGGTAGTTGAGTTCACCATCT TGCTTGTAATGATCGTCATTCATCTGGTGATGGTCATCTGTAAAGGGAAA CCTAAAGAATAACAAAAAACCACAGTTTAGATCAAATTTGAGATTGGGAA AAGTTTTCTGCGCAAAATATTTCGGAGAGATCGATTCTCGAATGTTTCTT TTTGCGAAATCTTCATCCCCTGAAGTAATGCAATAGAAGAATTACTATCG ATTATTTGTAATTTATTTTAATGTACATAATCATGATAAGACTATTAACT TTAACAAATAACCTACTTATTATAACTTTTTAATCTTATACAACTGTAAA TATGTGGATTTTTTAACTGATAATTGTCGTCTATACGGGCTCGGaatgaa acttaaagttctaaataataaatcaaagtcTCTATTCTTTTAATTggaat aaaccagccgaggctggaaggtcagccaatagagcttagctagatagctt taataagtgggttaacagatgtaagagatgcactgaaacagagtagacta aatatgttgaataatgactttgtttaaacaatagatgtacgcttttgcta aaccccctctccccccttcactgtgtacgtactatatggatggcccctcc agtctgggtaaataaattttgtagtttagtaccgtcaagttacacaacat g

Coding sequence (CDS) from alignment at sc0000012:949702..952952+

>TCONS_00001851 ID=TCONS_00001851|Name=TCONS_00001851|organism=Clytia hemisphaerica|type=CDS|length=1518bp|location=Sequence derived from alignment at sc0000012:949702..952952+ (Clytia hemisphaerica)
atgagaagtaacaaagtcaTGCCACAAAACGATATTATCACAGTAAAACA
CGGCCAAGCTAACGACCTCAACAGTGACATAAGTTTCAAGCCGTCTTTCT
TCCAGCAACCAGCGGCATACCAGAAAAACACACTTCCCAAGCATAACGAT
GACAATGAGAAAAATGTAGATGAAAAAAAGGACAAAAGCATCAAAGAGCT
ACTGATAGAGTTTGCAGAGAGTACATCAGCACATGGATATTCACCTCTGG
CCTCGACAAAGACAATATTAGGAAGTGTAGTATGGATTATATCAATGCTG
GCAGCTTACATTGTTCTCATTTTGGTGATACAACCTTTAATCACCAAGTA
TCTGGATCGCCCATTgctcaataaacagactgtggTTTATGAGCATCGTC
CGAAATTCCCAGTGGTTGTCTTTTGCAACGAAAACCCAGTGGTCAGAGAG
AAGTATGTTGAGTTGTTGACTCAACTAAACGAAACATTCGAATCTATCGA
CCCAGATAAAGCGATGAGTCATGTAGCAGACCCTTCAATATACGGCCACA
GAATCAACGACTCCATTTTAAGGTGTGATTTTCGACATGTTAAGGGAAGT
TGCACACCGACCTCTGACAATGATGCGAATACAAATCTTGGTTGGGGAGA
ATATTGGCAAGGAAGGTACGGTAAATGCTGGTTCTTCAATGCAGACGTTG
AGAATCCGAGACGAGTCACCAGAGCTGGTCATAGAGGTGGATTGCATCTC
CATTTTAATATTGAGCAAGAAAAGTACATTGACAATACTTATAGTGCAGG
ACTAAGAATGTTTGTTGGACTACAAGGTGAAAAATTCGATGTTGAAGAAA
AAGCAATACCAATTGCCCCAGGCAAAAAATACGACATCGCATTAACGAAA
AAATACATCTATCGAGCTGATCCATTCAATAATGGGTCTTGTATGAGAAA
CCAAGACAAGCATATGGTGGAACCTGACAGAAAAAGTGATTTTCACATCG
ACCGAATGACCCATGGATTCTGCTCTAAATTGTGTGCCAATGCAGCTATC
AGGGATGAATGCTCATGTGTGGCTCCCAGCCTACCCTTGGAGTATAGGTT
TAAAGATGTCCCTTTTTGCCCACAAGGTGATCAGTGCTTGGACGAATTGC
TTGAAAAATGGTTTGACGGAAATATGAAATGCGACTGTAACCCACCGTGC
GAAGAAACCTTATTTTCAACATCTGTTTATTCGCAAAACTATCCACAGGA
TATCAGAAGACAACGAGAAATTGCTGAAGGAAAGCCAGATccttcaaaaa
accttttaactgtttcaatattttatgaAGACAAGTCGTTCATTAAAATG
GaagaagaacaattttataccATTGTGAATTTAATTGCTGATATGGGTGG
ACAGTTGGGATTGTTTGGTGGTTTTTCTTTCTTGACGGTAGTTGAGTTCA
CCATCTTGCTTGTAATGATCGTCATTCATCTGGTGATGGTCATCTGTAAA
GGGAAACCTAAAGAATAA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000978XLOC_000978Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001851-proteinTCONS_00001851-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001851-exon-sc0000012-1491911889:949702..949730TCONS_00001851-exon-sc0000012-1491911889:949702..949730Clytia hemisphaericaexon
TCONS_00001851-exon-sc0000012-1510915933:949702..949730TCONS_00001851-exon-sc0000012-1510915933:949702..949730Clytia hemisphaericaexon
TCONS_00001851-exon-sc0000012-1575043694:949702..949730TCONS_00001851-exon-sc0000012-1575043694:949702..949730Clytia hemisphaericaexon
TCONS_00001851-exon-sc0000012-1491911889:950843..952952TCONS_00001851-exon-sc0000012-1491911889:950843..952952Clytia hemisphaericaexon
TCONS_00001851-exon-sc0000012-1510915933:950843..952952TCONS_00001851-exon-sc0000012-1510915933:950843..952952Clytia hemisphaericaexon
TCONS_00001851-exon-sc0000012-1575043694:950843..952952TCONS_00001851-exon-sc0000012-1575043694:950843..952952Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000012supercontigsc0000012:949702..952952 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0.640011 0.744048 1.20563 1.07393 1.41673 0.812254 1.67143 1.96638 1.55342 1.74442 1.80824 1.15384 12.5461 9.78241 1.49827 1.81472 1.60061 1.42704 23.4494 21.5117 4.34187 3.84239 1.1954 2.901 3.24653 5.10424 0.992907 1.15697 1.2171 1.15646
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR001873ENaC
Vocabulary: Biological Process
TermDefinition
GO:0006814sodium ion transport
Vocabulary: Cellular Component
TermDefinition
GO:0016020membrane
Vocabulary: Molecular Function
TermDefinition
GO:0005272sodium channel activity
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006814 sodium ion transport
cellular_component GO:0016020 membrane
molecular_function GO:0005272 sodium channel activity
Blast
BLAST of TCONS_00001851 vs. Swiss-Prot (Human)
Match: ASIC1 (Acid-sensing ion channel 1 OS=Homo sapiens GN=ASIC1 PE=1 SV=3)

HSP 1 Score: 97.0561 bits (240), Expect = 5.551e-21
Identity = 117/459 (25.49%), Postives = 192/459 (41.83%), Query Frame = 3
Query:  243 FAESTSAHGYSPLASTKTI-LGSVVWIISMLAAYIVLILVIQPLITKYLDRPLLNKQTVVYEHRPKFPVVVFCNENPVVREKYV--------ELLTQLNETFE------------SIDPDKAMSHVADPSIY---------GHRINDSILRCDFRHVKGSCTPTSDNDANTNLGWGEYWQGRYGKCWFFNADVEN-PRRVTRAGHRG-GLHLHFNIEQEKYI-------DNTYSAGLRMFVGLQGEKFDVEEKAIPIAPGKKYDIALT-KKYIYRADPFNNGSCMRNQDKHMVEPDRKSDFHIDRMTHGFCSKLCANAAIRDECSCVAPSLPLEYRFKDVPFCP--QGDQCLDELLEKWFDGNMK-CDCNPPCEETLFSTSVYSQNYPQDIRRQ---REIAEGKPDPSKNLLTVSIFYEDKSFIKMEEEQFYTIVNLIADMXXXXXXXXXXXXXTVVEF 1481
            FA S++ HG + + S + + L   +W +  L +  VL+ V    +  Y     + K   V   +  FP V  CN N     +          ELL  LN  +E             I  DKA      P  +         GH I D +L C FR   G      D               RYGKC+ FN+  +  PR  T  G  G GL +  +I+Q++Y+       + ++ AG+++ +  Q E   +++    +APG +  +A   ++ IY   P+  G+C        V  D   DF  D  +   C   C    + + C+C    +P      D P+C   Q  +C D  L+   + + + C C  PC  T +   +     P     +   ++  + +    +N+L + IF+E  ++  +E+++ Y I  L+ D+GGQ+GLF G S LTV+E 
Sbjct:   21 FASSSTLHGLAHIFSYERLSLKRALWALCFLGSLAVLLCVCTERVQYYFHYHHVTKLDEVAASQLTFPAVTLCNLNEFRFSQVSKNDLYHAGELLALLNNRYEIPDTQMADEKQLEILQDKANFRSFKPKPFNMREFYDRAGHDIRDMLLSCHFR---GEVCSAEDFKVVFT---------RYGKCYTFNSGRDGRPRLKTMKGGTGNGLEIMLDIQQDEYLPVWGETDETSFEAGIKVQIHSQDEPPFIDQLGFGVAPGFQTFVACQEQRLIYLPPPW--GTC------KAVTMDSDLDF-FDSYSITACRIDCETRYLVENCNCRMVHMP-----GDAPYCTPEQYKECADPALDFLVEKDQEYCVCEMPCNLTRYGKELSMVKIPSKASAKYLAKKFNKSEQYIGENILVLDIFFEVLNYETIEQKKAYEIAGLLGDIGGQMGLFIGASILTVLEL 453          
The following BLAST results are available for this feature:
BLAST of TCONS_00001851 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
ASIC15.551e-2125.49Acid-sensing ion channel 1 OS=Homo sapiens GN=ASIC... [more]
back to top